A0A087XB87_POEFO Loading...

Si:ch73-238c9.1

AlphaFold DB , UniProt , Accession A0A087XB87, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 107 aa.

						>A0A087XB87_POEFO|A0A087XB87
MNIGSKTKKRVVLPSRPELPTVDQLQEDINKAAPDDPVFSILEKTEQASSRPADSEAELRFQQSRRYLDLNGRLEEALGQLQEQREALQTAGEQLDRTMEEVKGQVC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.3	Very low	58.5	Low	242 Å²	242	164.4 Å²	164.4	100%	1.192	85%	0.848	S	S	*	*				0	108.9	0	-72.5	-179.5	-103.3	0	0	107.3
2	N	42.3	Very low	60.3	Low	147 Å²	147	161.6 Å²	161.6	79%	0.786	84%	0.843	S	S	*	*			trans	-139.4	121.7	177.1	-117.9	-15	0	0	0	112.1
3	I	49.5	Very low	62	Low	145 Å²	145	160.2 Å²	160.2	74%	0.744	84%	0.836	S	S	*	*			trans	60.4	112.4	141.7	-62.8	157.8	0	0	0	117.9
4	G	48.7	Very low	63.5	Low	76 Å²	76	157.3 Å²	157.3	78%	0.784	83%	0.832	S	S	*	*			trans	-138.6	53.1	164.9	0	0	0	0	0	112	K6	G4-K6 PolarHBondContact O-N 3.39Å
5	S	58.7	Low	64.7	Low	106 Å²	106	154.3 Å²	154.3	74%	0.741	83%	0.829	S	S	*	*			trans	-82.2	92.2	175.4	-58.2	0	0	0	0	110.4	T7	S5-T7 PolarHBondContact O-N 3.43Å
6	K	59.7	Low	66.2	Low	203 Å²	203	157.6 Å²	157.6	88%	0.883	83%	0.826	S	S	*	*			trans	-70.1	110.1	174.2	-65.3	-162.9	178.6	-178.8	0	110.4	G4 K8	G4-K6 PolarHBondContact O-N 3.39Å; K6-K8 PolarHBondContact O-N 3.3Å
7	T	61	Low	67.4	Low	132 Å²	132	154.7 Å²	154.7	81%	0.81	82%	0.819	S	S	*	*			trans	-71	110.1	173.1	39.1	0	0	0	0	110.4	S5 K9	S5-T7 PolarHBondContact O-N 3.43Å; T7-K9 PolarHBondContact O-N 3.23Å
8	K	66.7	Low	68.7	Low	198 Å²	198	156.7 Å²	156.7	86%	0.861	82%	0.823	S	S	*	*			trans	-71.3	112.2	169.4	-76.9	174.5	177.3	171.3	0	108.4	K6 R10	K6-K8 PolarHBondContact O-N 3.3Å; K8-R10 PolarHBondContact O-N 3.3Å
9	K	67.3	Low	69.9	Low	200 Å²	200	155.4 Å²	155.4	87%	0.87	82%	0.816	S	S	*	*			trans	-61.8	106.3	170.8	-66.9	-171.6	180	-177.9	0	108.1	T7 V11	T7-K9 PolarHBondContact O-N 3.23Å; K9-V11 PolarHBondContact O-N 3.11Å; K9-V11 VanDerWaalsContact O-N 3.11Å
10	R	72.4	Confident	71.1	Confident	227 Å²	227	151.4 Å²	151.4	86%	0.857	80%	0.799	S	S	*	*			trans	-67	107.3	170.9	-68	-179.9	65.8	130.2	-0.1	106.8	K8 V12	K8-R10 PolarHBondContact O-N 3.3Å; R10-V12 PolarHBondContact O-N 3.27Å; R10-V12 VanDerWaalsContact O-N 3.09Å
11	V	77.3	Confident	72.2	Confident	132 Å²	132	147.9 Å²	147.9	80%	0.8	78%	0.784	S	S	*	*			trans	-66.5	107.1	169.8	176.6	0	0	0	0	106.3	K9	K9-V11 PolarHBondContact O-N 3.11Å; K9-V11 VanDerWaalsContact O-N 3.11Å
12	V	79.4	Confident	74.8	Confident	131 Å²	131	141.3 Å²	141.3	79%	0.794	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-81.2	118.3	175.3	-178.5	0	0	0	0	106.5	R10	R10-V12 PolarHBondContact O-N 3.27Å; R10-V12 VanDerWaalsContact O-N 3.09Å
13	L	83.1	Confident	77.4	Confident	143 Å²	143	139.8 Å²	139.8	75%	0.749	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-66.4	149.2	174.4	-67.6	175.8	0	0	0	109.8
14	P	82.3	Confident	79.5	Confident	120 Å²	120	137.6 Å²	137.6	78%	0.779	74%	0.736	S	S	*	*	P	Polyproline II helix	trans	-57.5	146.6	172.2	25.4	-33.2	0	0	0	110.3
15	S	82.7	Confident	81.5	Confident	113 Å²	113	138.1 Å²	138.1	79%	0.79	72%	0.72	S	S	*	*	P	Polyproline II helix	trans	-62.1	148.3	175.6	45.9	0	0	0	0	111.1
16	R	87.4	Confident	83.1	Confident	207 Å²	207	138.2 Å²	138.2	78%	0.781	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-58.2	135.3	173.4	-172	-173.8	179.4	-174.4	0.2	109.3
17	P	87.6	Confident	84.8	Confident	108 Å²	108	133.1 Å²	133.1	70%	0.701	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-57.7	154.1	170.5	-21.8	32.2	0	0	0	111.8
18	E	90	Very high	86.2	Confident	190 Å²	190	131.9 Å²	131.9	89%	0.888	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-67.3	155.6	171.1	-64	-172.8	169.3	0	0	110.9
19	L	92.4	Very high	87.3	Confident	132 Å²	132	126.7 Å²	126.7	69%	0.691	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-70.9	145.8	176.2	-64.5	176.3	0	0	0	109.6
20	P	93.1	Very high	88.4	Confident	75 Å²	75	123 Å²	123	49%	0.487	65%	0.648	S	S	.	*	P	Polyproline II helix	trans	-64	151.8	176.9	27.7	-34.5	0	0	0	111.1	L25	P20-L25 HydrophobicContact CB-CD2 4.35Å; P20-L25 HydrophobicContact CB-CG 4.46Å; P20-L25 HydrophobicContact CG-CD2 4.02Å; P20-L25 HydrophobicContact CG-CG 4.41Å
21	T	94.6	Very high	89.4	Confident	79 Å²	79	119.1 Å²	119.1	49%	0.485	64%	0.637	S	S	.	*	P	Polyproline II helix	trans	-81.2	157	173.5	-52.3	0	0	0	0	110.1	D23 Q24 L25	T21-D23 PolarHBondContact O-N 3.23Å; T21-Q24 WeakPolarHBondContact O-CB 3.32Å; T21-Q24 PolarHBondContact O-N 2.84Å; T21-Q24 VanDerWaalsContact O-N 3.09Å; T21-L25 PolarHBondContact O-N 3.34Å
22	V	94.8	Very high	90.1	Very high	104 Å²	104	114.3 Å²	114.3	63%	0.63	61%	0.611	S	S	*	*	H	α-helix	trans	-53.3	-42	176.2	178.6	0	0	0	0	111.6	Q24 L25 Q26	V22-Q24 VanDerWaalsContact C-N 3.29Å; V22-Q24 PolarHBondContact O-N 3.38Å; V22-L25 WeakPolarHBondContact O-CB 3.3Å; V22-L25 PolarHBondContact O-N 2.71Å; V22-Q26 PolarHBondContact O-N 3.4Å
23	D	95.9	Very high	90.6	Very high	114 Å²	114	110.3 Å²	110.3	61%	0.61	59%	0.591	S	S	*	*	H	α-helix	trans	-61.5	-37.6	-179.9	-58.7	-27.7	0	0	0	112.5	T21 Q26 E27	T21-D23 PolarHBondContact O-N 3.23Å; D23-Q26 PolarHBondContact O-N 3.03Å; D23-E27 WeakPolarHBondContact O-CB 3.4Å; D23-E27 PolarHBondContact O-N 3.49Å
24	Q	94.3	Very high	90.7	Very high	99 Å²	99	109.6 Å²	109.6	46%	0.463	60%	0.595	S	S	.	*	H	α-helix	trans	-69.5	-39.9	178.4	-65.8	173.7	-39.3	0	0	111.1	T21 V22 Q26 E27 D28	T21-Q24 WeakPolarHBondContact O-CB 3.32Å; T21-Q24 PolarHBondContact O-N 2.84Å; T21-Q24 VanDerWaalsContact O-N 3.09Å; V22-Q24 VanDerWaalsContact C-N 3.29Å; V22-Q24 PolarHBondContact O-N 3.38Å; Q24-Q26 VanDerWaalsContact C-N 3.3Å; Q24-Q26 PolarHBondContact O-N 3.48Å; Q24-E27 PolarHBondContact O-N 3.16Å; Q24-D28 PolarHBondContact O-N 3.45Å
25	L	91.9	Very high	91	Very high	87 Å²	87	110.2 Å²	110.2	46%	0.455	59%	0.592	S	S	.	*	H	α-helix	trans	-62.6	-41.1	174.1	-65.3	173.3	0	0	0	111.2	P20 T21 V22 D28 I29	P20-L25 HydrophobicContact CB-CD2 4.35Å; P20-L25 HydrophobicContact CB-CG 4.46Å; P20-L25 HydrophobicContact CG-CD2 4.02Å; P20-L25 HydrophobicContact CG-CG 4.41Å; T21-L25 PolarHBondContact O-N 3.34Å; V22-L25 WeakPolarHBondContact O-CB 3.3Å; V22-L25 PolarHBondContact O-N 2.71Å; L25-D28 PolarHBondContact O-N 2.99Å; L25-I29 VanDerWaalsContact O-CG1 3.31Å; L25-I29 WeakPolarHBondContact O-CG1 3.33Å; L25-I29 PolarHBondContact O-N 2.92Å
26	Q	91.9	Very high	91.3	Very high	109 Å²	109	107.2 Å²	107.2	51%	0.509	57%	0.567	S	S	.	*	H	α-helix	trans	-71.1	-35.1	-179.5	-165.1	162.8	5.8	0	0	112.1	V22 D23 Q24 I29 N30	V22-Q26 PolarHBondContact O-N 3.4Å; D23-Q26 PolarHBondContact O-N 3.03Å; Q24-Q26 VanDerWaalsContact C-N 3.3Å; Q24-Q26 PolarHBondContact O-N 3.48Å; Q26-I29 PolarHBondContact O-N 2.97Å; Q26-N30 WeakPolarHBondContact O-CB 3.41Å; Q26-N30 PolarHBondContact O-N 3.26Å; Q26-N30 PolarHBondContact O-ND2 3.13Å
27	E	94.6	Very high	91.2	Very high	95 Å²	95	101.3 Å²	101.3	44%	0.444	56%	0.556	S	S	.	*	H	α-helix	trans	-59.8	-45.7	170.9	-173.9	-179.7	176.2	0	0	111.7	D23 Q24 I29 N30 K31	D23-E27 WeakPolarHBondContact O-CB 3.4Å; D23-E27 PolarHBondContact O-N 3.49Å; Q24-E27 PolarHBondContact O-N 3.16Å; E27-I29 PolarHBondContact O-N 3.01Å; E27-N30 PolarHBondContact O-N 3.39Å; E27-K31 HydrophobicContact CG-CD 4.03Å; E27-K31 WeakPolarHBondContact O-CB 3.41Å; E27-K31 WeakPolarHBondContact O-CG 3.36Å; E27-K31 PolarHBondContact O-N 2.95Å; E27-K31 WeakPolarHBondContact OE1-CE 3.43Å; E27-K31 IonicContact OE1-NZ 2.9Å; E27-K31 PolarHBondContact OE1-NZ 2.89Å
28	D	91.8	Very high	91	Very high	107 Å²	107	99.8 Å²	99.8	57%	0.572	54%	0.544	S	S	*	.	H	α-helix	trans	-62.2	-42.3	177.2	-73.6	-15.5	0	0	0	111.7	Q24 L25 N30 K31 A32	Q24-D28 PolarHBondContact O-N 3.45Å; L25-D28 PolarHBondContact O-N 2.99Å; D28-N30 PolarHBondContact O-N 2.75Å; D28-K31 PolarHBondContact O-N 2.95Å; D28-A32 PolarHBondContact O-N 3.39Å
29	I	89.6	Confident	90.7	Very high	88 Å²	88	93.8 Å²	93.8	45%	0.451	52%	0.515	S	S	.	.	H	α-helix	trans	-61.7	-43.8	175.4	-68	165.1	0	0	0	111	L25 Q26 E27 K31 A32 F39	L25-I29 VanDerWaalsContact O-CG1 3.31Å; L25-I29 WeakPolarHBondContact O-CG1 3.33Å; L25-I29 PolarHBondContact O-N 2.92Å; Q26-I29 PolarHBondContact O-N 2.97Å; E27-I29 PolarHBondContact O-N 3.01Å; I29-K31 VanDerWaalsContact C-N 3.26Å; I29-K31 PolarHBondContact O-N 3.32Å; I29-A32 WeakPolarHBondContact O-CB 3.41Å; I29-A32 PolarHBondContact O-N 3.39Å; I29-F39 HydrophobicContact CG2-CE1 4.28Å; I29-F39 HydrophobicContact CG2-CZ 4.29Å
30	N	90.1	Very high	90.1	Very high	124 Å²	124	90.7 Å²	90.7	66%	0.663	51%	0.505	S	S	*	.	H	α-helix	trans	-69.7	-24.9	-179.3	-70.9	-33.8	0	0	0	113	Q26 E27 D28	Q26-N30 WeakPolarHBondContact O-CB 3.41Å; Q26-N30 PolarHBondContact O-N 3.26Å; Q26-N30 PolarHBondContact O-ND2 3.13Å; E27-N30 PolarHBondContact O-N 3.39Å; D28-N30 PolarHBondContact O-N 2.75Å
31	K	92.6	Very high	89.5	Confident	145 Å²	145	92.2 Å²	92.2	63%	0.63	51%	0.508	S	S	*	.	H	α-helix	trans	-91.6	-11.5	177.3	-72.3	176.8	175.1	178.9	0	113.4	E27 D28 I29	E27-K31 HydrophobicContact CG-CD 4.03Å; E27-K31 WeakPolarHBondContact O-CB 3.41Å; E27-K31 WeakPolarHBondContact O-CG 3.36Å; E27-K31 PolarHBondContact O-N 2.95Å; E27-K31 WeakPolarHBondContact OE1-CE 3.43Å; E27-K31 IonicContact OE1-NZ 2.9Å; E27-K31 PolarHBondContact OE1-NZ 2.89Å; D28-K31 PolarHBondContact O-N 2.95Å; I29-K31 VanDerWaalsContact C-N 3.26Å; I29-K31 PolarHBondContact O-N 3.32Å
32	A	91.5	Very high	88.3	Confident	30 Å²	30	93 Å²	93	25%	0.248	51%	0.508	C	S	.	.	S	Bend	trans	-61	145.7	178.9	0	0	0	0	0	110.8	D28 I29 D36 F39	D28-A32 PolarHBondContact O-N 3.39Å; I29-A32 WeakPolarHBondContact O-CB 3.41Å; I29-A32 PolarHBondContact O-N 3.39Å; A32-D36 HydrophobicContact CB-CB 4.17Å; A32-F39 HydrophobicContact CB-CE2 3.69Å; A32-F39 HydrophobicContact CB-CZ 4Å
33	A	90.8	Very high	87.2	Confident	47 Å²	47	93.6 Å²	93.6	39%	0.388	50%	0.504	S	S	.	.			trans	-71.1	152.3	178.7	0	0	0	0	0	110.3	D35 D36 F39	A33-D35 WeakPolarHBondContact CB-OD1 3.45Å; A33-D35 PolarHBondContact O-N 3.1Å; A33-D35 VanDerWaalsContact O-N 3.12Å; A33-D36 WeakPolarHBondContact O-CB 3.3Å; A33-D36 PolarHBondContact O-N 3.38Å; A33-F39 WeakPolarHBondContact O-CE2 3.45Å
34	P	84.6	Confident	85.9	Confident	129 Å²	129	95.7 Å²	95.7	84%	0.838	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.9	-23.6	178.7	-24.5	34.6	0	0	0	114.2	D36	P34-D36 VanDerWaalsContact C-N 3.34Å
35	D	88.3	Confident	84.4	Confident	132 Å²	132	95 Å²	95	71%	0.706	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92	11.3	176.7	60.5	-36.6	0	0	0	113.5	A33	A33-D35 WeakPolarHBondContact CB-OD1 3.45Å; A33-D35 PolarHBondContact O-N 3.1Å; A33-D35 VanDerWaalsContact O-N 3.12Å
36	D	89.4	Confident	83	Confident	50 Å²	50	97.3 Å²	97.3	27%	0.267	52%	0.519	S	S	.	.			trans	-64	131.8	177.7	-166.5	-56	0	0	0	111.3	A32 A33 P34 V38 F39	A32-D36 HydrophobicContact CB-CB 4.17Å; A33-D36 WeakPolarHBondContact O-CB 3.3Å; A33-D36 PolarHBondContact O-N 3.38Å; P34-D36 VanDerWaalsContact C-N 3.34Å; D36-V38 PolarHBondContact O-N 3.03Å; D36-V38 WeakPolarHBondContact OD1-CB 3.44Å; D36-V38 WeakPolarHBondContact OD1-CG2 3.5Å; D36-V38 PolarHBondContact OD1-N 2.88Å; D36-F39 HydrophobicContact CB-CD2 3.8Å; D36-F39 HydrophobicContact CB-CE2 3.97Å; D36-F39 PolarHBondContact O-N 3.49Å
37	P	86.2	Confident	81.4	Confident	84 Å²	84	98.5 Å²	98.5	55%	0.545	53%	0.525	S	S	.	.	H	α-helix	trans	-52.1	-28.5	176	-28.2	34.8	0	0	0	115	F39 S40 I41	P37-F39 PolarHBondContact O-N 3.35Å; P37-S40 PolarHBondContact O-N 3.44Å; P37-S40 VanDerWaalsContact O-N 3.17Å; P37-I41 WeakPolarHBondContact O-CD1 3.34Å; P37-I41 VanDerWaalsContact O-CG1 3.24Å; P37-I41 WeakPolarHBondContact O-CG1 3.32Å; P37-I41 PolarHBondContact O-N 2.92Å
38	V	82.9	Confident	79.5	Confident	75 Å²	75	97 Å²	97	46%	0.455	53%	0.529	S	S	.	.	H	α-helix	trans	-54.8	-41.8	176.8	168.3	0	0	0	0	111	D36 L42	D36-V38 PolarHBondContact O-N 3.03Å; D36-V38 WeakPolarHBondContact OD1-CB 3.44Å; D36-V38 WeakPolarHBondContact OD1-CG2 3.5Å; D36-V38 PolarHBondContact OD1-N 2.88Å; V38-L42 WeakPolarHBondContact O-CG 3.46Å; V38-L42 PolarHBondContact O-N 3.4Å
39	F	84.6	Confident	77.9	Confident	64 Å²	64	95.6 Å²	95.6	28%	0.281	53%	0.528	S	S	.	.	H	α-helix	trans	-74.6	-37.2	179	-57.5	-62	0	0	0	111.9	I29 A32 A33 D36 P37 I41 L42 E43	I29-F39 HydrophobicContact CG2-CE1 4.28Å; I29-F39 HydrophobicContact CG2-CZ 4.29Å; A32-F39 HydrophobicContact CB-CE2 3.69Å; A32-F39 HydrophobicContact CB-CZ 4Å; A33-F39 WeakPolarHBondContact O-CE2 3.45Å; D36-F39 HydrophobicContact CB-CD2 3.8Å; D36-F39 HydrophobicContact CB-CE2 3.97Å; D36-F39 PolarHBondContact O-N 3.49Å; P37-F39 PolarHBondContact O-N 3.35Å; F39-I41 VanDerWaalsContact C-N 3.31Å; F39-I41 PolarHBondContact O-N 2.85Å; F39-L42 PolarHBondContact O-N 3.34Å; F39-E43 PolarHBondContact O-N 2.96Å; F39-E43 VanDerWaalsContact O-N 3.09Å
40	S	79.9	Confident	76.2	Confident	68 Å²	68	95.6 Å²	95.6	48%	0.476	54%	0.535	S	S	.	.	H	α-helix	trans	-63.1	-36.2	175.8	-63.5	0	0	0	0	112.9	P37 K44	P37-S40 PolarHBondContact O-N 3.44Å; P37-S40 VanDerWaalsContact O-N 3.17Å; S40-K44 VanDerWaalsContact O-CB 3.32Å; S40-K44 WeakPolarHBondContact O-CB 3.42Å; S40-K44 PolarHBondContact O-N 2.83Å; S40-K44 VanDerWaalsContact O-N 3.08Å
41	I	79.3	Confident	74.7	Confident	106 Å²	106	97.8 Å²	97.8	54%	0.544	53%	0.534	S	S	.	.	H	α-helix	trans	-70.1	-37.8	178.5	-65.9	161	0	0	0	110.7	P37 F39 K44 T45	P37-I41 WeakPolarHBondContact O-CD1 3.34Å; P37-I41 VanDerWaalsContact O-CG1 3.24Å; P37-I41 WeakPolarHBondContact O-CG1 3.32Å; P37-I41 PolarHBondContact O-N 2.92Å; F39-I41 VanDerWaalsContact C-N 3.31Å; F39-I41 PolarHBondContact O-N 2.85Å; I41-K44 PolarHBondContact O-N 3.42Å; I41-T45 WeakPolarHBondContact O-CB 3.48Å; I41-T45 PolarHBondContact O-N 3.21Å; I41-T45 PolarHBondContact O-OG1 3.03Å
42	L	70.2	Confident	72.9	Confident	95 Å²	95	96.1 Å²	96.1	50%	0.497	54%	0.538	S	S	.	.	H	α-helix	trans	-63.6	-50.6	176	-71.7	167.7	0	0	0	110.9	V38 F39 K44 T45 E46	V38-L42 WeakPolarHBondContact O-CG 3.46Å; V38-L42 PolarHBondContact O-N 3.4Å; F39-L42 PolarHBondContact O-N 3.34Å; L42-K44 VanDerWaalsContact C-N 3.29Å; L42-K44 PolarHBondContact O-N 2.97Å; L42-T45 PolarHBondContact O-N 3.5Å; L42-E46 WeakPolarHBondContact O-CG 3.46Å; L42-E46 PolarHBondContact O-N 3.21Å
43	E	71.8	Confident	71.3	Confident	118 Å²	118	97.6 Å²	97.6	55%	0.551	55%	0.551	S	S	*	*	H	α-helix	trans	-57.6	-41.7	176.5	-72.2	-177	176.7	0	0	112.3	F39 T45 E46 Q47	F39-E43 PolarHBondContact O-N 2.96Å; F39-E43 VanDerWaalsContact O-N 3.09Å; E43-T45 VanDerWaalsContact C-N 3.33Å; E43-T45 PolarHBondContact O-N 2.97Å; E43-E46 PolarHBondContact O-N 2.95Å; E43-Q47 WeakPolarHBondContact O-CB 3.33Å; E43-Q47 WeakPolarHBondContact O-CG 3.41Å; E43-Q47 PolarHBondContact O-N 3.45Å
44	K	67.1	Low	69.9	Low	157 Å²	157	100.6 Å²	100.6	68%	0.683	56%	0.56	S	S	*	*	H	α-helix	trans	-67.8	-33.4	178.1	-169.1	172.7	-175.8	177.1	0	112.7	S40 I41 L42 A48	S40-K44 VanDerWaalsContact O-CB 3.32Å; S40-K44 WeakPolarHBondContact O-CB 3.42Å; S40-K44 PolarHBondContact O-N 2.83Å; S40-K44 VanDerWaalsContact O-N 3.08Å; I41-K44 PolarHBondContact O-N 3.42Å; L42-K44 VanDerWaalsContact C-N 3.29Å; L42-K44 PolarHBondContact O-N 2.97Å; K44-A48 VanDerWaalsContact O-CB 3.25Å; K44-A48 WeakPolarHBondContact O-CB 3.47Å; K44-A48 PolarHBondContact O-N 3.24Å
45	T	64.3	Low	69.5	Low	86 Å²	86	97.7 Å²	97.7	53%	0.528	54%	0.543	S	S	.	.	H	α-helix	trans	-74.2	-37.9	177.3	-56	0	0	0	0	110.8	I41 L42 E43 A48 S49	I41-T45 WeakPolarHBondContact O-CB 3.48Å; I41-T45 PolarHBondContact O-N 3.21Å; I41-T45 PolarHBondContact O-OG1 3.03Å; L42-T45 PolarHBondContact O-N 3.5Å; E43-T45 VanDerWaalsContact C-N 3.33Å; E43-T45 PolarHBondContact O-N 2.97Å; T45-A48 PolarHBondContact O-N 3.45Å; T45-S49 PolarHBondContact O-N 3.46Å; T45-S49 VanDerWaalsContact O-N 3.08Å
46	E	61.6	Low	69.4	Low	134 Å²	134	96.5 Å²	96.5	63%	0.626	53%	0.533	S	S	*	.	H	α-helix	trans	-67.2	-43.2	173.4	-70.7	-178.9	175.3	0	0	111.4	L42 E43 A48 S49 S50	L42-E46 WeakPolarHBondContact O-CG 3.46Å; L42-E46 PolarHBondContact O-N 3.21Å; E43-E46 PolarHBondContact O-N 2.95Å; E46-A48 VanDerWaalsContact C-N 3.3Å; E46-A48 PolarHBondContact O-N 3.47Å; E46-S49 WeakPolarHBondContact O-CB 3.4Å; E46-S49 PolarHBondContact O-N 3.4Å; E46-S49 PolarHBondContact O-OG 2.95Å; E46-S50 PolarHBondContact O-N 3.45Å
47	Q	58.1	Low	69.3	Low	134 Å²	134	97 Å²	97	63%	0.626	55%	0.545	S	S	*	.	H	α-helix	trans	-65.7	-28.9	172.2	-76.6	167.9	5.9	0	0	113.4	E43 S49 S50	E43-Q47 WeakPolarHBondContact O-CB 3.33Å; E43-Q47 WeakPolarHBondContact O-CG 3.41Å; E43-Q47 PolarHBondContact O-N 3.45Å; Q47-S49 VanDerWaalsContact C-N 3.28Å; Q47-S50 PolarHBondContact O-OG 3.31Å
48	A	55.9	Low	69.5	Low	64 Å²	64	97.5 Å²	97.5	53%	0.529	54%	0.539	S	S	.	.	H	α-helix	trans	-76.4	-17	172.3	0	0	0	0	0	113	K44 T45 E46 R51	K44-A48 VanDerWaalsContact O-CB 3.25Å; K44-A48 WeakPolarHBondContact O-CB 3.47Å; K44-A48 PolarHBondContact O-N 3.24Å; T45-A48 PolarHBondContact O-N 3.45Å; E46-A48 VanDerWaalsContact C-N 3.3Å; E46-A48 PolarHBondContact O-N 3.47Å; A48-R51 WeakPolarHBondContact O-CG 3.46Å
49	S	56.4	Low	69.9	Low	78 Å²	78	99.3 Å²	99.3	55%	0.545	55%	0.546	S	S	.	.	H	α-helix	trans	-80.4	-22.5	176.7	79.4	0	0	0	0	112.8	T45 E46 Q47 R51	T45-S49 PolarHBondContact O-N 3.46Å; T45-S49 VanDerWaalsContact O-N 3.08Å; E46-S49 WeakPolarHBondContact O-CB 3.4Å; E46-S49 PolarHBondContact O-N 3.4Å; E46-S49 PolarHBondContact O-OG 2.95Å; Q47-S49 VanDerWaalsContact C-N 3.28Å; S49-R51 PolarHBondContact O-N 3.02Å
50	S	55.8	Low	70.5	Confident	88 Å²	88	103.1 Å²	103.1	62%	0.615	56%	0.558	S	S	*	*	S	Bend	trans	-73.9	67	160.7	52.1	0	0	0	0	110.9	E46 Q47	E46-S50 PolarHBondContact O-N 3.45Å; Q47-S50 PolarHBondContact O-OG 3.31Å
51	R	56.7	Low	71.2	Confident	169 Å²	169	105.4 Å²	105.4	64%	0.638	56%	0.56	S	S	*	*			trans	-66.3	150.6	-173	-78.3	178.4	167.3	165.3	-3.2	113	A48 S49 A53 D54 S55	A48-R51 WeakPolarHBondContact O-CG 3.46Å; S49-R51 PolarHBondContact O-N 3.02Å; R51-A53 HydrophobicContact CB-CB 4.48Å; R51-A53 PolarHBondContact O-N 3.44Å; R51-D54 PolarHBondContact O-N 3.03Å; R51-S55 PolarHBondContact O-N 3.31Å
52	P	55.8	Low	72	Confident	110 Å²	110	103.3 Å²	103.3	71%	0.714	55%	0.548	S	S	*	.	H	α-helix	trans	-62.3	-21.9	169.4	25	-33.3	0	0	0	113.6	S55 E56	P52-S55 WeakPolarHBondContact O-CB 3.37Å; P52-S55 PolarHBondContact O-N 3.03Å; P52-E56 PolarHBondContact O-N 2.98Å
53	A	56.7	Low	73.3	Confident	62 Å²	62	105 Å²	105	51%	0.512	55%	0.553	S	S	.	*	H	α-helix	trans	-67	-37.4	176.3	0	0	0	0	0	112.8	R51 S55 E56 A57	R51-A53 HydrophobicContact CB-CB 4.48Å; R51-A53 PolarHBondContact O-N 3.44Å; A53-S55 VanDerWaalsContact C-N 3.3Å; A53-E56 PolarHBondContact O-N 3.42Å; A53-A57 WeakPolarHBondContact O-CB 3.39Å; A53-A57 PolarHBondContact O-N 3.36Å
54	D	62.1	Low	74.6	Confident	109 Å²	109	102.5 Å²	102.5	58%	0.583	55%	0.549	S	S	*	.	H	α-helix	trans	-69.1	-33.9	173	-68.5	-35.8	0	0	0	110.6	R51 E58	R51-D54 PolarHBondContact O-N 3.03Å; D54-E58 VanDerWaalsContact O-CB 3.25Å; D54-E58 WeakPolarHBondContact O-CB 3.48Å; D54-E58 PolarHBondContact O-N 3.35Å
55	S	76.6	Confident	76.1	Confident	68 Å²	68	101.6 Å²	101.6	48%	0.476	54%	0.541	S	S	.	.	H	α-helix	trans	-67.6	-38.5	173.2	-174.5	0	0	0	0	113	R51 P52 A53 L59	R51-S55 PolarHBondContact O-N 3.31Å; P52-S55 WeakPolarHBondContact O-CB 3.37Å; P52-S55 PolarHBondContact O-N 3.03Å; A53-S55 VanDerWaalsContact C-N 3.3Å; S55-L59 WeakPolarHBondContact O-CB 3.33Å; S55-L59 WeakPolarHBondContact O-CD1 3.31Å; S55-L59 WeakPolarHBondContact O-CG 3.45Å; S55-L59 PolarHBondContact O-N 3.25Å
56	E	86.2	Confident	77.7	Confident	107 Å²	107	106 Å²	106	50%	0.5	55%	0.548	S	S	.	.	H	α-helix	trans	-71.5	-43.7	177.3	-172.4	178.1	177	0	0	111.3	P52 A53 E58 L59 R60	P52-E56 PolarHBondContact O-N 2.98Å; A53-E56 PolarHBondContact O-N 3.42Å; E56-E58 VanDerWaalsContact C-N 3.31Å; E56-E58 PolarHBondContact O-N 3.46Å; E56-L59 WeakPolarHBondContact O-CB 3.42Å; E56-L59 PolarHBondContact O-N 3.17Å; E56-R60 HydrophobicContact CG-CG 4.46Å; E56-R60 WeakPolarHBondContact O-CG 3.48Å; E56-R60 PolarHBondContact O-N 2.95Å; E56-R60 IonicContact OE1-CZ 3.77Å; E56-R60 IonicContact OE1-NE 3.21Å; E56-R60 IonicContact OE1-NH2 3.73Å; E56-R60 PolarHBondContact OE1-NH2 3.22Å
57	A	87.6	Confident	79.4	Confident	62 Å²	62	106.8 Å²	106.8	51%	0.512	55%	0.547	S	S	.	.	H	α-helix	trans	-59	-43.6	176.2	0	0	0	0	0	111.4	A53 R60 F61	A53-A57 WeakPolarHBondContact O-CB 3.39Å; A53-A57 PolarHBondContact O-N 3.36Å; A57-R60 PolarHBondContact O-N 2.96Å; A57-F61 WeakPolarHBondContact O-CB 3.44Å; A57-F61 PolarHBondContact O-N 2.88Å
58	E	89.8	Confident	81.4	Confident	93 Å²	93	105.7 Å²	105.7	44%	0.435	54%	0.544	S	S	.	.	H	α-helix	trans	-63.3	-42.7	175.1	-177.1	57.4	-153.9	0	0	111.8	D54 E56 R60 F61 Q62	D54-E58 VanDerWaalsContact O-CB 3.25Å; D54-E58 WeakPolarHBondContact O-CB 3.48Å; D54-E58 PolarHBondContact O-N 3.35Å; E56-E58 VanDerWaalsContact C-N 3.31Å; E56-E58 PolarHBondContact O-N 3.46Å; E58-R60 PolarHBondContact O-N 3.44Å; E58-F61 WeakPolarHBondContact O-CB 3.45Å; E58-F61 PolarHBondContact O-N 3Å; E58-Q62 VanDerWaalsContact O-CG 3.25Å; E58-Q62 WeakPolarHBondContact O-CG 3.47Å; E58-Q62 PolarHBondContact O-N 3.39Å; E58-Q62 WeakPolarHBondContact OE1-CG 3.44Å; E58-Q62 PolarHBondContact OE1-NE2 3.43Å
59	L	92.5	Very high	83.4	Confident	114 Å²	114	106.7 Å²	106.7	60%	0.597	54%	0.541	S	S	*	.	H	α-helix	trans	-60	-44.2	175.5	-77.5	167.8	0	0	0	112.2	S55 E56 F61 Q62 Q63	S55-L59 WeakPolarHBondContact O-CB 3.33Å; S55-L59 WeakPolarHBondContact O-CD1 3.31Å; S55-L59 WeakPolarHBondContact O-CG 3.45Å; S55-L59 PolarHBondContact O-N 3.25Å; E56-L59 WeakPolarHBondContact O-CB 3.42Å; E56-L59 PolarHBondContact O-N 3.17Å; L59-F61 VanDerWaalsContact C-N 3.35Å; L59-Q62 PolarHBondContact O-N 3.14Å; L59-Q63 WeakPolarHBondContact O-CB 3.32Å; L59-Q63 PolarHBondContact O-N 2.98Å
60	R	95.9	Very high	85.4	Confident	143 Å²	143	107.8 Å²	107.8	54%	0.54	54%	0.54	S	S	.	.	H	α-helix	trans	-66.5	-37.6	177	-64.8	-62.2	-175.2	103.2	15.3	111.9	E56 A57 E58 Q63 S64	E56-R60 HydrophobicContact CG-CG 4.46Å; E56-R60 WeakPolarHBondContact O-CG 3.48Å; E56-R60 PolarHBondContact O-N 2.95Å; E56-R60 IonicContact OE1-CZ 3.77Å; E56-R60 IonicContact OE1-NE 3.21Å; E56-R60 IonicContact OE1-NH2 3.73Å; E56-R60 PolarHBondContact OE1-NH2 3.22Å; A57-R60 PolarHBondContact O-N 2.96Å; E58-R60 PolarHBondContact O-N 3.44Å; R60-Q63 PolarHBondContact O-N 3.27Å; R60-S64 WeakPolarHBondContact O-CB 3.43Å; R60-S64 PolarHBondContact O-N 3.44Å; R60-S64 PolarHBondContact O-OG 2.94Å
61	F	95.3	Very high	87.5	Confident	116 Å²	116	106 Å²	106	51%	0.509	52%	0.524	S	S	.	.	H	α-helix	trans	-62.6	-49.1	175.1	175	-106.1	0	0	0	110.9	A57 E58 L59 Q63 S64 R65	A57-F61 WeakPolarHBondContact O-CB 3.44Å; A57-F61 PolarHBondContact O-N 2.88Å; E58-F61 WeakPolarHBondContact O-CB 3.45Å; E58-F61 PolarHBondContact O-N 3Å; L59-F61 VanDerWaalsContact C-N 3.35Å; F61-Q63 VanDerWaalsContact C-N 3.32Å; F61-Q63 PolarHBondContact O-N 2.92Å; F61-S64 PolarHBondContact O-N 3.32Å; F61-R65 WeakPolarHBondContact O-CB 3.4Å; F61-R65 PolarHBondContact O-N 3Å
62	Q	96.6	Very high	89.5	Confident	63 Å²	63	99.2 Å²	99.2	29%	0.294	51%	0.506	S	S	.	.	H	α-helix	trans	-61.5	-40.2	177.1	-67.6	-68.4	-11.2	0	0	112.2	E58 L59 R65 R66	E58-Q62 VanDerWaalsContact O-CG 3.25Å; E58-Q62 WeakPolarHBondContact O-CG 3.47Å; E58-Q62 PolarHBondContact O-N 3.39Å; E58-Q62 WeakPolarHBondContact OE1-CG 3.44Å; E58-Q62 PolarHBondContact OE1-NE2 3.43Å; L59-Q62 PolarHBondContact O-N 3.14Å; Q62-R65 PolarHBondContact O-N 3.49Å; Q62-R66 VanDerWaalsContact O-CG 3.32Å; Q62-R66 WeakPolarHBondContact O-CG 3.25Å; Q62-R66 PolarHBondContact O-N 3.26Å
63	Q	97.8	Very high	91.5	Very high	129 Å²	129	102.1 Å²	102.1	60%	0.603	50%	0.503	S	S	*	.	H	α-helix	trans	-63.2	-48	175.6	-173.7	179.2	12.1	0	0	111.6	L59 R60 F61 R65 R66 Y67	L59-Q63 WeakPolarHBondContact O-CB 3.32Å; L59-Q63 PolarHBondContact O-N 2.98Å; R60-Q63 PolarHBondContact O-N 3.27Å; F61-Q63 VanDerWaalsContact C-N 3.32Å; F61-Q63 PolarHBondContact O-N 2.92Å; Q63-R65 VanDerWaalsContact C-N 3.32Å; Q63-R65 PolarHBondContact O-N 3Å; Q63-R66 PolarHBondContact O-N 3.27Å; Q63-Y67 WeakPolarHBondContact O-CB 3.49Å; Q63-Y67 PolarHBondContact O-N 2.97Å
64	S	97.9	Very high	93.5	Very high	67 Å²	67	103.5 Å²	103.5	47%	0.469	50%	0.501	S	S	.	.	H	α-helix	trans	-60.1	-43.2	178	-58.4	0	0	0	0	111.3	R60 F61 Y67 L68	R60-S64 WeakPolarHBondContact O-CB 3.43Å; R60-S64 PolarHBondContact O-N 3.44Å; R60-S64 PolarHBondContact O-OG 2.94Å; F61-S64 PolarHBondContact O-N 3.32Å; S64-Y67 WeakPolarHBondContact O-CB 3.5Å; S64-Y67 PolarHBondContact O-N 3.24Å; S64-L68 WeakPolarHBondContact O-CG 3.41Å; S64-L68 PolarHBondContact O-N 2.91Å
65	R	98.1	Very high	95.2	Very high	137 Å²	137	104 Å²	104	52%	0.517	50%	0.5	S	S	.	.	H	α-helix	trans	-61.4	-48	177.7	-175.4	178.5	174.5	-176.7	0.5	112.1	F61 Q62 Q63 Y67 L68 D69	F61-R65 WeakPolarHBondContact O-CB 3.4Å; F61-R65 PolarHBondContact O-N 3Å; Q62-R65 PolarHBondContact O-N 3.49Å; Q63-R65 VanDerWaalsContact C-N 3.32Å; Q63-R65 PolarHBondContact O-N 3Å; R65-Y67 VanDerWaalsContact C-N 3.29Å; R65-Y67 PolarHBondContact O-N 2.92Å; R65-L68 PolarHBondContact O-N 2.86Å; R65-D69 PolarHBondContact O-N 2.78Å
66	R	98.4	Very high	96.3	Very high	179 Å²	179	107 Å²	107	68%	0.675	51%	0.507	S	S	*	.	H	α-helix	trans	-61.4	-38.8	177	-71.6	174.8	-171.8	-176.7	3.2	112.3	Q62 Q63 L70	Q62-R66 VanDerWaalsContact O-CG 3.32Å; Q62-R66 WeakPolarHBondContact O-CG 3.25Å; Q62-R66 PolarHBondContact O-N 3.26Å; Q63-R66 PolarHBondContact O-N 3.27Å; R66-L70 WeakPolarHBondContact O-CB 3.35Å; R66-L70 PolarHBondContact O-N 2.93Å
67	Y	98.4	Very high	96.9	Very high	150 Å²	150	103.9 Å²	103.9	59%	0.588	50%	0.499	S	S	*	.	H	α-helix	trans	-61.7	-47.6	175.8	172.7	-91.9	0	0	0	111.3	Q63 S64 R65 L70 N71	Q63-Y67 WeakPolarHBondContact O-CB 3.49Å; Q63-Y67 PolarHBondContact O-N 2.97Å; S64-Y67 WeakPolarHBondContact O-CB 3.5Å; S64-Y67 PolarHBondContact O-N 3.24Å; R65-Y67 VanDerWaalsContact C-N 3.29Å; R65-Y67 PolarHBondContact O-N 2.92Å; Y67-L70 PolarHBondContact O-N 3.39Å; Y67-N71 WeakPolarHBondContact O-CB 3.47Å; Y67-N71 PolarHBondContact O-N 2.9Å
68	L	98.7	Very high	97.4	Very high	111 Å²	111	106.6 Å²	106.6	58%	0.581	50%	0.504	S	S	*	.	H	α-helix	trans	-63	-43.5	178.5	-69.3	174.7	0	0	0	112	S64 R65 L70 N71 G72	S64-L68 WeakPolarHBondContact O-CG 3.41Å; S64-L68 PolarHBondContact O-N 2.91Å; R65-L68 PolarHBondContact O-N 2.86Å; L68-L70 VanDerWaalsContact C-N 3.34Å; L68-L70 PolarHBondContact O-N 3.48Å; L68-N71 PolarHBondContact O-N 2.99Å; L68-G72 PolarHBondContact O-N 3.3Å
69	D	98.5	Very high	97.8	Very high	86 Å²	86	103.6 Å²	103.6	46%	0.46	50%	0.498	S	S	.	.	H	α-helix	trans	-59.9	-44	176.2	-77.7	7.4	0	0	0	111.5	R65 R73	R65-D69 PolarHBondContact O-N 2.78Å; D69-R73 WeakPolarHBondContact O-CG 3.4Å; D69-R73 PolarHBondContact O-N 3.44Å
70	L	98.6	Very high	98.1	Very high	100 Å²	100	103.7 Å²	103.7	52%	0.524	50%	0.496	S	S	.	.	H	α-helix	trans	-66.7	-41.9	177.6	-178.9	63.7	0	0	0	111.5	R66 Y67 L68 G72 R73 L74	R66-L70 WeakPolarHBondContact O-CB 3.35Å; R66-L70 PolarHBondContact O-N 2.93Å; Y67-L70 PolarHBondContact O-N 3.39Å; L68-L70 VanDerWaalsContact C-N 3.34Å; L68-L70 PolarHBondContact O-N 3.48Å; L70-G72 VanDerWaalsContact C-N 3.33Å; L70-G72 PolarHBondContact O-N 3.04Å; L70-R73 PolarHBondContact O-N 3.43Å; L70-L74 HydrophobicContact CG-CD1 4.37Å; L70-L74 WeakPolarHBondContact O-CG 3.48Å; L70-L74 PolarHBondContact O-N 3.25Å
71	N	98.6	Very high	98.3	Very high	52 Å²	52	101.9 Å²	101.9	28%	0.278	50%	0.496	S	S	.	.	H	α-helix	trans	-63.2	-41.6	179.2	-165.5	58	0	0	0	111.2	Y67 L68 R73 L74 E75	Y67-N71 WeakPolarHBondContact O-CB 3.47Å; Y67-N71 PolarHBondContact O-N 2.9Å; L68-N71 PolarHBondContact O-N 2.99Å; N71-R73 VanDerWaalsContact C-N 3.35Å; N71-R73 PolarHBondContact O-N 2.9Å; N71-L74 WeakPolarHBondContact O-CB 3.21Å; N71-L74 PolarHBondContact O-N 3.44Å; N71-L74 VanDerWaalsContact O-N 3.14Å; N71-E75 PolarHBondContact ND2-OE1 3.19Å; N71-E75 WeakPolarHBondContact O-CG 3.5Å; N71-E75 PolarHBondContact O-N 2.99Å
72	G	98.6	Very high	98.4	Very high	25 Å²	25	101.1 Å²	101.1	26%	0.258	49%	0.494	S	S	.	.	H	α-helix	trans	-58.8	-44.1	173.9	0	0	0	0	0	112.6	L68 L70 L74 E75 E76	L68-G72 PolarHBondContact O-N 3.3Å; L70-G72 VanDerWaalsContact C-N 3.33Å; L70-G72 PolarHBondContact O-N 3.04Å; G72-L74 VanDerWaalsContact C-N 3.3Å; G72-L74 PolarHBondContact O-N 2.89Å; G72-E75 PolarHBondContact O-N 3.39Å; G72-E76 WeakPolarHBondContact O-CG 3.25Å; G72-E76 PolarHBondContact O-N 3.35Å
73	R	98.6	Very high	98.5	Very high	171 Å²	171	104.7 Å²	104.7	65%	0.645	51%	0.511	S	S	*	.	H	α-helix	trans	-63.6	-35.2	175.5	-67.5	175.2	-171.3	-173.7	2.8	112.9	D69 L70 N71 A77	D69-R73 WeakPolarHBondContact O-CG 3.4Å; D69-R73 PolarHBondContact O-N 3.44Å; L70-R73 PolarHBondContact O-N 3.43Å; N71-R73 VanDerWaalsContact C-N 3.35Å; N71-R73 PolarHBondContact O-N 2.9Å; R73-A77 WeakPolarHBondContact O-CB 3.38Å; R73-A77 PolarHBondContact O-N 3.43Å
74	L	98.8	Very high	98.5	Very high	92 Å²	92	104.2 Å²	104.2	48%	0.482	51%	0.509	S	S	.	.	H	α-helix	trans	-68.6	-42.3	176.1	-74.5	171.8	0	0	0	111.3	L70 N71 G72 A77 L78	L70-L74 HydrophobicContact CG-CD1 4.37Å; L70-L74 WeakPolarHBondContact O-CG 3.48Å; L70-L74 PolarHBondContact O-N 3.25Å; N71-L74 WeakPolarHBondContact O-CB 3.21Å; N71-L74 PolarHBondContact O-N 3.44Å; N71-L74 VanDerWaalsContact O-N 3.14Å; G72-L74 VanDerWaalsContact C-N 3.3Å; G72-L74 PolarHBondContact O-N 2.89Å; L74-A77 PolarHBondContact O-N 3.42Å; L74-L78 WeakPolarHBondContact O-CB 3.5Å; L74-L78 VanDerWaalsContact O-CG 3.31Å; L74-L78 WeakPolarHBondContact O-CG 3.44Å; L74-L78 PolarHBondContact O-N 2.78Å
75	E	98.7	Very high	98.6	Very high	119 Å²	119	107.5 Å²	107.5	56%	0.556	51%	0.511	S	S	*	.	H	α-helix	trans	-61.6	-43.8	175.7	-73	172.5	-172.7	0	0	111.4	N71 G72 L78 G79	N71-E75 PolarHBondContact ND2-OE1 3.19Å; N71-E75 WeakPolarHBondContact O-CG 3.5Å; N71-E75 PolarHBondContact O-N 2.99Å; G72-E75 PolarHBondContact O-N 3.39Å; E75-L78 PolarHBondContact O-N 2.93Å; E75-G79 PolarHBondContact O-N 2.9Å
76	E	98.6	Very high	98.6	Very high	132 Å²	132	105 Å²	105	62%	0.617	51%	0.505	S	S	*	.	H	α-helix	trans	-59.8	-47	173.6	-73.4	175.1	-175.9	0	0	112	G72 L78 G79 Q80	G72-E76 WeakPolarHBondContact O-CG 3.25Å; G72-E76 PolarHBondContact O-N 3.35Å; E76-L78 VanDerWaalsContact C-N 3.34Å; E76-L78 PolarHBondContact O-N 3.35Å; E76-G79 PolarHBondContact O-N 3.03Å; E76-Q80 WeakPolarHBondContact O-CG 3.35Å; E76-Q80 PolarHBondContact O-N 3.25Å
77	A	98.6	Very high	98.6	Very high	41 Å²	41	99.5 Å²	99.5	34%	0.339	50%	0.497	S	S	.	.	H	α-helix	trans	-64	-38.5	179	0	0	0	0	0	112.3	R73 L74 Q80 L81	R73-A77 WeakPolarHBondContact O-CB 3.38Å; R73-A77 PolarHBondContact O-N 3.43Å; L74-A77 PolarHBondContact O-N 3.42Å; A77-Q80 PolarHBondContact O-N 3.01Å; A77-L81 WeakPolarHBondContact O-CB 3.41Å; A77-L81 WeakPolarHBondContact O-CG 3.34Å; A77-L81 PolarHBondContact O-N 3.25Å
78	L	98.7	Very high	98.6	Very high	118 Å²	118	98.5 Å²	98.5	62%	0.618	50%	0.502	S	S	*	.	H	α-helix	trans	-63.5	-43.1	174.2	-76.4	172.4	0	0	0	111.5	L74 E75 E76 L81 Q82	L74-L78 WeakPolarHBondContact O-CB 3.5Å; L74-L78 VanDerWaalsContact O-CG 3.31Å; L74-L78 WeakPolarHBondContact O-CG 3.44Å; L74-L78 PolarHBondContact O-N 2.78Å; E75-L78 PolarHBondContact O-N 2.93Å; E76-L78 VanDerWaalsContact C-N 3.34Å; E76-L78 PolarHBondContact O-N 3.35Å; L78-L81 PolarHBondContact O-N 3.21Å; L78-Q82 WeakPolarHBondContact O-CB 3.36Å; L78-Q82 PolarHBondContact O-N 2.88Å
79	G	98.6	Very high	98.6	Very high	31 Å²	31	98.5 Å²	98.5	32%	0.32	50%	0.499	S	S	.	.	H	α-helix	trans	-58	-49.1	174.7	0	0	0	0	0	112.1	E75 E76 L81 Q82 E83	E75-G79 PolarHBondContact O-N 2.9Å; E76-G79 PolarHBondContact O-N 3.03Å; G79-L81 PolarHBondContact O-N 3.02Å; G79-Q82 WeakPolarHBondContact O-CB 3.4Å; G79-Q82 PolarHBondContact O-N 2.9Å; G79-E83 PolarHBondContact O-N 3.12Å
80	Q	98.6	Very high	98.6	Very high	115 Å²	115	98.8 Å²	98.8	54%	0.537	50%	0.504	S	S	.	.	H	α-helix	trans	-60.8	-42.9	177.8	-69.6	174.6	12.5	0	0	112.6	E76 A77 Q82 E83 Q84	E76-Q80 WeakPolarHBondContact O-CG 3.35Å; E76-Q80 PolarHBondContact O-N 3.25Å; A77-Q80 PolarHBondContact O-N 3.01Å; Q80-Q82 VanDerWaalsContact C-N 3.3Å; Q80-Q82 PolarHBondContact O-N 2.76Å; Q80-E83 PolarHBondContact O-N 3.49Å; Q80-Q84 WeakPolarHBondContact O-CG 3.17Å; Q80-Q84 PolarHBondContact O-N 3.25Å
81	L	98.7	Very high	98.5	Very high	106 Å²	106	96.3 Å²	96.3	56%	0.555	50%	0.498	S	S	*	.	H	α-helix	trans	-64.1	-37.7	176.9	-78	172.3	0	0	0	112	A77 L78 G79 Q84 R85	A77-L81 WeakPolarHBondContact O-CB 3.41Å; A77-L81 WeakPolarHBondContact O-CG 3.34Å; A77-L81 PolarHBondContact O-N 3.25Å; L78-L81 PolarHBondContact O-N 3.21Å; G79-L81 PolarHBondContact O-N 3.02Å; L81-Q84 PolarHBondContact O-N 3.4Å; L81-R85 WeakPolarHBondContact O-CB 3.45Å; L81-R85 PolarHBondContact O-N 3.09Å
82	Q	98.6	Very high	98.5	Very high	99 Å²	99	95.1 Å²	95.1	46%	0.463	50%	0.498	S	S	.	.	H	α-helix	trans	-64.3	-46.5	176.7	178.4	167.6	-8.2	0	0	111.6	L78 G79 Q80 Q84 R85 E86	L78-Q82 WeakPolarHBondContact O-CB 3.36Å; L78-Q82 PolarHBondContact O-N 2.88Å; G79-Q82 WeakPolarHBondContact O-CB 3.4Å; G79-Q82 PolarHBondContact O-N 2.9Å; Q80-Q82 VanDerWaalsContact C-N 3.3Å; Q80-Q82 PolarHBondContact O-N 2.76Å; Q82-Q84 VanDerWaalsContact C-N 3.33Å; Q82-Q84 PolarHBondContact O-N 3.38Å; Q82-R85 WeakPolarHBondContact O-CB 3.35Å; Q82-R85 PolarHBondContact O-N 3.3Å; Q82-E86 WeakPolarHBondContact CG-OE1 3.39Å; Q82-E86 PolarHBondContact NE2-OE1 2.86Å; Q82-E86 WeakPolarHBondContact O-CG 3.43Å; Q82-E86 PolarHBondContact O-N 3.08Å
83	E	98.5	Very high	98.5	Very high	138 Å²	138	97.8 Å²	97.8	65%	0.645	50%	0.503	S	S	*	.	H	α-helix	trans	-58.7	-45.3	176	-70.9	176.7	-179.3	0	0	111.5	G79 Q80 R85 E86 A87	G79-E83 PolarHBondContact O-N 3.12Å; Q80-E83 PolarHBondContact O-N 3.49Å; E83-R85 VanDerWaalsContact C-N 3.35Å; E83-R85 PolarHBondContact O-N 3.46Å; E83-E86 PolarHBondContact O-N 3.47Å; E83-A87 WeakPolarHBondContact O-CB 3.25Å; E83-A87 PolarHBondContact O-N 3.4Å
84	Q	98.5	Very high	98.4	Very high	119 Å²	119	94.3 Å²	94.3	56%	0.556	50%	0.495	S	S	*	.	H	α-helix	trans	-61.8	-41.7	177.2	-73.3	178.1	-1.1	0	0	112.4	Q80 L81 Q82 A87 L88	Q80-Q84 WeakPolarHBondContact O-CG 3.17Å; Q80-Q84 PolarHBondContact O-N 3.25Å; L81-Q84 PolarHBondContact O-N 3.4Å; Q82-Q84 VanDerWaalsContact C-N 3.33Å; Q82-Q84 PolarHBondContact O-N 3.38Å; Q84-A87 PolarHBondContact O-N 3.26Å; Q84-L88 WeakPolarHBondContact O-CB 3.34Å; Q84-L88 WeakPolarHBondContact O-CG 3.44Å; Q84-L88 PolarHBondContact O-N 3.07Å
85	R	98.6	Very high	98.3	Very high	137 Å²	137	95.3 Å²	95.3	52%	0.517	50%	0.5	S	S	.	.	H	α-helix	trans	-60.5	-47.1	176.5	-178.5	-161.3	69.5	-159.6	-3	111.1	L81 Q82 E83 L88 Q89	L81-R85 WeakPolarHBondContact O-CB 3.45Å; L81-R85 PolarHBondContact O-N 3.09Å; Q82-R85 WeakPolarHBondContact O-CB 3.35Å; Q82-R85 PolarHBondContact O-N 3.3Å; E83-R85 VanDerWaalsContact C-N 3.35Å; E83-R85 PolarHBondContact O-N 3.46Å; R85-L88 PolarHBondContact O-N 2.89Å; R85-Q89 WeakPolarHBondContact O-CB 3.43Å; R85-Q89 PolarHBondContact O-N 2.95Å
86	E	98.6	Very high	98.2	Very high	85 Å²	85	94.7 Å²	94.7	40%	0.397	50%	0.5	S	S	.	.	H	α-helix	trans	-65.7	-40.2	-178.9	-71.9	171.9	-164.6	0	0	111.7	Q82 E83 Q89 T90	Q82-E86 WeakPolarHBondContact CG-OE1 3.39Å; Q82-E86 PolarHBondContact NE2-OE1 2.86Å; Q82-E86 WeakPolarHBondContact O-CG 3.43Å; Q82-E86 PolarHBondContact O-N 3.08Å; E83-E86 PolarHBondContact O-N 3.47Å; E86-Q89 PolarHBondContact O-N 2.61Å; E86-T90 WeakPolarHBondContact O-CB 3.1Å; E86-T90 PolarHBondContact O-N 3.48Å; E86-T90 PolarHBondContact O-OG1 3.08Å
87	A	98.4	Very high	98.1	Very high	62 Å²	62	94.5 Å²	94.5	51%	0.512	49%	0.494	S	S	.	.	H	α-helix	trans	-61.4	-45.6	173.7	0	0	0	0	0	112	E83 Q84 T90 A91	E83-A87 WeakPolarHBondContact O-CB 3.25Å; E83-A87 PolarHBondContact O-N 3.4Å; Q84-A87 PolarHBondContact O-N 3.26Å; A87-T90 PolarHBondContact O-N 3.04Å; A87-A91 WeakPolarHBondContact O-CB 3.32Å; A87-A91 PolarHBondContact O-N 2.91Å
88	L	98.4	Very high	97.9	Very high	129 Å²	129	95.1 Å²	95.1	68%	0.675	49%	0.494	S	S	*	.	H	α-helix	trans	-64.9	-41.2	177.2	-75.8	173	0	0	0	112.3	Q84 R85 A91 G92	Q84-L88 WeakPolarHBondContact O-CB 3.34Å; Q84-L88 WeakPolarHBondContact O-CG 3.44Å; Q84-L88 PolarHBondContact O-N 3.07Å; R85-L88 PolarHBondContact O-N 2.89Å; L88-A91 PolarHBondContact O-N 3.39Å; L88-G92 PolarHBondContact O-N 3.33Å
89	Q	98.3	Very high	97.7	Very high	112 Å²	112	94.6 Å²	94.6	52%	0.523	49%	0.49	S	S	.	.	H	α-helix	trans	-61.4	-46.5	176.6	-176.7	174	-8.2	0	0	111	R85 E86 A91 G92 E93	R85-Q89 WeakPolarHBondContact O-CB 3.43Å; R85-Q89 PolarHBondContact O-N 2.95Å; E86-Q89 PolarHBondContact O-N 2.61Å; Q89-A91 VanDerWaalsContact C-N 3.35Å; Q89-A91 PolarHBondContact O-N 3.04Å; Q89-G92 PolarHBondContact O-N 2.85Å; Q89-E93 WeakPolarHBondContact O-CG 3.39Å; Q89-E93 PolarHBondContact O-N 3.17Å
90	T	98.3	Very high	97.5	Very high	91 Å²	91	98.6 Å²	98.6	56%	0.558	50%	0.5	S	S	*	.	H	α-helix	trans	-60.8	-44.3	176.8	-53.6	0	0	0	0	111.7	E86 A87 G92 E93 Q94	E86-T90 WeakPolarHBondContact O-CB 3.1Å; E86-T90 PolarHBondContact O-N 3.48Å; E86-T90 PolarHBondContact O-OG1 3.08Å; A87-T90 PolarHBondContact O-N 3.04Å; T90-G92 VanDerWaalsContact C-N 3.33Å; T90-G92 PolarHBondContact O-N 3.06Å; T90-E93 PolarHBondContact O-N 3.31Å; T90-Q94 WeakPolarHBondContact O-CB 3.36Å; T90-Q94 PolarHBondContact O-N 2.71Å
91	A	97.9	Very high	97.2	Very high	49 Å²	49	98.9 Å²	98.9	41%	0.405	50%	0.501	S	S	.	.	H	α-helix	trans	-63	-40.5	176.7	0	0	0	0	0	111.8	A87 L88 Q89 Q94 L95	A87-A91 WeakPolarHBondContact O-CB 3.32Å; A87-A91 PolarHBondContact O-N 2.91Å; L88-A91 PolarHBondContact O-N 3.39Å; Q89-A91 VanDerWaalsContact C-N 3.35Å; Q89-A91 PolarHBondContact O-N 3.04Å; A91-Q94 PolarHBondContact O-N 2.96Å; A91-L95 VanDerWaalsContact O-CG 3.3Å; A91-L95 WeakPolarHBondContact O-CG 3.42Å; A91-L95 PolarHBondContact O-N 2.95Å
92	G	97.9	Very high	96.9	Very high	27 Å²	27	98 Å²	98	28%	0.278	50%	0.5	S	S	.	.	H	α-helix	trans	-61.4	-49.3	175.1	0	0	0	0	0	112.5	L88 Q89 T90 Q94 L95 D96	L88-G92 PolarHBondContact O-N 3.33Å; Q89-G92 PolarHBondContact O-N 2.85Å; T90-G92 VanDerWaalsContact C-N 3.33Å; T90-G92 PolarHBondContact O-N 3.06Å; G92-Q94 VanDerWaalsContact C-N 3.27Å; G92-Q94 PolarHBondContact O-N 3.05Å; G92-L95 WeakPolarHBondContact O-CB 3.35Å; G92-L95 PolarHBondContact O-N 2.57Å; G92-L95 VanDerWaalsContact O-N 3.13Å; G92-D96 PolarHBondContact O-N 2.94Å
93	E	97.8	Very high	96.5	Very high	80 Å²	80	97.9 Å²	97.9	37%	0.374	50%	0.498	S	S	.	.	H	α-helix	trans	-59.7	-39.1	176.7	-72	177.4	-163.5	0	0	112.3	Q89 T90 D96 R97	Q89-E93 WeakPolarHBondContact O-CG 3.39Å; Q89-E93 PolarHBondContact O-N 3.17Å; T90-E93 PolarHBondContact O-N 3.31Å; E93-D96 PolarHBondContact O-N 3Å; E93-R97 WeakPolarHBondContact O-CG 3.37Å; E93-R97 PolarHBondContact O-N 3.26Å; E93-R97 VanDerWaalsContact O-N 3.1Å; E93-R97 IonicContact OE2-NH2 2.57Å; E93-R97 PolarHBondContact OE2-NH2 3.35Å
94	Q	97.3	Very high	95.9	Very high	98 Å²	98	93.8 Å²	93.8	46%	0.458	49%	0.493	S	S	.	.	H	α-helix	trans	-66.5	-42.1	176.7	-172.7	61	20.9	0	0	111.3	T90 A91 G92 R97 T98	T90-Q94 WeakPolarHBondContact O-CB 3.36Å; T90-Q94 PolarHBondContact O-N 2.71Å; A91-Q94 PolarHBondContact O-N 2.96Å; G92-Q94 VanDerWaalsContact C-N 3.27Å; G92-Q94 PolarHBondContact O-N 3.05Å; Q94-R97 PolarHBondContact O-N 3.49Å; Q94-R97 VanDerWaalsContact OE1-NH1 3.14Å; Q94-T98 WeakPolarHBondContact O-CG2 3.32Å; Q94-T98 PolarHBondContact O-N 2.96Å; Q94-T98 PolarHBondContact O-OG1 3.4Å
95	L	97.1	Very high	94.8	Very high	114 Å²	114	95.7 Å²	95.7	60%	0.597	50%	0.501	S	S	*	.	H	α-helix	trans	-61	-45.9	175.6	-76	167.5	0	0	0	111.3	A91 G92 R97 T98 M99	A91-L95 VanDerWaalsContact O-CG 3.3Å; A91-L95 WeakPolarHBondContact O-CG 3.42Å; A91-L95 PolarHBondContact O-N 2.95Å; G92-L95 WeakPolarHBondContact O-CB 3.35Å; G92-L95 PolarHBondContact O-N 2.57Å; G92-L95 VanDerWaalsContact O-N 3.13Å; L95-R97 VanDerWaalsContact C-N 3.33Å; L95-R97 PolarHBondContact O-N 3.31Å; L95-T98 WeakPolarHBondContact CA-OG1 3.34Å; L95-T98 PolarHBondContact O-N 3.38Å; L95-T98 VanDerWaalsContact O-N 3.16Å; L95-T98 PolarHBondContact O-OG1 3.05Å; L95-M99 WeakPolarHBondContact O-CB 3.44Å; L95-M99 PolarHBondContact O-N 3.37Å
96	D	96.5	Very high	93.2	Very high	105 Å²	105	95 Å²	95	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-58.6	-44.7	178.1	-72.8	-24.7	0	0	0	111.4	G92 E93 T98 M99 E100	G92-D96 PolarHBondContact O-N 2.94Å; E93-D96 PolarHBondContact O-N 3Å; D96-T98 PolarHBondContact O-N 3.28Å; D96-M99 PolarHBondContact O-N 3.07Å; D96-E100 WeakPolarHBondContact O-CG 3.45Å; D96-E100 PolarHBondContact O-N 2.91Å
97	R	95.6	Very high	90.8	Very high	128 Å²	128	99.1 Å²	99.1	48%	0.483	55%	0.548	S	S	.	.	H	α-helix	trans	-58.7	-48.8	174.4	-69	172.6	-158.7	143.4	7.6	111.7	E93 Q94 L95 M99 E100 E101	E93-R97 WeakPolarHBondContact O-CG 3.37Å; E93-R97 PolarHBondContact O-N 3.26Å; E93-R97 VanDerWaalsContact O-N 3.1Å; E93-R97 IonicContact OE2-NH2 2.57Å; E93-R97 PolarHBondContact OE2-NH2 3.35Å; Q94-R97 PolarHBondContact O-N 3.49Å; Q94-R97 VanDerWaalsContact OE1-NH1 3.14Å; L95-R97 VanDerWaalsContact C-N 3.33Å; L95-R97 PolarHBondContact O-N 3.31Å; R97-M99 VanDerWaalsContact C-N 3.25Å; R97-M99 PolarHBondContact O-N 3.39Å; R97-E100 PolarHBondContact O-N 3.46Å; R97-E101 WeakPolarHBondContact O-CG 3.24Å; R97-E101 PolarHBondContact O-N 2.97Å
98	T	95.7	Very high	90.4	Very high	55 Å²	55	101 Å²	101	34%	0.337	55%	0.55	S	S	.	*	H	α-helix	trans	-62.9	-34.5	179	59.7	0	0	0	0	112.2	Q94 L95 D96 E101 V102	Q94-T98 WeakPolarHBondContact O-CG2 3.32Å; Q94-T98 PolarHBondContact O-N 2.96Å; Q94-T98 PolarHBondContact O-OG1 3.4Å; L95-T98 WeakPolarHBondContact CA-OG1 3.34Å; L95-T98 PolarHBondContact O-N 3.38Å; L95-T98 VanDerWaalsContact O-N 3.16Å; L95-T98 PolarHBondContact O-OG1 3.05Å; D96-T98 PolarHBondContact O-N 3.28Å; T98-E101 PolarHBondContact O-N 3.48Å; T98-V102 VanDerWaalsContact O-CG2 3.3Å; T98-V102 WeakPolarHBondContact O-CG2 3.31Å; T98-V102 PolarHBondContact O-N 2.96Å
99	M	94.7	Very high	90	Very high	107 Å²	107	99.5 Å²	99.5	53%	0.527	54%	0.544	S	S	.	.	H	α-helix	trans	-69.5	-40.1	178.1	-170.8	175.7	176.7	0	0	111.5	L95 D96 R97 V102 K103	L95-M99 WeakPolarHBondContact O-CB 3.44Å; L95-M99 PolarHBondContact O-N 3.37Å; D96-M99 PolarHBondContact O-N 3.07Å; R97-M99 VanDerWaalsContact C-N 3.25Å; R97-M99 PolarHBondContact O-N 3.39Å; M99-V102 PolarHBondContact O-N 3.19Å; M99-K103 WeakPolarHBondContact O-CG 3.45Å; M99-K103 PolarHBondContact O-N 3.09Å
100	E	94.6	Very high	89.6	Confident	114 Å²	114	98.8 Å²	98.8	53%	0.533	55%	0.545	S	S	.	.	H	α-helix	trans	-66.5	-39.6	174.3	-69.2	-55.7	126.3	0	0	112.3	D96 R97 K103 G104	D96-E100 WeakPolarHBondContact O-CG 3.45Å; D96-E100 PolarHBondContact O-N 2.91Å; R97-E100 PolarHBondContact O-N 3.46Å; E100-K103 PolarHBondContact O-N 3.28Å; E100-K103 IonicContact OE1-NZ 2.75Å; E100-K103 PolarHBondContact OE1-NZ 3.01Å; E100-G104 PolarHBondContact O-N 3.34Å
101	E	92.3	Very high	89.1	Confident	122 Å²	122	99.2 Å²	99.2	57%	0.57	54%	0.544	S	S	*	.	H	α-helix	trans	-59.7	-46.5	172.9	-72.7	172.7	-173.1	0	0	112	R97 T98 G104 Q105	R97-E101 WeakPolarHBondContact O-CG 3.24Å; R97-E101 PolarHBondContact O-N 2.97Å; T98-E101 PolarHBondContact O-N 3.48Å; E101-G104 PolarHBondContact O-N 3.26Å; E101-Q105 WeakPolarHBondContact O-CG 3.46Å; E101-Q105 PolarHBondContact O-N 3.34Å; E101-Q105 VanDerWaalsContact O-N 3.11Å
102	V	91.8	Very high	88.5	Confident	86 Å²	86	102.4 Å²	102.4	52%	0.521	55%	0.553	S	S	.	*	H	α-helix	trans	-64.6	-43.4	178.2	171.1	0	0	0	0	111.2	T98 M99 G104 Q105 V106	T98-V102 VanDerWaalsContact O-CG2 3.3Å; T98-V102 WeakPolarHBondContact O-CG2 3.31Å; T98-V102 PolarHBondContact O-N 2.96Å; M99-V102 PolarHBondContact O-N 3.19Å; V102-G104 VanDerWaalsContact C-N 3.31Å; V102-G104 PolarHBondContact O-N 3.2Å; V102-Q105 PolarHBondContact O-N 3.09Å; V102-V106 WeakPolarHBondContact O-CG2 3.47Å; V102-V106 PolarHBondContact O-N 3.11Å
103	K	90.9	Very high	87.9	Confident	98 Å²	98	107.4 Å²	107.4	43%	0.426	57%	0.571	S	S	.	*	H	α-helix	trans	-60.1	-42.1	175.1	-75.7	175.2	-169.7	163.4	0	111.7	M99 E100 Q105 V106 C107	M99-K103 WeakPolarHBondContact O-CG 3.45Å; M99-K103 PolarHBondContact O-N 3.09Å; E100-K103 PolarHBondContact O-N 3.28Å; E100-K103 IonicContact OE1-NZ 2.75Å; E100-K103 PolarHBondContact OE1-NZ 3.01Å; K103-Q105 VanDerWaalsContact C-N 3.26Å; K103-Q105 PolarHBondContact O-N 3.3Å; K103-V106 PolarHBondContact O-N 3.22Å; K103-C107 PolarHBondContact O-N 3.23Å
104	G	85.3	Confident	87.2	Confident	52 Å²	52	109.4 Å²	109.4	54%	0.536	59%	0.585	S	S	.	*	H	α-helix	trans	-67	-23.4	178.7	0	0	0	0	0	114.3	E100 E101 V102	E100-G104 PolarHBondContact O-N 3.34Å; E101-G104 PolarHBondContact O-N 3.26Å; V102-G104 VanDerWaalsContact C-N 3.31Å; V102-G104 PolarHBondContact O-N 3.2Å
105	Q	74.4	Confident	86.4	Confident	158 Å²	158	110.2 Å²	110.2	74%	0.738	60%	0.595	S	S	*	*	H	α-helix	trans	-84.6	-18.7	175.3	-73	176.6	7.3	0	0	113.8	E101 V102 K103	E101-Q105 WeakPolarHBondContact O-CG 3.46Å; E101-Q105 PolarHBondContact O-N 3.34Å; E101-Q105 VanDerWaalsContact O-N 3.11Å; V102-Q105 PolarHBondContact O-N 3.09Å; K103-Q105 VanDerWaalsContact C-N 3.26Å; K103-Q105 PolarHBondContact O-N 3.3Å
106	V	65.2	Low	85.5	Confident	124 Å²	124	109.9 Å²	109.9	75%	0.752	59%	0.594	S	S	*	*	H	α-helix	trans	-95.8	-12.4	-177.3	178.3	0	0	0	0	112.2	V102 K103	V102-V106 WeakPolarHBondContact O-CG2 3.47Å; V102-V106 PolarHBondContact O-N 3.11Å; K103-V106 PolarHBondContact O-N 3.22Å
107	C	49.3	Very low	84.5	Confident	170 Å²	170	110.4 Å²	110.4	100%	1.149	60%	0.597	S	S	*	*			trans	-91.2	0	168.3	-72	0	0	0	0	111.4	K103	K103-C107 PolarHBondContact O-N 3.23Å

Retrieved 107 of 107 residues in 43.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).