A0A087XA05_POEFO Loading...

Chromosome 11 open reading frame 98

AlphaFold DB , UniProt , Accession A0A087XA05, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 125 aa.

						>A0A087XA05_POEFO|A0A087XA05
MAPPGGKINRPKTELGKKLFKRRRVLGRQKKKQNQIIGAVVDQDLITIHHLKKRRSSPRANITLSGKKRRKLLKQLQHLQTEKSSMEVEPEPQKKISSSSSSAAPKKRKKTGLGCHGDVEMEDVE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.3	Low	68.1	Low	242 Å²	242	137.1 Å²	137.1	100%	1.192	78%	0.784	S	S	*	*				0	120.5	0	-81.3	153.4	75.8	0	0	108.2
2	A	59	Low	69.3	Low	98 Å²	98	138.5 Å²	138.5	81%	0.81	78%	0.775	S	S	*	*			trans	-69.4	136	177.4	0	0	0	0	0	109.9
3	P	59.5	Low	70.5	Confident	113 Å²	113	135.2 Å²	135.2	73%	0.734	76%	0.761	S	S	*	*			trans	-64.8	145.3	-175.1	25.7	-33.3	0	0	0	111.1	G5	P3-G5 PolarHBondContact O-N 3.09Å
4	P	67	Low	71.3	Confident	144 Å²	144	135.9 Å²	135.9	94%	0.935	75%	0.754	S	S	*	*	S	Bend	trans	-75.8	56.4	-175.3	33.3	-37.2	0	0	0	112.4
5	G	60.9	Low	71.7	Confident	66 Å²	66	133.8 Å²	133.8	68%	0.68	74%	0.741	S	S	*	*			trans	-113.9	1.2	-173.7	0	0	0	0	0	115.9	P3	P3-G5 PolarHBondContact O-N 3.09Å
6	G	65.2	Low	72.4	Confident	30 Å²	30	126.8 Å²	126.8	31%	0.309	71%	0.708	S	S	.	*	S	Bend	trans	-96	0.2	-162.8	0	0	0	0	0	117.3	R10	G6-R10 WeakPolarHBondContact O-CD 3.17Å; G6-R10 WeakPolarHBondContact O-CG 3.37Å
7	K	68.6	Low	73.2	Confident	198 Å²	198	126.4 Å²	126.4	86%	0.861	70%	0.697	S	S	*	*	S	Bend	trans	-95.8	-27.6	-167.1	-164.8	169.5	-179.5	-179.5	0	114.6
8	I	72.3	Confident	74.1	Confident	158 Å²	158	127.5 Å²	127.5	81%	0.81	69%	0.694	S	S	*	*	S	Bend	trans	-84.8	-40.4	-169.4	-59.4	174.4	0	0	0	111.4
9	N	75.1	Confident	74.9	Confident	152 Å²	152	124.5 Å²	124.5	81%	0.813	68%	0.677	S	S	*	*	S	Bend	trans	-107.7	9.5	-173.7	-64.8	-25.8	0	0	0	114.8
10	R	79.8	Confident	75.7	Confident	187 Å²	187	127 Å²	127	71%	0.706	68%	0.681	S	S	*	*	S	Bend	trans	-76.1	139.1	174.5	-92.1	-176.6	-178.7	146.6	-5.6	110.7	G6 K12	G6-R10 WeakPolarHBondContact O-CD 3.17Å; G6-R10 WeakPolarHBondContact O-CG 3.37Å; R10-K12 PolarHBondContact O-N 3.15Å
11	P	81.6	Confident	76.6	Confident	120 Å²	120	127.5 Å²	127.5	78%	0.779	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-57.8	134.9	172.6	25.1	-33.3	0	0	0	109.6	T13	P11-T13 PolarHBondContact O-N 2.99Å
12	K	82.6	Confident	78	Confident	154 Å²	154	121.6 Å²	121.6	67%	0.67	64%	0.642	S	S	*	*	P	Polyproline II helix	trans	-63.9	132.4	177.9	-69.6	-179.7	-179	172.3	0	109.1	R10 K17	R10-K12 PolarHBondContact O-N 3.15Å; K12-K17 HydrophobicContact CB-CG 4.16Å
13	T	84.3	Confident	79.7	Confident	96 Å²	96	125.1 Å²	125.1	59%	0.589	63%	0.634	S	S	*	*	P	Polyproline II helix	trans	-57.6	156.4	169.1	59	0	0	0	0	110.2	P11 L15 G16 K17	P11-T13 PolarHBondContact O-N 2.99Å; T13-L15 PolarHBondContact O-N 3.4Å; T13-G16 WeakPolarHBondContact O-CA 3.34Å; T13-G16 PolarHBondContact O-N 3.07Å; T13-G16 PolarHBondContact OG1-N 3.34Å; T13-K17 PolarHBondContact O-N 3.15Å; T13-K17 VanDerWaalsContact O-N 3.14Å
14	E	81.4	Confident	81.4	Confident	144 Å²	144	128.2 Å²	128.2	67%	0.673	63%	0.631	S	S	*	*	H	α-helix	trans	-51.1	-33.7	177	-64.1	-55.4	142	0	0	112.3	K17	E14-K17 VanDerWaalsContact CD-NZ 3.3Å; E14-K17 IonicContact OE1-NZ 2.64Å; E14-K17 PolarHBondContact OE1-NZ 3.01Å; E14-K17 IonicContact OE2-NZ 3.23Å; E14-K17 PolarHBondContact OE2-NZ 3.04Å
15	L	77.6	Confident	82.7	Confident	105 Å²	105	124.5 Å²	124.5	55%	0.55	61%	0.606	S	S	.	*	H	α-helix	trans	-69.3	-30.7	175.2	-59.8	-179.7	0	0	0	113.9	T13	T13-L15 PolarHBondContact O-N 3.4Å
16	G	82.8	Confident	84.2	Confident	21 Å²	21	124.4 Å²	124.4	22%	0.216	59%	0.589	C	S	.	*	H	α-helix	trans	-85	-23.3	-179	0	0	0	0	0	114.4	T13 K18	T13-G16 WeakPolarHBondContact O-CA 3.34Å; T13-G16 PolarHBondContact O-N 3.07Å; T13-G16 PolarHBondContact OG1-N 3.34Å; G16-K18 VanDerWaalsContact C-N 3.33Å; G16-K18 PolarHBondContact O-N 2.92Å
17	K	86.7	Confident	85.6	Confident	120 Å²	120	124.4 Å²	124.4	52%	0.522	59%	0.589	S	S	.	*	H	α-helix	trans	-61.5	-36.7	-180	-69.5	178.2	-176.4	172.4	0	113.1	K12 T13 E14	K12-K17 HydrophobicContact CB-CG 4.16Å; T13-K17 PolarHBondContact O-N 3.15Å; T13-K17 VanDerWaalsContact O-N 3.14Å; E14-K17 VanDerWaalsContact CD-NZ 3.3Å; E14-K17 IonicContact OE1-NZ 2.64Å; E14-K17 PolarHBondContact OE1-NZ 3.01Å; E14-K17 IonicContact OE2-NZ 3.23Å; E14-K17 PolarHBondContact OE2-NZ 3.04Å
18	K	89.5	Confident	86.8	Confident	147 Å²	147	123.1 Å²	123.1	64%	0.639	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.8	44.6	179.8	-65.7	-178.6	-177.7	169.4	0	112.4	G16 F20 K21 R22	G16-K18 VanDerWaalsContact C-N 3.33Å; G16-K18 PolarHBondContact O-N 2.92Å; K18-F20 PolarHBondContact O-N 3.4Å; K18-K21 HydrophobicContact CB-CB 4.23Å; K18-K21 PolarHBondContact O-N 3.26Å; K18-K21 VanDerWaalsContact O-N 3.12Å; K18-R22 PolarHBondContact O-N 2.95Å
19	L	88.9	Confident	87.7	Confident	70 Å²	70	120.6 Å²	120.6	37%	0.366	56%	0.564	S	S	.	*	H	α-helix	trans	-52.8	-47.4	-173.1	-156.7	171.7	0	0	0	112.7	R22 R23	L19-R22 PolarHBondContact O-N 2.94Å; L19-R23 HydrophobicContact CD2-CG 3.85Å; L19-R23 VanDerWaalsContact CD2-NE 3.27Å; L19-R23 PolarHBondContact O-N 3.41Å
20	F	91.2	Very high	88.4	Confident	174 Å²	174	120.1 Å²	120.1	76%	0.763	56%	0.555	S	S	*	*	H	α-helix	trans	-66.3	-40.1	179.6	-66.2	-66.7	0	0	0	113.2	K18 R22 R23 R24	K18-F20 PolarHBondContact O-N 3.4Å; F20-R22 VanDerWaalsContact C-N 3.34Å; F20-R23 PolarHBondContact O-N 2.97Å; F20-R24 WeakPolarHBondContact O-CB 3.41Å; F20-R24 PolarHBondContact O-N 3.49Å
21	K	93.4	Very high	88.7	Confident	139 Å²	139	118.4 Å²	118.4	60%	0.604	55%	0.552	S	S	*	*	H	α-helix	trans	-64.3	-42.2	174.6	-168.4	176.2	-177.9	177.1	0	110.3	K18 R24 V25	K18-K21 HydrophobicContact CB-CB 4.23Å; K18-K21 PolarHBondContact O-N 3.26Å; K18-K21 VanDerWaalsContact O-N 3.12Å; K21-R24 WeakPolarHBondContact O-CB 3.23Å; K21-R24 PolarHBondContact O-N 3.49Å; K21-V25 VanDerWaalsContact O-CG2 3.3Å; K21-V25 WeakPolarHBondContact O-CG2 3.33Å; K21-V25 PolarHBondContact O-N 2.92Å
22	R	91.3	Very high	88.8	Confident	118 Å²	118	119.6 Å²	119.6	45%	0.445	55%	0.545	S	S	.	.	H	α-helix	trans	-61.6	-49.3	175.9	-177.5	176.1	173.9	-100.9	-0.3	111.7	K18 L19 F20 R24 V25 L26	K18-R22 PolarHBondContact O-N 2.95Å; L19-R22 PolarHBondContact O-N 2.94Å; F20-R22 VanDerWaalsContact C-N 3.34Å; R22-R24 VanDerWaalsContact C-N 3.29Å; R22-R24 PolarHBondContact O-N 2.94Å; R22-V25 PolarHBondContact O-N 3.23Å; R22-L26 HydrophobicContact CG-CD1 3.94Å; R22-L26 HydrophobicContact CG-CG 4.35Å; R22-L26 WeakPolarHBondContact O-CB 3.31Å; R22-L26 WeakPolarHBondContact O-CG 3.4Å; R22-L26 PolarHBondContact O-N 3.15Å
23	R	93.7	Very high	88.8	Confident	171 Å²	171	119.6 Å²	119.6	65%	0.645	55%	0.548	S	S	*	.	H	α-helix	trans	-56.2	-43.7	174.7	-81.7	-178	178.3	-157.7	2.9	111.6	L19 F20 G27	L19-R23 HydrophobicContact CD2-CG 3.85Å; L19-R23 VanDerWaalsContact CD2-NE 3.27Å; L19-R23 PolarHBondContact O-N 3.41Å; F20-R23 PolarHBondContact O-N 2.97Å; R23-G27 PolarHBondContact O-N 3.2Å
24	R	94.8	Very high	88.5	Confident	178 Å²	178	121.5 Å²	121.5	67%	0.672	55%	0.554	S	S	*	*	H	α-helix	trans	-61.2	-46.6	176.5	-173.8	-173.4	-65.9	-168	-1.1	112.1	F20 K21 R22 G27 R28	F20-R24 WeakPolarHBondContact O-CB 3.41Å; F20-R24 PolarHBondContact O-N 3.49Å; K21-R24 WeakPolarHBondContact O-CB 3.23Å; K21-R24 PolarHBondContact O-N 3.49Å; R22-R24 VanDerWaalsContact C-N 3.29Å; R22-R24 PolarHBondContact O-N 2.94Å; R24-G27 PolarHBondContact O-N 3.36Å; R24-R28 WeakPolarHBondContact O-CG 3.44Å; R24-R28 PolarHBondContact O-N 3.19Å
25	V	94.2	Very high	88.1	Confident	67 Å²	67	117.9 Å²	117.9	41%	0.406	54%	0.537	S	S	.	.	H	α-helix	trans	-65.1	-48.2	179.9	170.6	0	0	0	0	111.1	K21 R22 G27 R28 Q29	K21-V25 VanDerWaalsContact O-CG2 3.3Å; K21-V25 WeakPolarHBondContact O-CG2 3.33Å; K21-V25 PolarHBondContact O-N 2.92Å; R22-V25 PolarHBondContact O-N 3.23Å; V25-G27 VanDerWaalsContact C-N 3.31Å; V25-G27 PolarHBondContact O-N 2.86Å; V25-R28 WeakPolarHBondContact O-CB 3.33Å; V25-R28 PolarHBondContact O-N 2.76Å; V25-R28 VanDerWaalsContact O-N 3.11Å; V25-Q29 PolarHBondContact O-N 3.2Å
26	L	93.6	Very high	87.7	Confident	63 Å²	63	119.6 Å²	119.6	33%	0.33	55%	0.546	S	S	.	.	H	α-helix	trans	-60.3	-41.5	176.7	-70.7	174.6	0	0	0	111.7	R22 R28 Q29 K30	R22-L26 HydrophobicContact CG-CD1 3.94Å; R22-L26 HydrophobicContact CG-CG 4.35Å; R22-L26 WeakPolarHBondContact O-CB 3.31Å; R22-L26 WeakPolarHBondContact O-CG 3.4Å; R22-L26 PolarHBondContact O-N 3.15Å; L26-R28 VanDerWaalsContact C-N 3.33Å; L26-R28 PolarHBondContact O-N 3.02Å; L26-Q29 PolarHBondContact O-N 2.91Å; L26-K30 WeakPolarHBondContact O-CG 3.39Å; L26-K30 PolarHBondContact O-N 3.47Å
27	G	94.9	Very high	86.9	Confident	31 Å²	31	124.1 Å²	124.1	32%	0.32	56%	0.563	S	S	.	*	H	α-helix	trans	-61.8	-39.5	174.7	0	0	0	0	0	112.7	R23 R24 V25 K31	R23-G27 PolarHBondContact O-N 3.2Å; R24-G27 PolarHBondContact O-N 3.36Å; V25-G27 VanDerWaalsContact C-N 3.31Å; V25-G27 PolarHBondContact O-N 2.86Å; G27-K31 WeakPolarHBondContact O-CB 3.31Å; G27-K31 VanDerWaalsContact O-CG 3.29Å; G27-K31 WeakPolarHBondContact O-CG 3.43Å; G27-K31 PolarHBondContact O-N 3.08Å; G27-K31 VanDerWaalsContact O-N 3.11Å
28	R	92.6	Very high	85.9	Confident	171 Å²	171	120.3 Å²	120.3	65%	0.645	56%	0.558	S	S	*	*	H	α-helix	trans	-65.8	-41.8	173.5	-74.8	-177.5	178	-153.3	-1	111.9	R24 V25 L26 K31 K32	R24-R28 WeakPolarHBondContact O-CG 3.44Å; R24-R28 PolarHBondContact O-N 3.19Å; V25-R28 WeakPolarHBondContact O-CB 3.33Å; V25-R28 PolarHBondContact O-N 2.76Å; V25-R28 VanDerWaalsContact O-N 3.11Å; L26-R28 VanDerWaalsContact C-N 3.33Å; L26-R28 PolarHBondContact O-N 3.02Å; R28-K31 PolarHBondContact O-N 3.32Å; R28-K32 WeakPolarHBondContact O-CG 3.39Å; R28-K32 PolarHBondContact O-N 3.43Å
29	Q	91.3	Very high	85	Confident	104 Å²	104	115.8 Å²	115.8	49%	0.486	55%	0.549	S	S	.	.	H	α-helix	trans	-64.2	-47.6	178	-77.1	175.9	-21.2	0	0	112.1	V25 L26 K31 K32 Q33	V25-Q29 PolarHBondContact O-N 3.2Å; L26-Q29 PolarHBondContact O-N 2.91Å; Q29-K31 VanDerWaalsContact C-N 3.3Å; Q29-K31 PolarHBondContact O-N 2.92Å; Q29-K32 WeakPolarHBondContact O-CB 3.49Å; Q29-K32 PolarHBondContact O-N 2.91Å; Q29-Q33 PolarHBondContact O-N 3.31Å
30	K	90	Very high	84.3	Confident	143 Å²	143	113.8 Å²	113.8	62%	0.622	54%	0.539	S	S	*	.	H	α-helix	trans	-57.2	-43.2	174.6	-72.7	-174	176.9	-168.3	0	112	L26 K32 Q33 N34	L26-K30 WeakPolarHBondContact O-CG 3.39Å; L26-K30 PolarHBondContact O-N 3.47Å; K30-K32 VanDerWaalsContact C-N 3.31Å; K30-K32 PolarHBondContact O-N 3.42Å; K30-Q33 PolarHBondContact O-N 3.46Å; K30-N34 PolarHBondContact O-N 3.42Å; K30-N34 VanDerWaalsContact O-N 3.07Å; K30-N34 PolarHBondContact O-OD1 3.45Å
31	K	86.4	Confident	83.7	Confident	150 Å²	150	110.1 Å²	110.1	65%	0.652	53%	0.531	S	S	*	.	H	α-helix	trans	-62.9	-35.2	175.6	-75.6	179.7	-178.5	-171.8	0	112.9	G27 R28 Q29 Q35	G27-K31 WeakPolarHBondContact O-CB 3.31Å; G27-K31 VanDerWaalsContact O-CG 3.29Å; G27-K31 WeakPolarHBondContact O-CG 3.43Å; G27-K31 PolarHBondContact O-N 3.08Å; G27-K31 VanDerWaalsContact O-N 3.11Å; R28-K31 PolarHBondContact O-N 3.32Å; Q29-K31 VanDerWaalsContact C-N 3.3Å; Q29-K31 PolarHBondContact O-N 2.92Å; K31-Q35 WeakPolarHBondContact O-CG 3.45Å
32	K	83.9	Confident	83.2	Confident	145 Å²	145	104.2 Å²	104.2	63%	0.63	51%	0.506	S	S	*	.	H	α-helix	trans	-70.3	-41.4	174.9	-75.8	-175.5	175.3	-167.2	0	111.9	R28 Q29 K30 N34 Q35	R28-K32 WeakPolarHBondContact O-CG 3.39Å; R28-K32 PolarHBondContact O-N 3.43Å; Q29-K32 WeakPolarHBondContact O-CB 3.49Å; Q29-K32 PolarHBondContact O-N 2.91Å; K30-K32 VanDerWaalsContact C-N 3.31Å; K30-K32 PolarHBondContact O-N 3.42Å; K32-N34 VanDerWaalsContact C-N 3.31Å; K32-N34 PolarHBondContact O-N 3.22Å; K32-Q35 WeakPolarHBondContact O-CB 3.46Å; K32-Q35 PolarHBondContact O-N 3.01Å
33	Q	82.9	Confident	82.6	Confident	155 Å²	155	105.2 Å²	105.2	72%	0.724	52%	0.515	S	S	*	.	H	α-helix	trans	-63.4	-37.3	177.6	-72.6	176.9	-18.4	0	0	112.3	Q29 K30 Q35	Q29-Q33 PolarHBondContact O-N 3.31Å; K30-Q33 PolarHBondContact O-N 3.46Å; Q33-Q35 PolarHBondContact O-N 3.43Å
34	N	77.9	Confident	82	Confident	136 Å²	136	104.3 Å²	104.3	73%	0.727	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.4	4.7	177.9	-64.8	8.1	0	0	0	113.5	K30 K32 I36	K30-N34 PolarHBondContact O-N 3.42Å; K30-N34 VanDerWaalsContact O-N 3.07Å; K30-N34 PolarHBondContact O-OD1 3.45Å; K32-N34 VanDerWaalsContact C-N 3.31Å; K32-N34 PolarHBondContact O-N 3.22Å; N34-I36 PolarHBondContact O-N 3.38Å
35	Q	73.4	Confident	81.6	Confident	68 Å²	68	97.3 Å²	97.3	32%	0.318	50%	0.499	S	S	.	.			trans	-77.5	117	169.9	-77.6	170.7	-1.3	0	0	108.4	K31 K32 Q33 I37	K31-Q35 WeakPolarHBondContact O-CG 3.45Å; K32-Q35 WeakPolarHBondContact O-CB 3.46Å; K32-Q35 PolarHBondContact O-N 3.01Å; Q33-Q35 PolarHBondContact O-N 3.43Å; Q35-I37 HydrophobicContact CB-CD1 4.17Å; Q35-I37 HydrophobicContact CB-CG1 3.76Å; Q35-I37 PolarHBondContact O-N 2.87Å
36	I	68.6	Low	81.1	Confident	141 Å²	141	95 Å²	95	72%	0.723	49%	0.485	S	S	*	.			trans	-72.7	83.9	167.9	-55.8	173.6	0	0	0	106.7	N34 A39	N34-I36 PolarHBondContact O-N 3.38Å; I36-A39 HydrophobicContact CG2-CB 3.69Å
37	I	66.3	Low	80.6	Confident	115 Å²	115	94.7 Å²	94.7	59%	0.59	49%	0.485	S	S	*	.			trans	-88.4	123.8	175.4	-54.6	171.2	0	0	0	106.6	Q35	Q35-I37 HydrophobicContact CB-CD1 4.17Å; Q35-I37 HydrophobicContact CB-CG1 3.76Å; Q35-I37 PolarHBondContact O-N 2.87Å
38	G	64.7	Low	80.1	Confident	40 Å²	40	100 Å²	100	41%	0.412	51%	0.505	S	S	.	.	S	Bend	trans	112.9	-46.1	169	0	0	0	0	0	113.2	V40 R54	G38-V40 PolarHBondContact O-N 3Å; G38-R54 PolarHBondContact O-NH1 3.29Å
39	A	70.9	Confident	79.6	Confident	53 Å²	53	97 Å²	97	44%	0.438	50%	0.498	S	S	.	.			trans	-69.8	107	-168.2	0	0	0	0	0	112.2	I36	I36-A39 HydrophobicContact CG2-CB 3.69Å
40	V	73.8	Confident	79.1	Confident	28 Å²	28	93.8 Å²	93.8	17%	0.17	48%	0.483	C	S	.	.			trans	-91.1	106.9	163.5	-177.1	0	0	0	0	105.3	G38 Q43 I46 I62	G38-V40 PolarHBondContact O-N 3Å; V40-Q43 HydrophobicContact CB-CG 3.81Å; V40-Q43 HydrophobicContact CG1-CB 4.28Å; V40-Q43 HydrophobicContact CG1-CG 3.65Å; V40-Q43 WeakPolarHBondContact O-CG 3.12Å; V40-Q43 PolarHBondContact O-NE2 3.24Å; V40-I46 HydrophobicContact CG1-CD1 3.36Å; V40-I62 HydrophobicContact CB-CD1 4.39Å; V40-I62 HydrophobicContact CG2-CD1 3.61Å
41	V	78.9	Confident	78.6	Confident	96 Å²	96	90.8 Å²	90.8	58%	0.582	47%	0.473	S	S	*	.	S	Bend	trans	-76.4	-46	-175	-179.5	0	0	0	0	111.5	Q43 T63	V41-Q43 PolarHBondContact O-N 3.35Å; V41-T63 HydrophobicContact CB-CG2 3.93Å; V41-T63 HydrophobicContact CG2-CG2 3.66Å
42	D	83.6	Confident	78.5	Confident	16 Å²	16	90.8 Å²	90.8	9%	0.086	47%	0.473	C	S	.	.	S	Bend	trans	-101.6	56.8	-177.1	-55.4	-56.1	0	0	0	110.8	D44 L45 I46 L64 R69	D42-D44 VanDerWaalsContact C-N 3.28Å; D42-D44 PolarHBondContact O-N 2.85Å; D42-L45 HydrophobicContact CB-CB 4.25Å; D42-L45 PolarHBondContact O-N 3.41Å; D42-L45 VanDerWaalsContact O-N 3.08Å; D42-I46 HydrophobicContact CB-CD1 3.91Å; D42-I46 HydrophobicContact CB-CG1 4.04Å; D42-I46 VanDerWaalsContact O-CB 3.26Å; D42-I46 WeakPolarHBondContact O-CB 3.2Å; D42-I46 VanDerWaalsContact O-CD1 3.31Å; D42-I46 WeakPolarHBondContact O-CD1 3.31Å; D42-I46 WeakPolarHBondContact O-CG1 3.15Å; D42-I46 PolarHBondContact O-N 3.02Å; D42-L64 HydrophobicContact CB-CD1 4.31Å; D42-L64 PolarHBondContact OD2-N 2.97Å; D42-R69 IonicContact OD1-CZ 3.74Å; D42-R69 IonicContact OD1-NE 3.65Å; D42-R69 IonicContact OD1-NH1 3.55Å
43	Q	78.6	Confident	78.4	Confident	138 Å²	138	89.4 Å²	89.4	65%	0.645	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.6	-45.3	-170.5	-63.3	-173.1	11.5	0	0	113	V40 V41 L45	V40-Q43 HydrophobicContact CB-CG 3.81Å; V40-Q43 HydrophobicContact CG1-CB 4.28Å; V40-Q43 HydrophobicContact CG1-CG 3.65Å; V40-Q43 WeakPolarHBondContact O-CG 3.12Å; V40-Q43 PolarHBondContact O-NE2 3.24Å; V41-Q43 PolarHBondContact O-N 3.35Å; Q43-L45 VanDerWaalsContact C-N 3.32Å; Q43-L45 PolarHBondContact O-N 3.36Å
44	D	81.1	Confident	78.1	Confident	153 Å²	153	85.3 Å²	85.3	82%	0.818	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.6	-15.2	-174.6	-49.7	-39.6	0	0	0	113.5	D42	D42-D44 VanDerWaalsContact C-N 3.28Å; D42-D44 PolarHBondContact O-N 2.85Å
45	L	85.9	Confident	78.2	Confident	30 Å²	30	90 Å²	90	16%	0.157	45%	0.453	C	S	.	.	T	Hydrogen-bonded Turn	trans	-107.9	-15.8	-178.7	-89.6	77.9	0	0	0	113.4	D42 Q43 T47 L64 R69 L72 L73	D42-L45 HydrophobicContact CB-CB 4.25Å; D42-L45 PolarHBondContact O-N 3.41Å; D42-L45 VanDerWaalsContact O-N 3.08Å; Q43-L45 VanDerWaalsContact C-N 3.32Å; Q43-L45 PolarHBondContact O-N 3.36Å; L45-T47 PolarHBondContact O-N 3Å; L45-L64 HydrophobicContact CB-CD1 3.72Å; L45-L64 HydrophobicContact CD2-CD1 4.46Å; L45-R69 HydrophobicContact CD2-CG 4.01Å; L45-L72 HydrophobicContact CB-CD1 4.48Å; L45-L72 HydrophobicContact CD2-CB 3.88Å; L45-L72 HydrophobicContact CG-CB 4.4Å; L45-L73 HydrophobicContact CD1-CD2 3.85Å; L45-L73 HydrophobicContact CD2-CD2 3.69Å; L45-L73 HydrophobicContact CD2-CG 3.69Å; L45-L73 HydrophobicContact CG-CD2 4.32Å
46	I	84.4	Confident	78.7	Confident	20 Å²	20	91.7 Å²	91.7	10%	0.103	47%	0.472	C	S	.	.			trans	-71.7	129	-174.9	-89	161.8	0	0	0	110.4	V40 D42 H50 L51 I62 L64	V40-I46 HydrophobicContact CG1-CD1 3.36Å; D42-I46 HydrophobicContact CB-CD1 3.91Å; D42-I46 HydrophobicContact CB-CG1 4.04Å; D42-I46 VanDerWaalsContact O-CB 3.26Å; D42-I46 WeakPolarHBondContact O-CB 3.2Å; D42-I46 VanDerWaalsContact O-CD1 3.31Å; D42-I46 WeakPolarHBondContact O-CD1 3.31Å; D42-I46 WeakPolarHBondContact O-CG1 3.15Å; D42-I46 PolarHBondContact O-N 3.02Å; I46-H50 HydrophobicContact CG2-CB 4.02Å; I46-L51 HydrophobicContact CG2-CD2 3.79Å; I46-L51 HydrophobicContact CG2-CG 3.89Å; I46-I62 HydrophobicContact CD1-CB 4.33Å; I46-I62 HydrophobicContact CD1-CG2 3.84Å; I46-I62 WeakPolarHBondContact CD1-O 3.2Å; I46-I62 HydrophobicContact CG1-CG2 4.48Å; I46-I62 HydrophobicContact CG2-CG2 4.2Å; I46-L64 HydrophobicContact CG1-CG 4.23Å
47	T	81.8	Confident	79.1	Confident	55 Å²	55	87.3 Å²	87.3	34%	0.337	45%	0.454	S	S	.	.			trans	-84.3	156.6	179.8	68.2	0	0	0	0	111.8	L45 H49 H50 L51	L45-T47 PolarHBondContact O-N 3Å; T47-H49 PolarHBondContact O-N 3.4Å; T47-H50 WeakPolarHBondContact O-CB 3.26Å; T47-H50 PolarHBondContact O-N 3.28Å; T47-H50 PolarHBondContact OG1-ND1 3.29Å; T47-L51 PolarHBondContact O-N 3.47Å
48	I	84.2	Confident	79.4	Confident	144 Å²	144	86.7 Å²	86.7	74%	0.738	46%	0.457	S	S	*	.	H	α-helix	trans	-48.7	-35.9	176.2	-60.1	171.2	0	0	0	111.8	H50 L51 K52	I48-H50 VanDerWaalsContact C-N 3.3Å; I48-H50 PolarHBondContact O-N 3.07Å; I48-L51 WeakPolarHBondContact O-CB 3.42Å; I48-L51 PolarHBondContact O-N 3.47Å; I48-K52 PolarHBondContact O-N 3.01Å
49	H	82.9	Confident	79.8	Confident	107 Å²	107	93.4 Å²	93.4	50%	0.495	47%	0.47	S	S	.	.	H	α-helix	trans	-61.5	-36.4	178.4	-170.5	78.6	0	0	0	113.1	T47 K52 K53	T47-H49 PolarHBondContact O-N 3.4Å; H49-K52 PolarHBondContact O-N 3.01Å; H49-K53 WeakPolarHBondContact NE2-CE 3.47Å; H49-K53 PolarHBondContact O-N 3.42Å
50	H	80.8	Confident	80	Confident	36 Å²	36	92.5 Å²	92.5	17%	0.167	46%	0.463	C	S	.	.	H	α-helix	trans	-73.1	-35.6	179.6	-65.7	24.5	0	0	0	110.4	I46 T47 I48 K53 R54 I62 L64 K68	I46-H50 HydrophobicContact CG2-CB 4.02Å; T47-H50 WeakPolarHBondContact O-CB 3.26Å; T47-H50 PolarHBondContact O-N 3.28Å; T47-H50 PolarHBondContact OG1-ND1 3.29Å; I48-H50 VanDerWaalsContact C-N 3.3Å; I48-H50 PolarHBondContact O-N 3.07Å; H50-K53 PolarHBondContact O-N 3.24Å; H50-R54 PolarHBondContact O-N 3Å; H50-I62 HydrophobicContact CB-CG2 4.26Å; H50-L64 WeakPolarHBondContact CD2-CD2 3.38Å; H50-L64 VanDerWaalsContact NE2-CD2 3.26Å; H50-L64 WeakPolarHBondContact NE2-CD2 3.24Å; H50-K68 PolarHBondContact CE1-NZ 3.28Å; H50-K68 PolarHBondContact NE2-NZ 3.16Å
51	L	79.4	Confident	79.9	Confident	80 Å²	80	97.1 Å²	97.1	42%	0.419	49%	0.486	S	S	.	.	H	α-helix	trans	-65.8	-40.2	171.2	-58	176.2	0	0	0	111.7	I46 T47 I48 K53 R54 R55 I62	I46-L51 HydrophobicContact CG2-CD2 3.79Å; I46-L51 HydrophobicContact CG2-CG 3.89Å; T47-L51 PolarHBondContact O-N 3.47Å; I48-L51 WeakPolarHBondContact O-CB 3.42Å; I48-L51 PolarHBondContact O-N 3.47Å; L51-K53 PolarHBondContact O-N 3.27Å; L51-R54 WeakPolarHBondContact O-CB 3.33Å; L51-R54 PolarHBondContact O-N 3.07Å; L51-R54 VanDerWaalsContact O-N 3.14Å; L51-R55 PolarHBondContact O-N 3.49Å; L51-I62 HydrophobicContact CD2-CG2 4.5Å
52	K	85.1	Confident	79.7	Confident	151 Å²	151	93 Å²	93	66%	0.657	46%	0.461	S	S	*	.	H	α-helix	trans	-63.8	-39.6	176.6	-164.6	173.6	-177.7	176.9	0	112.2	I48 H49 R54 R55 S56	I48-K52 PolarHBondContact O-N 3.01Å; H49-K52 PolarHBondContact O-N 3.01Å; K52-R54 PolarHBondContact O-N 3.36Å; K52-R55 PolarHBondContact O-N 3.46Å; K52-S56 PolarHBondContact O-N 3.05Å; K52-S56 PolarHBondContact O-OG 3.37Å
53	K	81.6	Confident	79.6	Confident	116 Å²	116	94.8 Å²	94.8	50%	0.504	47%	0.473	S	S	.	.	H	α-helix	trans	-61.7	-31.6	173	-77.3	-172	179.4	-179.3	0	113.1	H49 H50 L51 S56 S57	H49-K53 WeakPolarHBondContact NE2-CE 3.47Å; H49-K53 PolarHBondContact O-N 3.42Å; H50-K53 PolarHBondContact O-N 3.24Å; L51-K53 PolarHBondContact O-N 3.27Å; K53-S56 PolarHBondContact O-OG 3.06Å; K53-S56 VanDerWaalsContact O-OG 3.07Å; K53-S57 PolarHBondContact O-N 3.36Å
54	R	75.5	Confident	79.8	Confident	69 Å²	69	88.8 Å²	88.8	26%	0.26	45%	0.445	S	S	.	.	H	α-helix	trans	-76	-36.7	176.8	-162.5	-165.8	-176.5	-163.8	-19.9	112.7	G38 H50 L51 K52 S56 S57 I62	G38-R54 PolarHBondContact O-NH1 3.29Å; H50-R54 PolarHBondContact O-N 3Å; L51-R54 WeakPolarHBondContact O-CB 3.33Å; L51-R54 PolarHBondContact O-N 3.07Å; L51-R54 VanDerWaalsContact O-N 3.14Å; K52-R54 PolarHBondContact O-N 3.36Å; R54-S56 VanDerWaalsContact C-N 3.27Å; R54-S56 PolarHBondContact O-N 3.49Å; R54-S57 WeakPolarHBondContact CA-O 3.48Å; R54-S57 CarbonylContact O-C 3.23Å; R54-S57 VanDerWaalsContact O-C 3.23Å; R54-S57 PolarHBondContact O-N 3.14Å; R54-S57 VanDerWaalsContact O-O 3.11Å; R54-I62 HydrophobicContact CG-CD1 4.24Å; R54-I62 HydrophobicContact CG-CG1 4.24Å
55	R	81	Confident	80	Confident	235 Å²	235	85.5 Å²	85.5	89%	0.887	43%	0.434	S	S	*	.	H	α-helix	trans	-58.9	-39.2	172.9	-88.2	-174.7	160.6	177	-4.1	111.8	L51 K52	L51-R55 PolarHBondContact O-N 3.49Å; K52-R55 PolarHBondContact O-N 3.46Å
56	S	82.7	Confident	80.2	Confident	103 Å²	103	86.3 Å²	86.3	72%	0.72	45%	0.449	S	S	*	.	H	α-helix	trans	-81.6	-29.4	177.2	59.5	0	0	0	0	113.9	K52 K53 R54	K52-S56 PolarHBondContact O-N 3.05Å; K52-S56 PolarHBondContact O-OG 3.37Å; K53-S56 PolarHBondContact O-OG 3.06Å; K53-S56 VanDerWaalsContact O-OG 3.07Å; R54-S56 VanDerWaalsContact C-N 3.27Å; R54-S56 PolarHBondContact O-N 3.49Å
57	S	77.6	Confident	80.5	Confident	49 Å²	49	92.1 Å²	92.1	34%	0.343	47%	0.474	S	S	.	.			trans	-137.1	112.8	177.5	-179.5	0	0	0	0	112.2	K53 R54 R59 A60	K53-S57 PolarHBondContact O-N 3.36Å; R54-S57 WeakPolarHBondContact CA-O 3.48Å; R54-S57 CarbonylContact O-C 3.23Å; R54-S57 VanDerWaalsContact O-C 3.23Å; R54-S57 PolarHBondContact O-N 3.14Å; R54-S57 VanDerWaalsContact O-O 3.11Å; S57-R59 PolarHBondContact O-N 2.94Å; S57-R59 VanDerWaalsContact O-N 3.13Å; S57-A60 WeakPolarHBondContact O-CB 3.26Å; S57-A60 PolarHBondContact O-N 3.26Å; S57-A60 VanDerWaalsContact O-N 3.16Å
58	P	73.2	Confident	80.8	Confident	102 Å²	102	93.1 Å²	93.1	66%	0.662	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.7	-12.4	179.8	25.8	-32.5	0	0	0	113.6
59	R	72.1	Confident	81.1	Confident	181 Å²	181	92 Å²	92	68%	0.683	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.3	-10.1	177.7	-170.5	178.9	167.6	82.7	2.4	112.9	S57 N61	S57-R59 PolarHBondContact O-N 2.94Å; S57-R59 VanDerWaalsContact O-N 3.13Å; R59-N61 PolarHBondContact O-N 2.92Å
60	A	75.2	Confident	81.5	Confident	34 Å²	34	94.9 Å²	94.9	28%	0.281	47%	0.466	S	S	.	.			trans	-64	127.2	-178.1	0	0	0	0	0	110.7	S57 I62	S57-A60 WeakPolarHBondContact O-CB 3.26Å; S57-A60 PolarHBondContact O-N 3.26Å; S57-A60 VanDerWaalsContact O-N 3.16Å; A60-I62 PolarHBondContact O-N 3.03Å
61	N	72.2	Confident	82.1	Confident	124 Å²	124	99.7 Å²	99.7	66%	0.663	49%	0.487	S	S	*	.			trans	-71.5	128.6	171.7	-167.9	-9.1	0	0	0	109	R59 T63	R59-N61 PolarHBondContact O-N 2.92Å; N61-T63 PolarHBondContact ND2-OG1 3.13Å; N61-T63 VanDerWaalsContact ND2-OG1 3.14Å; N61-T63 VanDerWaalsContact OD1-CG2 3.26Å; N61-T63 WeakPolarHBondContact OD1-CG2 3.5Å; N61-T63 PolarHBondContact OD1-N 2.87Å; N61-T63 VanDerWaalsContact OD1-N 3.09Å; N61-T63 PolarHBondContact OD1-OG1 3.49Å
62	I	75.6	Confident	82.7	Confident	9 Å²	9	97.8 Å²	97.8	5%	0.046	48%	0.477	C	S	.	.			trans	-93.2	-11.4	-174.5	-30.9	161.9	0	0	0	110.9	V40 I46 H50 L51 R54 A60	V40-I62 HydrophobicContact CB-CD1 4.39Å; V40-I62 HydrophobicContact CG2-CD1 3.61Å; I46-I62 HydrophobicContact CD1-CB 4.33Å; I46-I62 HydrophobicContact CD1-CG2 3.84Å; I46-I62 WeakPolarHBondContact CD1-O 3.2Å; I46-I62 HydrophobicContact CG1-CG2 4.48Å; I46-I62 HydrophobicContact CG2-CG2 4.2Å; H50-I62 HydrophobicContact CB-CG2 4.26Å; L51-I62 HydrophobicContact CD2-CG2 4.5Å; R54-I62 HydrophobicContact CG-CD1 4.24Å; R54-I62 HydrophobicContact CG-CG1 4.24Å; A60-I62 PolarHBondContact O-N 3.03Å
63	T	79.9	Confident	83.1	Confident	55 Å²	55	94.4 Å²	94.4	34%	0.337	47%	0.466	S	S	.	.	P	Polyproline II helix	trans	-61	138.8	179.3	58.7	0	0	0	0	111.3	V41 N61	V41-T63 HydrophobicContact CB-CG2 3.93Å; V41-T63 HydrophobicContact CG2-CG2 3.66Å; N61-T63 PolarHBondContact ND2-OG1 3.13Å; N61-T63 VanDerWaalsContact ND2-OG1 3.14Å; N61-T63 VanDerWaalsContact OD1-CG2 3.26Å; N61-T63 WeakPolarHBondContact OD1-CG2 3.5Å; N61-T63 PolarHBondContact OD1-N 2.87Å; N61-T63 VanDerWaalsContact OD1-N 3.09Å; N61-T63 PolarHBondContact OD1-OG1 3.49Å
64	L	83	Confident	83.7	Confident	12 Å²	12	94.9 Å²	94.9	6%	0.063	47%	0.468	C	S	.	.	P	Polyproline II helix	trans	-72.8	143.8	169.7	-64	172.2	0	0	0	110	D42 L45 I46 H50 K68 R69 L72	D42-L64 HydrophobicContact CB-CD1 4.31Å; D42-L64 PolarHBondContact OD2-N 2.97Å; L45-L64 HydrophobicContact CB-CD1 3.72Å; L45-L64 HydrophobicContact CD2-CD1 4.46Å; I46-L64 HydrophobicContact CG1-CG 4.23Å; H50-L64 WeakPolarHBondContact CD2-CD2 3.38Å; H50-L64 VanDerWaalsContact NE2-CD2 3.26Å; H50-L64 WeakPolarHBondContact NE2-CD2 3.24Å; L64-K68 HydrophobicContact CD2-CD 3.68Å; L64-K68 HydrophobicContact CD2-CG 4.13Å; L64-R69 HydrophobicContact CB-CB 4.21Å; L64-L72 HydrophobicContact CD1-CD1 3.73Å
65	S	85.6	Confident	84.6	Confident	84 Å²	84	97 Å²	97	59%	0.587	48%	0.481	S	S	*	.	P	Polyproline II helix	trans	-56.6	142.3	163.9	167.2	0	0	0	0	109.3	K67 K68 R69	S65-K67 PolarHBondContact O-N 3.14Å; S65-K67 VanDerWaalsContact O-N 3.11Å; S65-K68 WeakPolarHBondContact O-CA 3.42Å; S65-K68 WeakPolarHBondContact O-CB 3.43Å; S65-K68 PolarHBondContact O-N 3.46Å; S65-R69 PolarHBondContact O-N 2.93Å
66	G	89.6	Confident	85.2	Confident	47 Å²	47	89.9 Å²	89.9	49%	0.485	46%	0.459	S	S	.	.	H	α-helix	trans	-53.4	-36.5	-178.7	0	0	0	0	0	113.7	K68 R69 R70	G66-K68 VanDerWaalsContact C-N 3.34Å; G66-K68 PolarHBondContact O-N 3.09Å; G66-R69 PolarHBondContact O-N 3.04Å; G66-R70 WeakPolarHBondContact O-CB 3.26Å; G66-R70 PolarHBondContact O-N 3.49Å
67	K	91.6	Very high	85.7	Confident	142 Å²	142	90.9 Å²	90.9	62%	0.617	45%	0.453	S	S	*	.	H	α-helix	trans	-62.4	-41.6	174.8	-174.8	175.8	-177.4	176.2	0	111.8	S65 K71	S65-K67 PolarHBondContact O-N 3.14Å; S65-K67 VanDerWaalsContact O-N 3.11Å; K67-K71 PolarHBondContact O-N 3.45Å; K67-K71 VanDerWaalsContact O-N 3.12Å
68	K	88.1	Confident	86.6	Confident	75 Å²	75	92.8 Å²	92.8	33%	0.326	46%	0.456	S	S	.	.	H	α-helix	trans	-71.8	-44.1	-179.9	-174.6	171.4	173.7	-171.2	0	111.4	H50 L64 S65 G66 R70 K71 L72	H50-K68 PolarHBondContact CE1-NZ 3.28Å; H50-K68 PolarHBondContact NE2-NZ 3.16Å; L64-K68 HydrophobicContact CD2-CD 3.68Å; L64-K68 HydrophobicContact CD2-CG 4.13Å; S65-K68 WeakPolarHBondContact O-CA 3.42Å; S65-K68 WeakPolarHBondContact O-CB 3.43Å; S65-K68 PolarHBondContact O-N 3.46Å; G66-K68 VanDerWaalsContact C-N 3.34Å; G66-K68 PolarHBondContact O-N 3.09Å; K68-R70 PolarHBondContact O-N 3.36Å; K68-K71 PolarHBondContact O-N 2.99Å; K68-L72 HydrophobicContact CG-CD1 4.31Å; K68-L72 WeakPolarHBondContact O-CG 3.44Å; K68-L72 PolarHBondContact O-N 3.47Å
69	R	89.8	Confident	87.6	Confident	122 Å²	122	92.2 Å²	92.2	46%	0.46	45%	0.447	S	S	.	.	H	α-helix	trans	-55.1	-51.1	173.8	-179.1	176.7	169.8	-178.1	-5.6	111.2	D42 L45 L64 S65 G66 K71 L72 L73	D42-R69 IonicContact OD1-CZ 3.74Å; D42-R69 IonicContact OD1-NE 3.65Å; D42-R69 IonicContact OD1-NH1 3.55Å; L45-R69 HydrophobicContact CD2-CG 4.01Å; L64-R69 HydrophobicContact CB-CB 4.21Å; S65-R69 PolarHBondContact O-N 2.93Å; G66-R69 PolarHBondContact O-N 3.04Å; R69-K71 VanDerWaalsContact C-N 3.35Å; R69-K71 PolarHBondContact O-N 2.85Å; R69-L72 PolarHBondContact O-N 3.11Å; R69-L73 HydrophobicContact CG-CD1 4.29Å; R69-L73 WeakPolarHBondContact O-CG 3.43Å; R69-L73 PolarHBondContact O-N 3.12Å
70	R	92.9	Very high	88.6	Confident	166 Å²	166	90.1 Å²	90.1	63%	0.626	45%	0.445	S	S	*	.	H	α-helix	trans	-59.6	-42	178.2	-176.7	172.7	61.7	-120.2	4.8	112.7	G66 K68 K74	G66-R70 WeakPolarHBondContact O-CB 3.26Å; G66-R70 PolarHBondContact O-N 3.49Å; K68-R70 PolarHBondContact O-N 3.36Å; R70-K74 WeakPolarHBondContact O-CB 3.42Å; R70-K74 PolarHBondContact O-N 3.25Å
71	K	93.6	Very high	89.5	Confident	138 Å²	138	91.7 Å²	91.7	60%	0.6	45%	0.451	S	S	*	.	H	α-helix	trans	-63.1	-44.2	177.6	-82.7	-157.9	171.6	-162.5	0	112.4	K67 K68 R69 K74 Q75	K67-K71 PolarHBondContact O-N 3.45Å; K67-K71 VanDerWaalsContact O-N 3.12Å; K68-K71 PolarHBondContact O-N 2.99Å; R69-K71 VanDerWaalsContact C-N 3.35Å; R69-K71 PolarHBondContact O-N 2.85Å; K71-K74 PolarHBondContact O-N 2.91Å; K71-Q75 WeakPolarHBondContact O-CG 3.45Å; K71-Q75 PolarHBondContact O-N 3.32Å
72	L	91.6	Very high	90.5	Very high	39 Å²	39	91.3 Å²	91.3	20%	0.204	45%	0.446	C	S	.	.	H	α-helix	trans	-66.4	-43.7	179.4	-71.1	173.3	0	0	0	111.9	L45 L64 K68 R69 K74 Q75 L76	L45-L72 HydrophobicContact CB-CD1 4.48Å; L45-L72 HydrophobicContact CD2-CB 3.88Å; L45-L72 HydrophobicContact CG-CB 4.4Å; L64-L72 HydrophobicContact CD1-CD1 3.73Å; K68-L72 HydrophobicContact CG-CD1 4.31Å; K68-L72 WeakPolarHBondContact O-CG 3.44Å; K68-L72 PolarHBondContact O-N 3.47Å; R69-L72 PolarHBondContact O-N 3.11Å; L72-K74 VanDerWaalsContact C-N 3.31Å; L72-K74 PolarHBondContact O-N 3.17Å; L72-Q75 PolarHBondContact O-N 3.4Å; L72-L76 WeakPolarHBondContact O-CG 3.45Å; L72-L76 PolarHBondContact O-N 2.92Å
73	L	92.9	Very high	91.3	Very high	80 Å²	80	98 Å²	98	42%	0.419	47%	0.474	S	S	.	.	H	α-helix	trans	-58.5	-44.6	174.3	-70.9	177.8	0	0	0	111.6	L45 R69 Q75 L76 Q77	L45-L73 HydrophobicContact CD1-CD2 3.85Å; L45-L73 HydrophobicContact CD2-CD2 3.69Å; L45-L73 HydrophobicContact CD2-CG 3.69Å; L45-L73 HydrophobicContact CG-CD2 4.32Å; R69-L73 HydrophobicContact CG-CD1 4.29Å; R69-L73 WeakPolarHBondContact O-CG 3.43Å; R69-L73 PolarHBondContact O-N 3.12Å; L73-Q75 VanDerWaalsContact C-N 3.33Å; L73-Q75 PolarHBondContact O-N 3.31Å; L73-L76 PolarHBondContact O-N 3.42Å; L73-Q77 WeakPolarHBondContact O-CB 3.41Å; L73-Q77 PolarHBondContact O-N 3.49Å
74	K	95.1	Very high	91.8	Very high	127 Å²	127	99.2 Å²	99.2	55%	0.552	49%	0.485	S	S	*	.	H	α-helix	trans	-60.6	-42.7	177.6	-173.7	173	-179.9	177.5	0	111.7	R70 K71 L72 Q77 H78	R70-K74 WeakPolarHBondContact O-CB 3.42Å; R70-K74 PolarHBondContact O-N 3.25Å; K71-K74 PolarHBondContact O-N 2.91Å; L72-K74 VanDerWaalsContact C-N 3.31Å; L72-K74 PolarHBondContact O-N 3.17Å; K74-Q77 PolarHBondContact O-N 3.35Å; K74-H78 WeakPolarHBondContact CE-NE2 3.45Å; K74-H78 PolarHBondContact O-CD2 3.21Å; K74-H78 PolarHBondContact O-N 3.07Å
75	Q	93.9	Very high	92.1	Very high	114 Å²	114	103 Å²	103	53%	0.533	51%	0.513	S	S	.	.	H	α-helix	trans	-64.9	-44.9	177	-74.2	177.1	-40	0	0	112.4	K71 L72 L73 Q77 H78 L79	K71-Q75 WeakPolarHBondContact O-CG 3.45Å; K71-Q75 PolarHBondContact O-N 3.32Å; L72-Q75 PolarHBondContact O-N 3.4Å; L73-Q75 VanDerWaalsContact C-N 3.33Å; L73-Q75 PolarHBondContact O-N 3.31Å; Q75-Q77 VanDerWaalsContact C-N 3.3Å; Q75-Q77 PolarHBondContact O-N 3.4Å; Q75-H78 PolarHBondContact O-N 2.92Å; Q75-L79 WeakPolarHBondContact O-CG 3.46Å; Q75-L79 PolarHBondContact O-N 2.9Å
76	L	92.6	Very high	91.6	Very high	84 Å²	84	107.3 Å²	107.3	44%	0.44	53%	0.526	S	S	.	.	H	α-helix	trans	-61.4	-40.9	176.4	-72.6	172.8	0	0	0	111.7	L72 L73 L79 Q80	L72-L76 WeakPolarHBondContact O-CG 3.45Å; L72-L76 PolarHBondContact O-N 2.92Å; L73-L76 PolarHBondContact O-N 3.42Å; L76-L79 PolarHBondContact O-N 3.05Å; L76-Q80 WeakPolarHBondContact O-CG 3.43Å; L76-Q80 PolarHBondContact O-N 3Å
77	Q	94.8	Very high	90.6	Very high	124 Å²	124	113.1 Å²	113.1	58%	0.579	54%	0.54	S	S	*	.	H	α-helix	trans	-62.3	-46.2	176.2	-172.2	178.7	5.8	0	0	111.4	L73 K74 Q75 L79 Q80 T81	L73-Q77 WeakPolarHBondContact O-CB 3.41Å; L73-Q77 PolarHBondContact O-N 3.49Å; K74-Q77 PolarHBondContact O-N 3.35Å; Q75-Q77 VanDerWaalsContact C-N 3.3Å; Q75-Q77 PolarHBondContact O-N 3.4Å; Q77-L79 PolarHBondContact O-N 3.11Å; Q77-Q80 PolarHBondContact O-N 3.36Å; Q77-T81 WeakPolarHBondContact O-CG2 3.36Å; Q77-T81 PolarHBondContact O-N 3.29Å; Q77-T81 PolarHBondContact O-OG1 3.11Å
78	H	96.2	Very high	89.3	Confident	90 Å²	90	112 Å²	112	42%	0.417	55%	0.545	S	S	.	.	H	α-helix	trans	-59.6	-45.5	176.6	-75.4	-57.7	0	0	0	112.4	K74 Q75 Q80 T81 E82	K74-H78 WeakPolarHBondContact CE-NE2 3.45Å; K74-H78 PolarHBondContact O-CD2 3.21Å; K74-H78 PolarHBondContact O-N 3.07Å; Q75-H78 PolarHBondContact O-N 2.92Å; H78-Q80 VanDerWaalsContact C-N 3.28Å; H78-Q80 PolarHBondContact O-N 2.89Å; H78-T81 WeakPolarHBondContact CA-OG1 3.47Å; H78-T81 PolarHBondContact O-N 3.46Å; H78-T81 PolarHBondContact O-OG1 3.01Å; H78-E82 WeakPolarHBondContact O-CB 3.47Å; H78-E82 VanDerWaalsContact O-CG 3.31Å; H78-E82 WeakPolarHBondContact O-CG 3.3Å; H78-E82 PolarHBondContact O-N 3.4Å
79	L	94	Very high	88.1	Confident	90 Å²	90	115.6 Å²	115.6	47%	0.471	56%	0.563	S	S	.	*	H	α-helix	trans	-63.3	-34.7	177	-70.3	171.9	0	0	0	112.5	Q75 L76 Q77 K83	Q75-L79 WeakPolarHBondContact O-CG 3.46Å; Q75-L79 PolarHBondContact O-N 2.9Å; L76-L79 PolarHBondContact O-N 3.05Å; Q77-L79 PolarHBondContact O-N 3.11Å; L79-K83 WeakPolarHBondContact O-CB 3.46Å; L79-K83 WeakPolarHBondContact O-CG 3.39Å; L79-K83 PolarHBondContact O-N 2.91Å
80	Q	92.9	Very high	86.3	Confident	136 Å²	136	114.7 Å²	114.7	64%	0.636	57%	0.573	S	S	*	*	H	α-helix	trans	-68.6	-44.1	174.7	-76.4	173.9	-15.4	0	0	111.4	L76 Q77 H78 K83 S84	L76-Q80 WeakPolarHBondContact O-CG 3.43Å; L76-Q80 PolarHBondContact O-N 3Å; Q77-Q80 PolarHBondContact O-N 3.36Å; H78-Q80 VanDerWaalsContact C-N 3.28Å; H78-Q80 PolarHBondContact O-N 2.89Å; Q80-K83 PolarHBondContact O-N 3.45Å; Q80-S84 PolarHBondContact O-N 3.23Å; Q80-S84 PolarHBondContact O-OG 3.12Å
81	T	94.4	Very high	84.7	Confident	67 Å²	67	113.2 Å²	113.2	41%	0.411	57%	0.573	S	S	.	*	H	α-helix	trans	-65.7	-39.7	178	51.5	0	0	0	0	112.4	Q77 H78 S84 S85	Q77-T81 WeakPolarHBondContact O-CG2 3.36Å; Q77-T81 PolarHBondContact O-N 3.29Å; Q77-T81 PolarHBondContact O-OG1 3.11Å; H78-T81 WeakPolarHBondContact CA-OG1 3.47Å; H78-T81 PolarHBondContact O-N 3.46Å; H78-T81 PolarHBondContact O-OG1 3.01Å; T81-S84 WeakPolarHBondContact CA-OG 3.41Å; T81-S84 PolarHBondContact O-N 2.64Å; T81-S84 PolarHBondContact O-OG 3.27Å; T81-S85 VanDerWaalsContact O-CB 3.23Å; T81-S85 WeakPolarHBondContact O-CB 3.12Å; T81-S85 PolarHBondContact O-N 2.9Å
82	E	92.8	Very high	82.8	Confident	117 Å²	117	112.5 Å²	112.5	55%	0.547	58%	0.583	S	S	.	*	H	α-helix	trans	-65	-45.4	175.9	-74.4	169.9	-170.9	0	0	110.7	H78 S84 S85 M86	H78-E82 WeakPolarHBondContact O-CB 3.47Å; H78-E82 VanDerWaalsContact O-CG 3.31Å; H78-E82 WeakPolarHBondContact O-CG 3.3Å; H78-E82 PolarHBondContact O-N 3.4Å; E82-S84 PolarHBondContact O-N 3.03Å; E82-S85 PolarHBondContact O-N 3.38Å; E82-M86 VanDerWaalsContact O-CB 3.31Å; E82-M86 WeakPolarHBondContact O-CB 3.29Å; E82-M86 PolarHBondContact O-N 3.46Å
83	K	93.1	Very high	80.9	Confident	148 Å²	148	119 Å²	119	64%	0.643	61%	0.612	S	S	*	*	H	α-helix	trans	-59.4	-47.4	175.3	-76.9	175.2	179.6	-171.4	0	112.3	L79 Q80 S85 M86 E87	L79-K83 WeakPolarHBondContact O-CB 3.46Å; L79-K83 WeakPolarHBondContact O-CG 3.39Å; L79-K83 PolarHBondContact O-N 2.91Å; Q80-K83 PolarHBondContact O-N 3.45Å; K83-S85 VanDerWaalsContact C-N 3.28Å; K83-S85 PolarHBondContact O-N 2.86Å; K83-M86 PolarHBondContact O-N 3.3Å; K83-E87 WeakPolarHBondContact O-CB 3.18Å; K83-E87 PolarHBondContact O-N 2.97Å
84	S	89.8	Confident	78.9	Confident	82 Å²	82	123.4 Å²	123.4	57%	0.573	63%	0.628	S	S	*	*	H	α-helix	trans	-67.4	-28.6	179	59.5	0	0	0	0	113.4	Q80 T81 E82	Q80-S84 PolarHBondContact O-N 3.23Å; Q80-S84 PolarHBondContact O-OG 3.12Å; T81-S84 WeakPolarHBondContact CA-OG 3.41Å; T81-S84 PolarHBondContact O-N 2.64Å; T81-S84 PolarHBondContact O-OG 3.27Å; E82-S84 PolarHBondContact O-N 3.03Å
85	S	87.9	Confident	76.6	Confident	92 Å²	92	127 Å²	127	64%	0.643	64%	0.644	S	S	*	*	H	α-helix	trans	-76.9	-34.7	176.7	-173.4	0	0	0	0	112	T81 E82 K83	T81-S85 VanDerWaalsContact O-CB 3.23Å; T81-S85 WeakPolarHBondContact O-CB 3.12Å; T81-S85 PolarHBondContact O-N 2.9Å; E82-S85 PolarHBondContact O-N 3.38Å; K83-S85 VanDerWaalsContact C-N 3.28Å; K83-S85 PolarHBondContact O-N 2.86Å
86	M	75.4	Confident	74.4	Confident	173 Å²	173	128.8 Å²	128.8	85%	0.852	66%	0.655	S	S	*	*	H	α-helix	trans	-86.6	-18.3	-176.6	-148.5	170.4	103.9	0	0	113.2	E82 K83 V88	E82-M86 VanDerWaalsContact O-CB 3.31Å; E82-M86 WeakPolarHBondContact O-CB 3.29Å; E82-M86 PolarHBondContact O-N 3.46Å; K83-M86 PolarHBondContact O-N 3.3Å; M86-V88 VanDerWaalsContact C-N 3.26Å; M86-V88 PolarHBondContact O-N 3.39Å
87	E	69.3	Low	72.1	Confident	169 Å²	169	130.2 Å²	130.2	79%	0.79	67%	0.672	S	S	*	*			trans	-79.8	74.8	173.3	-151.9	165.9	-144.4	0	0	109.5	K83	K83-E87 WeakPolarHBondContact O-CB 3.18Å; K83-E87 PolarHBondContact O-N 2.97Å
88	V	63.8	Low	69.3	Low	119 Å²	119	129.3 Å²	129.3	72%	0.721	68%	0.68	S	S	*	*			trans	-98.8	107.8	170.3	175	0	0	0	0	109	M86	M86-V88 VanDerWaalsContact C-N 3.26Å; M86-V88 PolarHBondContact O-N 3.39Å
89	E	62.8	Low	66.7	Low	150 Å²	150	130.1 Å²	130.1	70%	0.701	70%	0.695	S	S	*	*			trans	78.7	149.2	160.8	-89.7	-90.7	120	0	0	121.6	E91	E89-E91 PolarHBondContact OE1-N 3.46Å; E89-E91 VanDerWaalsContact OE1-N 3.15Å
90	P	51.8	Low	63.8	Low	104 Å²	104	131.2 Å²	131.2	68%	0.675	71%	0.71	S	S	*	*			cis	-118.4	152	7.6	41.1	-28.4	0	0	0	117.9
91	E	59.4	Low	61.2	Low	134 Å²	134	129.8 Å²	129.8	63%	0.626	72%	0.716	S	S	*	*			trans	-44.6	136.2	159.1	-77.2	-169.9	147.6	0	0	110.7	E89 Q93	E89-E91 PolarHBondContact OE1-N 3.46Å; E89-E91 VanDerWaalsContact OE1-N 3.15Å; E91-Q93 PolarHBondContact O-N 2.78Å
92	P	54.9	Low	58.4	Low	124 Å²	124	132.1 Å²	132.1	81%	0.805	74%	0.735	S	S	*	*			trans	-65.9	109	160.3	26.9	-30.2	0	0	0	108	K94	P92-K94 PolarHBondContact O-N 3.14Å; P92-K94 VanDerWaalsContact O-N 3.15Å
93	Q	50.7	Low	55.6	Low	174 Å²	174	131.5 Å²	131.5	81%	0.813	75%	0.749	S	S	*	*			trans	-38.8	117.9	174.8	-67.9	176.4	-14.1	0	0	111.5	E91 K95	E91-Q93 PolarHBondContact O-N 2.78Å; Q93-K95 PolarHBondContact O-N 3.35Å; Q93-K95 VanDerWaalsContact O-N 3.09Å
94	K	51.6	Low	53.1	Low	173 Å²	173	128.9 Å²	128.9	75%	0.752	76%	0.755	S	S	*	*			trans	-55.5	112.6	167.5	-72.9	171.9	-179.1	157.5	0	109.2	P92	P92-K94 PolarHBondContact O-N 3.14Å; P92-K94 VanDerWaalsContact O-N 3.15Å
95	K	47.2	Very low	51.1	Low	204 Å²	204	130.4 Å²	130.4	89%	0.887	76%	0.763	S	S	*	*			trans	-85.3	111.8	157.2	-64.8	-166.9	-177	-174.8	0	108.1	Q93	Q93-K95 PolarHBondContact O-N 3.35Å; Q93-K95 VanDerWaalsContact O-N 3.09Å
96	I	48.2	Very low	49.1	Very low	151 Å²	151	135.2 Å²	135.2	77%	0.774	77%	0.773	S	S	*	*			trans	-79.9	150.6	174.5	-67.3	165.4	0	0	0	109.7
97	S	43.1	Very low	47.6	Very low	113 Å²	113	137.2 Å²	137.2	79%	0.79	78%	0.776	S	S	*	*			trans	100.3	121.9	169.1	75.8	0	0	0	0	114.3
98	S	35.7	Very low	46.4	Very low	106 Å²	106	139.2 Å²	139.2	74%	0.741	78%	0.777	S	S	*	*			cis	-161.7	136.5	46.9	43.7	0	0	0	0	113.9
99	S	41.2	Very low	45.3	Very low	107 Å²	107	141.5 Å²	141.5	75%	0.748	78%	0.777	S	S	*	*			trans	26.2	124	146.2	57.8	0	0	0	0	122.1
100	S	34.4	Very low	44.1	Very low	112 Å²	112	144.2 Å²	144.2	78%	0.783	79%	0.786	S	S	*	*				169.6	125.5	100.7	48.8	0	0	0	0	114.9
101	S	38.5	Very low	43.6	Very low	107 Å²	107	144.9 Å²	144.9	75%	0.748	79%	0.789	S	S	*	*			trans	43.7	118.1	145.5	62.3	0	0	0	0	122.1
102	S	35.2	Very low	42.6	Very low	116 Å²	116	142.4 Å²	142.4	81%	0.811	80%	0.799	S	S	*	*				163.2	138.6	89.1	53.2	0	0	0	0	114.7
103	A	33.7	Very low	41.9	Very low	104 Å²	104	144.9 Å²	144.9	86%	0.86	81%	0.805	S	S	*	*			trans	64.9	105.6	149.8	0	0	0	0	0	121.3
104	A	40.8	Very low	41.3	Very low	93 Å²	93	140.1 Å²	140.1	77%	0.769	80%	0.803	S	S	*	*			trans	-102.1	160.1	148	0	0	0	0	0	108.8
105	P	48.4	Very low	40.6	Very low	114 Å²	114	138.1 Å²	138.1	74%	0.74	81%	0.809	S	S	*	*				-151.6	146	77.3	35.5	-14.1	0	0	0	118.7
106	K	46.2	Very low	40.5	Very low	193 Å²	193	137.7 Å²	137.7	84%	0.839	81%	0.809	S	S	*	*			trans	48.9	120.9	132.5	-57.9	177.2	-177.7	174.9	0	121.3
107	K	42.3	Very low	40.3	Very low	214 Å²	214	132.8 Å²	132.8	93%	0.93	80%	0.797	S	S	*	*				-144.7	126.5	125.5	-75.5	-163.4	179.9	175.3	0	112.1
108	R	45.4	Very low	40.3	Very low	212 Å²	212	134.9 Å²	134.9	80%	0.8	80%	0.799	S	S	*	*			trans	-81.8	162.6	166.9	-56.1	164	80.4	-173	8	106.9
109	K	40.2	Very low	41.5	Very low	166 Å²	166	135.4 Å²	135.4	72%	0.722	80%	0.797	S	S	*	*			cis	-179.8	141.7	27.9	-141.6	178.9	-173.1	-170.5	0	105.3
110	K	38.5	Very low	41.8	Very low	207 Å²	207	138.1 Å²	138.1	90%	0.9	80%	0.798	S	S	*	*				-169.2	130.7	124.3	-139.7	169.9	-179	178.5	0	111.1
111	T	40.4	Very low	43	Very low	119 Å²	119	140.7 Å²	140.7	73%	0.73	80%	0.8	S	S	*	*			trans	-85.2	147.3	-176.4	43.2	0	0	0	0	111.8
112	G	37.8	Very low	43.9	Very low	81 Å²	81	144 Å²	144	84%	0.835	80%	0.803	S	S	*	*			trans	-154.5	85.8	163.2	0	0	0	0	0	109
113	L	40.3	Very low	44.4	Very low	176 Å²	176	146.3 Å²	146.3	92%	0.921	81%	0.807	S	S	*	*			trans	-67.4	146.7	177.4	-84.7	129.2	0	0	0	111.6
114	G	37.9	Very low	45.3	Very low	75 Å²	75	148.1 Å²	148.1	77%	0.773	81%	0.807	S	S	*	*			trans	167.3	33.4	165.1	0	0	0	0	0	115.9
115	C	37.2	Very low	45.4	Very low	131 Å²	131	156.3 Å²	156.3	89%	0.885	83%	0.829	S	S	*	*			trans	-93.7	88.9	165	-173.8	0	0	0	0	107.5
116	H	45.6	Very low	45.2	Very low	194 Å²	194	158.5 Å²	158.5	90%	0.898	83%	0.834	S	S	*	*			trans	-70.6	111.7	158.2	-126.7	-87.5	0	0	0	104.1
117	G	43.8	Very low	45.2	Very low	49 Å²	49	156.6 Å²	156.6	51%	0.505	83%	0.833	S	S	.	*				112.7	78.3	53.2	0	0	0	0	0	105	V119	G117-V119 PolarHBondContact O-N 2.79Å
118	D	42.5	Very low	45.4	Very low	157 Å²	157	153.4 Å²	153.4	84%	0.84	83%	0.828	S	S	*	*			trans	-66.7	118.5	175.7	-162.7	11.8	0	0	0	108.2
119	V	60.8	Low	45.4	Very low	116 Å²	116	150 Å²	150	70%	0.703	83%	0.83	S	S	*	*			trans	-106.3	99.7	-180	178	0	0	0	0	106.8	G117	G117-V119 PolarHBondContact O-N 2.79Å
120	E	47.4	Very low	45.7	Very low	165 Å²	165	149 Å²	149	77%	0.771	84%	0.836	S	S	*	*			trans	-67.3	126.8	163.6	-68.5	-146.1	142.9	0	0	109.2
121	M	60.9	Low	46.2	Very low	166 Å²	166	145.1 Å²	145.1	82%	0.818	83%	0.832	S	S	*	*			trans	-103.1	107.5	169.6	-70.5	-80.3	-81.3	0	0	106.6
122	E	57.6	Low	46.6	Very low	175 Å²	175	147 Å²	147	82%	0.818	84%	0.84	S	S	*	*			trans	-74.8	134.8	169.5	-71.4	-179	158.7	0	0	110
123	D	45.8	Very low	47.2	Very low	166 Å²	166	152.1 Å²	152.1	89%	0.888	84%	0.84	S	S	*	*			trans	-68.7	137.4	173.7	-72	-52.6	0	0	0	110.9
124	V	52.5	Low	47.8	Very low	142 Å²	142	150.1 Å²	150.1	86%	0.861	83%	0.833	S	S	*	*			trans	-104.3	133.8	170.6	177.5	0	0	0	0	108.5
125	E	41.8	Very low	48.7	Very low	265 Å²	265	156.9 Å²	156.9	100%	1.238	84%	0.839	S	S	*	*			trans	-41.9	0	179.2	-70.6	-179.5	141.8	0	0	116.4

Retrieved 125 of 125 residues in 19.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).