A0A087X9I5_POEFO Loading...

Nucleolar protein 10

AlphaFold DB , UniProt , Accession A0A087X9I5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 64 aa.

						>A0A087X9I5_POEFO|A0A087X9I5
MFLQYYLNENGDRVYTLKKATPEGQPTSPAHPARFSPDDKFSRHRVLVKKRFGILLTQQARPIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	81.6	Confident	94	Very high	165 Å²	165	95.1 Å²	95.1	81%	0.813	48%	0.481	S	S	*	.				0	138.7	0	-71.3	-158.1	78.1	0	0	109.5	H31	M1-H31 WeakPolarHBondContact CB-CD2 3.46Å; M1-H31 WeakPolarHBondContact CE-CE1 3.08Å; M1-H31 WeakPolarHBondContact CE-NE2 3.24Å; M1-H31 HydrophobicContact SD-CB 3.84Å; M1-H31 PolarHBondContact SD-CD2 3.11Å; M1-H31 PolarHBondContact SD-CE1 3.25Å; M1-H31 PolarHBondContact SD-ND1 3.23Å; M1-H31 PolarHBondContact SD-NE2 3.33Å
2	F	92.5	Very high	94.2	Very high	169 Å²	169	95 Å²	95	74%	0.741	48%	0.483	S	S	*	.			trans	-84.6	-30.5	-174	-65.5	-69.6	0	0	0	113.3	Q4 L17	F2-Q4 WeakPolarHBondContact O-CG 3.44Å; F2-Q4 PolarHBondContact O-N 3.2Å; F2-Q4 PolarHBondContact O-NE2 3.4Å; F2-Q4 VanDerWaalsContact O-NE2 3.15Å; F2-L17 HydrophobicContact CB-CD2 4.09Å
3	L	97	Very high	94.3	Very high	64 Å²	64	98.1 Å²	98.1	34%	0.335	49%	0.485	S	S	.	.			trans	-62.6	121.7	-176.9	-165.6	67.5	0	0	0	111.3	Y15 L17 A30 H31	L3-Y15 HydrophobicContact CD1-CD1 4.31Å; L3-Y15 HydrophobicContact CD2-CD1 3.99Å; L3-Y15 HydrophobicContact CD2-CE1 4.31Å; L3-Y15 HydrophobicContact CG-CD1 4.03Å; L3-L17 HydrophobicContact CD1-CD2 4.38Å; L3-A30 HydrophobicContact CB-CB 4.06Å; L3-A30 HydrophobicContact CD2-CB 3.8Å; L3-A30 HydrophobicContact CG-CB 3.72Å; L3-A30 WeakPolarHBondContact O-CB 3.42Å; L3-A30 PolarHBondContact O-N 3.26Å; L3-H31 WeakPolarHBondContact CB-NE2 3.45Å
4	Q	97.4	Very high	94.5	Very high	10 Å²	10	94.6 Å²	94.6	5%	0.047	47%	0.472	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	167.6	174.3	-50.6	-60.7	-50.6	0	0	109.8	F2 Y15 T16 K19 T27 S28	F2-Q4 WeakPolarHBondContact O-CG 3.44Å; F2-Q4 PolarHBondContact O-N 3.2Å; F2-Q4 PolarHBondContact O-NE2 3.4Å; F2-Q4 VanDerWaalsContact O-NE2 3.15Å; Q4-Y15 WeakPolarHBondContact O-CA 3.41Å; Q4-T16 CarbonylContact C-O 3.46Å; Q4-T16 WeakPolarHBondContact CA-O 3.03Å; Q4-T16 HydrophobicContact CB-CG2 4.12Å; Q4-T16 WeakPolarHBondContact CB-O 3.41Å; Q4-T16 PolarHBondContact N-O 2.9Å; Q4-T16 PolarHBondContact O-N 3.06Å; Q4-T16 VanDerWaalsContact O-O 3.08Å; Q4-K19 HydrophobicContact CG-CD 4.36Å; Q4-T27 HydrophobicContact CB-CG2 4.47Å; Q4-T27 WeakPolarHBondContact CB-OG1 3.21Å; Q4-T27 WeakPolarHBondContact CG-OG1 3.34Å; Q4-S28 CarbonylContact C-O 3.54Å; Q4-S28 WeakPolarHBondContact CA-O 3.17Å; Q4-S28 WeakPolarHBondContact CB-O 3.43Å; Q4-S28 VanDerWaalsContact OE1-C 3.22Å; Q4-S28 PolarHBondContact OE1-O 3.01Å
5	Y	97.1	Very high	94.7	Very high	46 Å²	46	96.9 Å²	96.9	18%	0.18	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.9	162.8	169.4	79.9	-74.8	0	0	0	111.4	L7 R13 V14 S28 P29 A30	Y5-L7 HydrophobicContact CD2-CD2 4.35Å; Y5-L7 HydrophobicContact CE2-CD2 3.97Å; Y5-L7 HydrophobicContact CE2-CG 4.39Å; Y5-R13 HydrophobicContact CD2-CB 3.87Å; Y5-R13 HydrophobicContact CD2-CG 3.58Å; Y5-R13 HydrophobicContact CE2-CG 3.84Å; Y5-R13 HydrophobicContact CG-CB 4.45Å; Y5-R13 HydrophobicContact CG-CG 4.43Å; Y5-V14 WeakPolarHBondContact CA-O 3.43Å; Y5-S28 WeakPolarHBondContact CD1-O 3.4Å; Y5-S28 PolarHBondContact N-O 3.21Å; Y5-S28 PolarHBondContact O-N 3.45Å; Y5-P29 WeakPolarHBondContact CE1-O 3.48Å; Y5-A30 HydrophobicContact CD1-CB 4.3Å
6	Y	97	Very high	94.8	Very high	62 Å²	62	92.7 Å²	92.7	24%	0.243	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	167.2	163.1	63.4	-82.8	0	0	0	109.2	R13 V14 T16 T21	Y6-R13 WeakPolarHBondContact O-CA 3.44Å; Y6-V14 HydrophobicContact CD1-CB 4.25Å; Y6-V14 HydrophobicContact CD2-CB 4.47Å; Y6-V14 HydrophobicContact CE1-CB 3.75Å; Y6-V14 HydrophobicContact CE1-CG1 3.71Å; Y6-V14 HydrophobicContact CE2-CB 4Å; Y6-V14 HydrophobicContact CE2-CG1 4.46Å; Y6-V14 HydrophobicContact CE2-CG2 4.24Å; Y6-V14 PolarHBondContact N-O 3.12Å; Y6-V14 VanDerWaalsContact N-O 3.12Å; Y6-V14 PolarHBondContact O-N 3.16Å; Y6-V14 WeakPolarHBondContact OH-CG1 3.47Å; Y6-T16 HydrophobicContact CD1-CG2 4.32Å; Y6-T21 VanDerWaalsContact CB-CG2 3.49Å; Y6-T21 HydrophobicContact CD1-CG2 3.99Å; Y6-T21 HydrophobicContact CD2-CG2 4.1Å; Y6-T21 HydrophobicContact CG-CG2 3.6Å
7	L	96.3	Very high	94.9	Very high	104 Å²	104	94.5 Å²	94.5	55%	0.545	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.8	131.1	176.3	-61.7	177.6	0	0	0	109.1	Y5 D12 R13	Y5-L7 HydrophobicContact CD2-CD2 4.35Å; Y5-L7 HydrophobicContact CE2-CD2 3.97Å; Y5-L7 HydrophobicContact CE2-CG 4.39Å; L7-D12 WeakPolarHBondContact CA-O 3.49Å; L7-R13 HydrophobicContact CD2-CG 4.01Å
8	N	93.1	Very high	94.9	Very high	52 Å²	52	97.7 Å²	97.7	28%	0.278	48%	0.478	S	S	.	.			trans	-77.3	179	169.2	70.4	2.9	0	0	0	110.4	N10 G11 D12 V14	N8-N10 PolarHBondContact O-N 3.4Å; N8-N10 WeakPolarHBondContact OD1-CA 3.43Å; N8-N10 WeakPolarHBondContact OD1-CB 3.36Å; N8-N10 PolarHBondContact OD1-N 3.25Å; N8-G11 PolarHBondContact O-N 3.47Å; N8-G11 PolarHBondContact OD1-N 2.98Å; N8-D12 PolarHBondContact N-O 2.99Å; N8-D12 PolarHBondContact ND2-OD2 3.42Å; N8-D12 WeakPolarHBondContact OD1-CA 3.21Å; N8-D12 PolarHBondContact OD1-N 2.95Å; N8-D12 PolarHBondContact OD1-O 2.75Å; N8-V14 HydrophobicContact CB-CG2 4.06Å
9	E	93.9	Very high	94.9	Very high	194 Å²	194	99.7 Å²	99.7	91%	0.907	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.2	-27.7	177.7	-61.8	178.1	176.4	0	0	113.2	G11	E9-G11 VanDerWaalsContact C-N 3.3Å
10	N	94.6	Very high	95	Very high	132 Å²	132	97 Å²	97	71%	0.706	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.6	-7.3	177	-60.3	-22.7	0	0	0	113.1	N8	N8-N10 PolarHBondContact O-N 3.4Å; N8-N10 WeakPolarHBondContact OD1-CA 3.43Å; N8-N10 WeakPolarHBondContact OD1-CB 3.36Å; N8-N10 PolarHBondContact OD1-N 3.25Å
11	G	93.8	Very high	94.9	Very high	48 Å²	48	93.1 Å²	93.1	50%	0.495	46%	0.46	S	S	.	.	S	Bend	trans	82.4	9.3	-174.7	0	0	0	0	0	114.9	N8 E9	N8-G11 PolarHBondContact O-N 3.47Å; N8-G11 PolarHBondContact OD1-N 2.98Å; E9-G11 VanDerWaalsContact C-N 3.3Å
12	D	96.1	Very high	95.5	Very high	94 Å²	94	90.7 Å²	90.7	50%	0.503	46%	0.457	S	S	.	.	P	Polyproline II helix	trans	-80.8	150.3	175	-54.2	-53	0	0	0	111.7	L7 N8 V14	L7-D12 WeakPolarHBondContact CA-O 3.49Å; N8-D12 PolarHBondContact N-O 2.99Å; N8-D12 PolarHBondContact ND2-OD2 3.42Å; N8-D12 WeakPolarHBondContact OD1-CA 3.21Å; N8-D12 PolarHBondContact OD1-N 2.95Å; N8-D12 PolarHBondContact OD1-O 2.75Å; D12-V14 PolarHBondContact O-N 3.46Å
13	R	95.9	Very high	95.5	Very high	135 Å²	135	89.8 Å²	89.8	51%	0.509	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	119.2	176.5	-61.2	-173.9	179.3	178.3	-0.7	110.7	Y5 Y6 L7 Y15	Y5-R13 HydrophobicContact CD2-CB 3.87Å; Y5-R13 HydrophobicContact CD2-CG 3.58Å; Y5-R13 HydrophobicContact CE2-CG 3.84Å; Y5-R13 HydrophobicContact CG-CB 4.45Å; Y5-R13 HydrophobicContact CG-CG 4.43Å; Y6-R13 WeakPolarHBondContact O-CA 3.44Å; L7-R13 HydrophobicContact CD2-CG 4.01Å; R13-Y15 HydrophobicContact CB-CE2 4.24Å
14	V	96.6	Very high	95.4	Very high	50 Å²	50	89.4 Å²	89.4	30%	0.303	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	116.6	168.3	-176.2	0	0	0	0	109.1	Y5 Y6 N8 D12	Y5-V14 WeakPolarHBondContact CA-O 3.43Å; Y6-V14 HydrophobicContact CD1-CB 4.25Å; Y6-V14 HydrophobicContact CD2-CB 4.47Å; Y6-V14 HydrophobicContact CE1-CB 3.75Å; Y6-V14 HydrophobicContact CE1-CG1 3.71Å; Y6-V14 HydrophobicContact CE2-CB 4Å; Y6-V14 HydrophobicContact CE2-CG1 4.46Å; Y6-V14 HydrophobicContact CE2-CG2 4.24Å; Y6-V14 PolarHBondContact N-O 3.12Å; Y6-V14 VanDerWaalsContact N-O 3.12Å; Y6-V14 PolarHBondContact O-N 3.16Å; Y6-V14 WeakPolarHBondContact OH-CG1 3.47Å; N8-V14 HydrophobicContact CB-CG2 4.06Å; D12-V14 PolarHBondContact O-N 3.46Å
15	Y	97.1	Very high	95.2	Very high	128 Å²	128	94.2 Å²	94.2	50%	0.502	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	143.5	-176.7	-67.1	-77.9	0	0	0	112.4	L3 Q4 R13 A30	L3-Y15 HydrophobicContact CD1-CD1 4.31Å; L3-Y15 HydrophobicContact CD2-CD1 3.99Å; L3-Y15 HydrophobicContact CD2-CE1 4.31Å; L3-Y15 HydrophobicContact CG-CD1 4.03Å; Q4-Y15 WeakPolarHBondContact O-CA 3.41Å; R13-Y15 HydrophobicContact CB-CE2 4.24Å; Y15-A30 HydrophobicContact CD1-CB 4.08Å; Y15-A30 HydrophobicContact CE1-CB 3.83Å
16	T	96.5	Very high	95.2	Very high	30 Å²	30	97.5 Å²	97.5	18%	0.184	52%	0.516	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.8	162.3	-179.6	-175.8	0	0	0	0	111.3	Q4 Y6 K18 T27	Q4-T16 CarbonylContact C-O 3.46Å; Q4-T16 WeakPolarHBondContact CA-O 3.03Å; Q4-T16 HydrophobicContact CB-CG2 4.12Å; Q4-T16 WeakPolarHBondContact CB-O 3.41Å; Q4-T16 PolarHBondContact N-O 2.9Å; Q4-T16 PolarHBondContact O-N 3.06Å; Q4-T16 VanDerWaalsContact O-O 3.08Å; Y6-T16 HydrophobicContact CD1-CG2 4.32Å; T16-K18 PolarHBondContact OG1-N 2.92Å; T16-K18 VanDerWaalsContact OG1-N 3.1Å; T16-T27 HydrophobicContact CG2-CG2 3.87Å
17	L	96.3	Very high	95.1	Very high	124 Å²	124	95.3 Å²	95.3	65%	0.649	51%	0.509	S	S	*	.	S	Bend	trans	-99.7	-10.6	168.9	-61.3	177.5	0	0	0	112.2	F2 L3	F2-L17 HydrophobicContact CB-CD2 4.09Å; L3-L17 HydrophobicContact CD1-CD2 4.38Å
18	K	95.9	Very high	95.1	Very high	152 Å²	152	93.1 Å²	93.1	66%	0.661	50%	0.503	S	S	*	.	S	Bend	trans	-71.6	152.1	177.8	-61.4	-176.6	179.9	-179.8	0	110.1	T16 T27	T16-K18 PolarHBondContact OG1-N 2.92Å; T16-K18 VanDerWaalsContact OG1-N 3.1Å; K18-T27 PolarHBondContact O-OG1 3Å; K18-T27 VanDerWaalsContact O-OG1 3.11Å
19	K	94.8	Very high	95.3	Very high	135 Å²	135	94.5 Å²	94.5	59%	0.587	51%	0.514	S	S	*	.	S	Bend	trans	-87.4	-11.3	176.8	-63.5	-58.8	-174.2	177.1	0	114	Q4 T27	Q4-K19 HydrophobicContact CG-CD 4.36Å; K19-T27 WeakPolarHBondContact CA-OG1 3.49Å; K19-T27 PolarHBondContact O-N 2.89Å; K19-T27 PolarHBondContact O-OG1 2.77Å
20	A	96.1	Very high	95.4	Very high	45 Å²	45	86 Å²	86	37%	0.372	48%	0.477	S	S	.	.	B	Isolated β-bridge	trans	-126.3	146.8	178.1	0	0	0	0	0	110.6	Q25	A20-Q25 CarbonylContact C-O 3.41Å; A20-Q25 WeakPolarHBondContact CA-O 3.46Å
21	T	93.9	Very high	95.4	Very high	16 Å²	16	82.7 Å²	82.7	10%	0.098	46%	0.458	C	S	.	.			trans	-70.6	168.3	170.1	67	0	0	0	0	110.3	Y6 E23 G24 Q25 T27	Y6-T21 VanDerWaalsContact CB-CG2 3.49Å; Y6-T21 HydrophobicContact CD1-CG2 3.99Å; Y6-T21 HydrophobicContact CD2-CG2 4.1Å; Y6-T21 HydrophobicContact CG-CG2 3.6Å; T21-E23 PolarHBondContact O-N 3.1Å; T21-E23 VanDerWaalsContact O-N 3.16Å; T21-E23 PolarHBondContact OG1-N 3.39Å; T21-G24 PolarHBondContact O-N 3.04Å; T21-G24 PolarHBondContact OG1-N 3.03Å; T21-Q25 HydrophobicContact CG2-CB 4.24Å; T21-Q25 WeakPolarHBondContact CG2-O 3.45Å; T21-Q25 PolarHBondContact N-O 2.92Å; T21-Q25 WeakPolarHBondContact OG1-CB 3.35Å; T21-Q25 PolarHBondContact OG1-N 3.47Å; T21-Q25 PolarHBondContact OG1-O 2.81Å; T21-T27 HydrophobicContact CG2-CG2 4.06Å
22	P	93.3	Very high	95.5	Very high	115 Å²	115	86.1 Å²	86.1	75%	0.747	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.6	-28.5	172	-26.9	36.6	0	0	0	113.9	G24	P22-G24 VanDerWaalsContact C-N 3.32Å
23	E	93	Very high	95.3	Very high	149 Å²	149	86.4 Å²	86.4	70%	0.696	49%	0.486	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.6	0	176.8	-61.7	174.1	-168.7	0	0	113.7	T21 Q25	T21-E23 PolarHBondContact O-N 3.1Å; T21-E23 VanDerWaalsContact O-N 3.16Å; T21-E23 PolarHBondContact OG1-N 3.39Å; E23-Q25 PolarHBondContact OE2-NE2 3.41Å
24	G	93.8	Very high	95.3	Very high	57 Å²	57	89.6 Å²	89.6	59%	0.588	50%	0.498	S	S	*	.	S	Bend	trans	84.7	2.8	180	0	0	0	0	0	115.3	T21 P22	T21-G24 PolarHBondContact O-N 3.04Å; T21-G24 PolarHBondContact OG1-N 3.03Å; P22-G24 VanDerWaalsContact C-N 3.32Å
25	Q	94	Very high	95.2	Very high	111 Å²	111	95.3 Å²	95.3	52%	0.519	52%	0.519	S	S	.	.	P	Polyproline II helix	trans	-74.7	149.6	176.7	-59.2	179.3	23	0	0	111.1	A20 T21 E23	A20-Q25 CarbonylContact C-O 3.41Å; A20-Q25 WeakPolarHBondContact CA-O 3.46Å; T21-Q25 HydrophobicContact CG2-CB 4.24Å; T21-Q25 WeakPolarHBondContact CG2-O 3.45Å; T21-Q25 PolarHBondContact N-O 2.92Å; T21-Q25 WeakPolarHBondContact OG1-CB 3.35Å; T21-Q25 PolarHBondContact OG1-N 3.47Å; T21-Q25 PolarHBondContact OG1-O 2.81Å; E23-Q25 PolarHBondContact OE2-NE2 3.41Å
26	P	96.3	Very high	95	Very high	115 Å²	115	91 Å²	91	75%	0.747	51%	0.508	S	S	*	.	B	Isolated β-bridge	trans	-68	136.2	179.3	27.7	-34.4	0	0	0	112
27	T	96.6	Very high	95	Very high	16 Å²	16	95.2 Å²	95.2	10%	0.098	54%	0.536	C	S	.	.	P	Polyproline II helix	trans	-81.5	154.1	175.4	58.8	0	0	0	0	112	Q4 T16 K18 K19 T21	Q4-T27 HydrophobicContact CB-CG2 4.47Å; Q4-T27 WeakPolarHBondContact CB-OG1 3.21Å; Q4-T27 WeakPolarHBondContact CG-OG1 3.34Å; T16-T27 HydrophobicContact CG2-CG2 3.87Å; K18-T27 PolarHBondContact O-OG1 3Å; K18-T27 VanDerWaalsContact O-OG1 3.11Å; K19-T27 WeakPolarHBondContact CA-OG1 3.49Å; K19-T27 PolarHBondContact O-N 2.89Å; K19-T27 PolarHBondContact O-OG1 2.77Å; T21-T27 HydrophobicContact CG2-CG2 4.06Å
28	S	96.1	Very high	95	Very high	58 Å²	58	94.9 Å²	94.9	41%	0.406	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	149.7	177.1	-70.6	0	0	0	0	112.6	Q4 Y5 A30	Q4-S28 CarbonylContact C-O 3.54Å; Q4-S28 WeakPolarHBondContact CA-O 3.17Å; Q4-S28 WeakPolarHBondContact CB-O 3.43Å; Q4-S28 VanDerWaalsContact OE1-C 3.22Å; Q4-S28 PolarHBondContact OE1-O 3.01Å; Y5-S28 WeakPolarHBondContact CD1-O 3.4Å; Y5-S28 PolarHBondContact N-O 3.21Å; Y5-S28 PolarHBondContact O-N 3.45Å; S28-A30 PolarHBondContact O-N 3.19Å
29	P	96.3	Very high	94.9	Very high	81 Å²	81	89.7 Å²	89.7	53%	0.526	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.3	132.9	175.4	27.3	-33.5	0	0	0	110.8	Y5 H31	Y5-P29 WeakPolarHBondContact CE1-O 3.48Å; P29-H31 PolarHBondContact O-N 2.78Å
30	A	96.4	Very high	95	Very high	16 Å²	16	91 Å²	91	13%	0.132	52%	0.52	C	S	.	.	S	Bend	trans	-69.9	-13.5	-178.7	0	0	0	0	0	114.1	L3 Y5 Y15 S28	L3-A30 HydrophobicContact CB-CB 4.06Å; L3-A30 HydrophobicContact CD2-CB 3.8Å; L3-A30 HydrophobicContact CG-CB 3.72Å; L3-A30 WeakPolarHBondContact O-CB 3.42Å; L3-A30 PolarHBondContact O-N 3.26Å; Y5-A30 HydrophobicContact CD1-CB 4.3Å; Y15-A30 HydrophobicContact CD1-CB 4.08Å; Y15-A30 HydrophobicContact CE1-CB 3.83Å; S28-A30 PolarHBondContact O-N 3.19Å
31	H	94.5	Very high	95	Very high	62 Å²	62	95.8 Å²	95.8	29%	0.287	53%	0.532	S	S	.	.	S	Bend	trans	-103.3	143.5	-171.4	-55	-75.2	0	0	0	111.2	M1 L3 P29	M1-H31 WeakPolarHBondContact CB-CD2 3.46Å; M1-H31 WeakPolarHBondContact CE-CE1 3.08Å; M1-H31 WeakPolarHBondContact CE-NE2 3.24Å; M1-H31 HydrophobicContact SD-CB 3.84Å; M1-H31 PolarHBondContact SD-CD2 3.11Å; M1-H31 PolarHBondContact SD-CE1 3.25Å; M1-H31 PolarHBondContact SD-ND1 3.23Å; M1-H31 PolarHBondContact SD-NE2 3.33Å; L3-H31 WeakPolarHBondContact CB-NE2 3.45Å; P29-H31 PolarHBondContact O-N 2.78Å
32	P	95.4	Very high	95.1	Very high	120 Å²	120	97.5 Å²	97.5	78%	0.779	55%	0.545	S	S	*	.	P	Polyproline II helix	trans	-65.4	157	177.3	29.2	-35.2	0	0	0	111.2
33	A	93.4	Very high	95.3	Very high	99 Å²	99	100.2 Å²	100.2	82%	0.818	54%	0.541	S	S	*	.	P	Polyproline II helix	trans	-59.2	143.2	168.5	0	0	0	0	0	110.4	F35	A33-F35 PolarHBondContact O-N 3.19Å
34	R	94.3	Very high	95.5	Very high	203 Å²	203	97.6 Å²	97.6	77%	0.766	53%	0.528	S	S	*	.	P	Polyproline II helix	trans	-60.8	128.9	-179.7	-173.6	-179.4	66.3	72.2	-1.7	110.7	S36	R34-S36 VanDerWaalsContact CZ-OG 3.26Å; R34-S36 PolarHBondContact NH1-OG 3.35Å; R34-S36 PolarHBondContact NH2-OG 3.3Å; R34-S36 VanDerWaalsContact NH2-OG 3.13Å
35	F	94.8	Very high	95.6	Very high	169 Å²	169	100.6 Å²	100.6	74%	0.741	52%	0.522	S	S	*	.	P	Polyproline II helix	trans	-71.5	136.8	170.9	-179.2	-106.4	0	0	0	110.8	A33 P37	A33-F35 PolarHBondContact O-N 3.19Å; F35-P37 HydrophobicContact CE1-CG 4.07Å
36	S	94.1	Very high	95.7	Very high	37 Å²	37	98.8 Å²	98.8	26%	0.259	52%	0.518	S	S	.	.			trans	-129	124.6	172.2	-60.9	0	0	0	0	108.2	R34 D38 D39	R34-S36 VanDerWaalsContact CZ-OG 3.26Å; R34-S36 PolarHBondContact NH1-OG 3.35Å; R34-S36 PolarHBondContact NH2-OG 3.3Å; R34-S36 VanDerWaalsContact NH2-OG 3.13Å; S36-D38 VanDerWaalsContact C-N 3.28Å; S36-D38 PolarHBondContact O-N 3.15Å; S36-D39 PolarHBondContact O-N 3.35Å
37	P	95.9	Very high	95.7	Very high	120 Å²	120	97.6 Å²	97.6	78%	0.779	51%	0.505	S	S	*	.	S	Bend	trans	-59.4	-37.2	178.4	-26.3	34.7	0	0	0	113.8	F35	F35-P37 HydrophobicContact CE1-CG 4.07Å
38	D	96	Very high	95.7	Very high	117 Å²	117	99.7 Å²	99.7	63%	0.626	52%	0.518	S	S	*	.	S	Bend	trans	-71.8	-30.7	-178.3	-180	47.4	0	0	0	113.6	S36 K40	S36-D38 VanDerWaalsContact C-N 3.28Å; S36-D38 PolarHBondContact O-N 3.15Å; D38-K40 PolarHBondContact O-N 3.35Å; D38-K40 VanDerWaalsContact O-N 3.08Å; D38-K40 WeakPolarHBondContact OD2-CE 3.45Å; D38-K40 WeakPolarHBondContact OD2-CG 3.38Å
39	D	94.8	Very high	95.7	Very high	42 Å²	42	101.3 Å²	101.3	23%	0.225	52%	0.517	C	S	.	.			trans	23.5	68.5	179.7	-174.6	24.8	0	0	0	116	S36 F41 S42 R45	S36-D39 PolarHBondContact O-N 3.35Å; D39-F41 PolarHBondContact O-N 2.84Å; D39-S42 VanDerWaalsContact O-CB 3.23Å; D39-S42 WeakPolarHBondContact O-CB 3.5Å; D39-S42 PolarHBondContact O-N 3.12Å; D39-S42 PolarHBondContact O-OG 3.34Å; D39-S42 VanDerWaalsContact O-OG 3.07Å; D39-S42 PolarHBondContact OD1-N 3.48Å; D39-S42 WeakPolarHBondContact OD2-CA 3.45Å; D39-S42 VanDerWaalsContact OD2-CB 3.25Å; D39-S42 WeakPolarHBondContact OD2-CB 3.27Å; D39-R45 VanDerWaalsContact CG-NH1 3.27Å; D39-R45 IonicContact OD1-NH1 3.18Å; D39-R45 PolarHBondContact OD1-NH1 3.44Å; D39-R45 IonicContact OD2-CZ 3.07Å; D39-R45 IonicContact OD2-NH1 2.65Å; D39-R45 PolarHBondContact OD2-NH1 2.99Å; D39-R45 IonicContact OD2-NH2 2.64Å; D39-R45 PolarHBondContact OD2-NH2 3.26Å
40	K	96.3	Very high	95.8	Very high	163 Å²	163	103.5 Å²	103.5	71%	0.709	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.2	-23.1	-178.3	-60.4	-175.6	179.7	-177.9	0	114.3	D38	D38-K40 PolarHBondContact O-N 3.35Å; D38-K40 VanDerWaalsContact O-N 3.08Å; D38-K40 WeakPolarHBondContact OD2-CE 3.45Å; D38-K40 WeakPolarHBondContact OD2-CG 3.38Å
41	F	96	Very high	95.8	Very high	145 Å²	145	111.8 Å²	111.8	64%	0.636	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.4	12	-178.4	-57.7	-72.8	0	0	0	113.6	D39 R43 H44 R45	D39-F41 PolarHBondContact O-N 2.84Å; F41-R43 VanDerWaalsContact C-N 3.31Å; F41-R43 PolarHBondContact O-N 3.32Å; F41-H44 AromaticContact CD1-ND1 3.88Å; F41-H44 PolarHBondContact O-N 2.99Å; F41-R45 PolarHBondContact O-N 3.13Å
42	S	96	Very high	95.9	Very high	53 Å²	53	115.8 Å²	115.8	37%	0.371	56%	0.563	S	S	.	*	H	α-helix	trans	-48.9	-49.2	176.5	55.3	0	0	0	0	112.6	D39 H44 R45 V46	D39-S42 VanDerWaalsContact O-CB 3.23Å; D39-S42 WeakPolarHBondContact O-CB 3.5Å; D39-S42 PolarHBondContact O-N 3.12Å; D39-S42 PolarHBondContact O-OG 3.34Å; D39-S42 VanDerWaalsContact O-OG 3.07Å; D39-S42 PolarHBondContact OD1-N 3.48Å; D39-S42 WeakPolarHBondContact OD2-CA 3.45Å; D39-S42 VanDerWaalsContact OD2-CB 3.25Å; D39-S42 WeakPolarHBondContact OD2-CB 3.27Å; S42-H44 VanDerWaalsContact C-N 3.34Å; S42-H44 PolarHBondContact O-N 2.64Å; S42-R45 PolarHBondContact O-N 2.83Å; S42-V46 WeakPolarHBondContact O-CG2 3.42Å; S42-V46 PolarHBondContact O-N 3.17Å
43	R	96.6	Very high	95.8	Very high	172 Å²	172	111.7 Å²	111.7	65%	0.649	54%	0.543	S	S	*	.	H	α-helix	trans	-55	-46.9	177.2	-173.6	178.5	72.7	170.4	1.3	112.1	F41 V46 L47	F41-R43 VanDerWaalsContact C-N 3.31Å; F41-R43 PolarHBondContact O-N 3.32Å; R43-V46 PolarHBondContact O-N 3.41Å; R43-L47 HydrophobicContact CG-CD1 4.03Å; R43-L47 WeakPolarHBondContact O-CB 3.28Å; R43-L47 VanDerWaalsContact O-CG 3.26Å; R43-L47 WeakPolarHBondContact O-CG 3.25Å; R43-L47 PolarHBondContact O-N 3.28Å
44	H	97.6	Very high	95.9	Very high	93 Å²	93	111.5 Å²	111.5	43%	0.431	53%	0.527	S	S	.	.	H	α-helix	trans	-65.8	-43.2	-179.1	-59.2	92.4	0	0	0	111.2	F41 S42 V46 L47 V48	F41-H44 AromaticContact CD1-ND1 3.88Å; F41-H44 PolarHBondContact O-N 2.99Å; S42-H44 VanDerWaalsContact C-N 3.34Å; S42-H44 PolarHBondContact O-N 2.64Å; H44-V46 PolarHBondContact O-N 3.37Å; H44-L47 PolarHBondContact O-N 3.21Å; H44-V48 VanDerWaalsContact O-CG2 3.28Å; H44-V48 WeakPolarHBondContact O-CG2 3.37Å; H44-V48 PolarHBondContact O-N 3.01Å
45	R	95.9	Very high	95.9	Very high	120 Å²	120	103.6 Å²	103.6	45%	0.453	50%	0.5	S	S	.	.	H	α-helix	trans	-60.7	-44.8	177.4	-173.8	176.6	64.7	-109	-1.9	111.8	D39 F41 S42 K49	D39-R45 VanDerWaalsContact CG-NH1 3.27Å; D39-R45 IonicContact OD1-NH1 3.18Å; D39-R45 PolarHBondContact OD1-NH1 3.44Å; D39-R45 IonicContact OD2-CZ 3.07Å; D39-R45 IonicContact OD2-NH1 2.65Å; D39-R45 PolarHBondContact OD2-NH1 2.99Å; D39-R45 IonicContact OD2-NH2 2.64Å; D39-R45 PolarHBondContact OD2-NH2 3.26Å; F41-R45 PolarHBondContact O-N 3.13Å; S42-R45 PolarHBondContact O-N 2.83Å; R45-K49 WeakPolarHBondContact O-CG 3.42Å; R45-K49 PolarHBondContact O-N 2.9Å; R45-K49 VanDerWaalsContact O-N 3.13Å
46	V	95.9	Very high	95.7	Very high	73 Å²	73	102.6 Å²	102.6	44%	0.442	50%	0.502	S	S	.	.	H	α-helix	trans	-66.3	-42.9	178.7	174.1	0	0	0	0	111.4	S42 R43 H44 V48 K49 K50	S42-V46 WeakPolarHBondContact O-CG2 3.42Å; S42-V46 PolarHBondContact O-N 3.17Å; R43-V46 PolarHBondContact O-N 3.41Å; H44-V46 PolarHBondContact O-N 3.37Å; V46-V48 PolarHBondContact O-N 3.34Å; V46-K49 PolarHBondContact O-N 3.27Å; V46-K50 WeakPolarHBondContact O-CB 3.26Å; V46-K50 PolarHBondContact O-N 3.28Å
47	L	97.1	Very high	95.6	Very high	91 Å²	91	107.1 Å²	107.1	48%	0.476	53%	0.528	S	S	.	.	H	α-helix	trans	-61.6	-43	177.4	-74.6	173.2	0	0	0	112.4	R43 H44 K50 R51	R43-L47 HydrophobicContact CG-CD1 4.03Å; R43-L47 WeakPolarHBondContact O-CB 3.28Å; R43-L47 VanDerWaalsContact O-CG 3.26Å; R43-L47 WeakPolarHBondContact O-CG 3.25Å; R43-L47 PolarHBondContact O-N 3.28Å; H44-L47 PolarHBondContact O-N 3.21Å; L47-K50 PolarHBondContact O-N 3.13Å; L47-R51 WeakPolarHBondContact O-CG 3.44Å; L47-R51 PolarHBondContact O-N 2.98Å
48	V	97.3	Very high	95.4	Very high	59 Å²	59	105.5 Å²	105.5	36%	0.358	51%	0.51	S	S	.	.	H	α-helix	trans	-59.2	-49.5	174.8	172.1	0	0	0	0	110.4	H44 V46 K50 R51 F52	H44-V48 VanDerWaalsContact O-CG2 3.28Å; H44-V48 WeakPolarHBondContact O-CG2 3.37Å; H44-V48 PolarHBondContact O-N 3.01Å; V46-V48 PolarHBondContact O-N 3.34Å; V48-K50 VanDerWaalsContact C-N 3.29Å; V48-K50 PolarHBondContact O-N 3.48Å; V48-R51 PolarHBondContact O-N 3.35Å; V48-F52 HydrophobicContact CG1-CD2 3.94Å; V48-F52 HydrophobicContact CG1-CE2 3.97Å; V48-F52 VanDerWaalsContact O-CD2 3.27Å; V48-F52 WeakPolarHBondContact O-CD2 3.23Å; V48-F52 PolarHBondContact O-N 2.98Å
49	K	96.3	Very high	95	Very high	92 Å²	92	105 Å²	105	40%	0.4	50%	0.504	S	S	.	.	H	α-helix	trans	-58.2	-41	177.2	-72.2	-175	178.1	-166	0	112.4	R45 V46 F52 G53 I54 L55	R45-K49 WeakPolarHBondContact O-CG 3.42Å; R45-K49 PolarHBondContact O-N 2.9Å; R45-K49 VanDerWaalsContact O-N 3.13Å; V46-K49 PolarHBondContact O-N 3.27Å; K49-F52 PolarHBondContact O-N 3.46Å; K49-G53 PolarHBondContact O-N 2.99Å; K49-I54 PolarHBondContact O-N 3.03Å; K49-L55 HydrophobicContact CB-CD2 3.62Å; K49-L55 HydrophobicContact CB-CG 4.04Å; K49-L55 HydrophobicContact CD-CD2 4.18Å
50	K	96.5	Very high	94.7	Very high	127 Å²	127	107.5 Å²	107.5	55%	0.552	53%	0.53	S	S	*	.	H	α-helix	trans	-61.8	-43.5	177.8	-170.2	175.3	177.9	178.7	0	112.2	V46 L47 V48 F52 G53 L55 Q58	V46-K50 WeakPolarHBondContact O-CB 3.26Å; V46-K50 PolarHBondContact O-N 3.28Å; L47-K50 PolarHBondContact O-N 3.13Å; V48-K50 VanDerWaalsContact C-N 3.29Å; V48-K50 PolarHBondContact O-N 3.48Å; K50-F52 VanDerWaalsContact C-N 3.29Å; K50-F52 PolarHBondContact O-N 3.44Å; K50-G53 PolarHBondContact O-N 3.22Å; K50-L55 HydrophobicContact CB-CD1 3.71Å; K50-L55 HydrophobicContact CB-CG 4.46Å; K50-L55 HydrophobicContact CG-CD1 4.03Å; K50-Q58 PolarHBondContact O-NE2 3.05Å; K50-Q58 PolarHBondContact O-OE1 3.29Å
51	R	97	Very high	94.2	Very high	191 Å²	191	110.9 Å²	110.9	72%	0.721	54%	0.539	S	S	*	.	H	α-helix	trans	-61.5	-36.3	179.2	-73.7	-170.6	-61.5	175.2	2.7	112.6	L47 V48	L47-R51 WeakPolarHBondContact O-CG 3.44Å; L47-R51 PolarHBondContact O-N 2.98Å; V48-R51 PolarHBondContact O-N 3.35Å
52	F	96.7	Very high	93.6	Very high	145 Å²	145	109.5 Å²	109.5	64%	0.636	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.9	4.8	-180	-68.5	-70.7	0	0	0	114	V48 K49 K50 I54	V48-F52 HydrophobicContact CG1-CD2 3.94Å; V48-F52 HydrophobicContact CG1-CE2 3.97Å; V48-F52 VanDerWaalsContact O-CD2 3.27Å; V48-F52 WeakPolarHBondContact O-CD2 3.23Å; V48-F52 PolarHBondContact O-N 2.98Å; K49-F52 PolarHBondContact O-N 3.46Å; K50-F52 VanDerWaalsContact C-N 3.29Å; K50-F52 PolarHBondContact O-N 3.44Å; F52-I54 VanDerWaalsContact C-N 3.26Å; F52-I54 HydrophobicContact CB-CD1 3.56Å; F52-I54 HydrophobicContact CB-CG1 3.76Å; F52-I54 HydrophobicContact CG-CD1 4.42Å; F52-I54 PolarHBondContact O-N 3.07Å
53	G	94.4	Very high	93	Very high	35 Å²	35	115 Å²	115	36%	0.361	57%	0.568	S	S	.	*	T	Hydrogen-bonded Turn	trans	68.9	20.8	179.2	0	0	0	0	0	114.6	K49 K50	K49-G53 PolarHBondContact O-N 2.99Å; K50-G53 PolarHBondContact O-N 3.22Å
54	I	94.6	Very high	91.8	Very high	94 Å²	94	118 Å²	118	48%	0.482	60%	0.595	S	S	.	*			trans	-89.6	-7.8	-173.3	-52.6	167.7	0	0	0	111.4	K49 F52 L56	K49-I54 PolarHBondContact O-N 3.03Å; F52-I54 VanDerWaalsContact C-N 3.26Å; F52-I54 HydrophobicContact CB-CD1 3.56Å; F52-I54 HydrophobicContact CB-CG1 3.76Å; F52-I54 HydrophobicContact CG-CD1 4.42Å; F52-I54 PolarHBondContact O-N 3.07Å; I54-L56 PolarHBondContact O-N 2.65Å
55	L	93.6	Very high	91.5	Very high	37 Å²	37	119.3 Å²	119.3	19%	0.194	60%	0.604	C	S	.	*	S	Bend	trans	-66.9	137.6	176.7	-62.9	175.1	0	0	0	109.9	K49 K50 T57 Q58 Q59	K49-L55 HydrophobicContact CB-CD2 3.62Å; K49-L55 HydrophobicContact CB-CG 4.04Å; K49-L55 HydrophobicContact CD-CD2 4.18Å; K50-L55 HydrophobicContact CB-CD1 3.71Å; K50-L55 HydrophobicContact CB-CG 4.46Å; K50-L55 HydrophobicContact CG-CD1 4.03Å; L55-T57 PolarHBondContact O-N 3.37Å; L55-T57 VanDerWaalsContact O-N 3.12Å; L55-Q58 HydrophobicContact CB-CB 4.5Å; L55-Q58 HydrophobicContact CB-CG 4.07Å; L55-Q58 VanDerWaalsContact CB-OE1 3.3Å; L55-Q58 WeakPolarHBondContact O-CA 2.93Å; L55-Q58 WeakPolarHBondContact O-CB 3.15Å; L55-Q58 PolarHBondContact O-N 2.91Å; L55-Q59 PolarHBondContact O-N 3.08Å
56	L	90.5	Very high	91.3	Very high	149 Å²	149	119.2 Å²	119.2	78%	0.78	61%	0.612	S	S	*	*	G	3₁₀ helix	trans	-55.7	-31.6	176.2	-68.7	170.7	0	0	0	112.3	I54 Q58 Q59	I54-L56 PolarHBondContact O-N 2.65Å; L56-Q58 PolarHBondContact O-N 3.18Å; L56-Q59 PolarHBondContact O-N 3.36Å
57	T	92	Very high	91	Very high	131 Å²	131	121.8 Å²	121.8	80%	0.804	62%	0.621	S	S	*	*	G	3₁₀ helix	trans	-70.5	-15.3	175.9	53.8	0	0	0	0	114.1	L55	L55-T57 PolarHBondContact O-N 3.37Å; L55-T57 VanDerWaalsContact O-N 3.12Å
58	Q	92.2	Very high	90.7	Very high	87 Å²	87	123.6 Å²	123.6	41%	0.407	63%	0.63	S	S	.	*	G	3₁₀ helix	trans	-97	-13.6	175.8	-63.5	174.7	-69	0	0	112.3	K50 L55 L56	K50-Q58 PolarHBondContact O-NE2 3.05Å; K50-Q58 PolarHBondContact O-OE1 3.29Å; L55-Q58 HydrophobicContact CB-CB 4.5Å; L55-Q58 HydrophobicContact CB-CG 4.07Å; L55-Q58 VanDerWaalsContact CB-OE1 3.3Å; L55-Q58 WeakPolarHBondContact O-CA 2.93Å; L55-Q58 WeakPolarHBondContact O-CB 3.15Å; L55-Q58 PolarHBondContact O-N 2.91Å; L56-Q58 PolarHBondContact O-N 3.18Å
59	Q	88.8	Confident	90.3	Very high	105 Å²	105	127.6 Å²	127.6	49%	0.491	65%	0.647	S	S	.	*	S	Bend	trans	-85.4	149.8	179.6	-66.6	-177.4	-13.6	0	0	110.8	L55 L56	L55-Q59 PolarHBondContact O-N 3.08Å; L56-Q59 PolarHBondContact O-N 3.36Å
60	A	87.7	Confident	89.9	Confident	95 Å²	95	130 Å²	130	79%	0.785	66%	0.663	S	S	*	*	P	Polyproline II helix	trans	-58.9	145.5	172.2	0	0	0	0	0	109.9
61	R	85.6	Confident	89.4	Confident	234 Å²	234	130.2 Å²	130.2	88%	0.883	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-60.2	133.1	174.7	-70.1	-176.3	-176	-176.6	1.9	108.6	I63	R61-I63 PolarHBondContact O-N 2.94Å
62	P	83.4	Confident	88.8	Confident	116 Å²	116	125.5 Å²	125.5	75%	0.753	67%	0.667	S	S	*	*	P	Polyproline II helix	trans	-59.1	128.9	173.2	24.6	-31.5	0	0	0	108.3	L64	P62-L64 PolarHBondContact O-N 3.34Å
63	I	82.8	Confident	88.1	Confident	169 Å²	169	123.9 Å²	123.9	87%	0.867	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-76.8	119.6	170.1	-47.3	174.8	0	0	0	104.9	R61	R61-I63 PolarHBondContact O-N 2.94Å
64	L	72	Confident	87.6	Confident	235 Å²	235	132 Å²	132	100%	1.23	70%	0.698	S	S	*	*			trans	-69.9	0	176.6	-69.4	174.2	0	0	0	110.9	P62	P62-L64 PolarHBondContact O-N 3.34Å

Retrieved 64 of 64 residues in 445.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).