A0A087XBI5_POEFO Loading...

LYR motif containing 5a

AlphaFold DB , UniProt , Accession A0A087XBI5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 85 aa.

						>A0A087XBI5_POEFO|A0A087XBI5
MANPLKGEVMRLYKTLLYLGREYPKGAAYFRERLKHAFMKNKDETDPEKIKQLVARGDHVIKELEALYFLRKYRAMKKRYYDPEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.1	Very low	79.5	Confident	244 Å²	244	102.5 Å²	102.5	100%	1.202	55%	0.547	S	S	*	.				0	126.7	0	-62.5	-176.5	-170.4	0	0	108.1	N3	M1-N3 PolarHBondContact O-N 3.4Å
2	A	55.4	Low	80.8	Confident	98 Å²	98	94.9 Å²	94.9	81%	0.81	51%	0.507	S	S	*	.			trans	-65.9	124.9	175.8	0	0	0	0	0	108.8	P4	A2-P4 WeakPolarHBondContact O-CD 3.33Å; A2-P4 VanDerWaalsContact O-N 3.12Å
3	N	67.7	Low	81.9	Confident	92 Å²	92	92.4 Å²	92.4	49%	0.492	49%	0.487	S	S	.	.			trans	-65.6	109.9	177.6	-174.9	-11.4	0	0	0	108.4	M1 L5 K6	M1-N3 PolarHBondContact O-N 3.4Å; N3-L5 PolarHBondContact O-N 3.32Å; N3-L5 VanDerWaalsContact O-N 3.12Å; N3-L5 PolarHBondContact OD1-N 3.24Å; N3-K6 HydrophobicContact CB-CB 4.19Å; N3-K6 VanDerWaalsContact O-CB 3.31Å; N3-K6 WeakPolarHBondContact O-CB 3.43Å; N3-K6 PolarHBondContact O-N 3.29Å
4	P	75.9	Confident	82.8	Confident	104 Å²	104	95 Å²	95	68%	0.675	49%	0.492	S	S	*	.	H	α-helix	trans	-58.6	-30.3	-172.2	21.8	-31.7	0	0	0	112.2	A2 K6	A2-P4 WeakPolarHBondContact O-CD 3.33Å; A2-P4 VanDerWaalsContact O-N 3.12Å; P4-K6 PolarHBondContact O-N 2.96Å
5	L	84.1	Confident	83.7	Confident	16 Å²	16	92.8 Å²	92.8	8%	0.084	49%	0.485	C	S	.	.	H	α-helix	trans	-73.9	-23.5	179.6	-59.8	175.2	0	0	0	113.4	N3 G7 E8 V9 P47 I50 K51	N3-L5 PolarHBondContact O-N 3.32Å; N3-L5 VanDerWaalsContact O-N 3.12Å; N3-L5 PolarHBondContact OD1-N 3.24Å; L5-G7 PolarHBondContact O-N 3.3Å; L5-E8 WeakPolarHBondContact O-CB 3.3Å; L5-E8 PolarHBondContact O-N 3.28Å; L5-E8 VanDerWaalsContact O-N 3.17Å; L5-V9 WeakPolarHBondContact O-CG2 3.47Å; L5-V9 PolarHBondContact O-N 3.41Å; L5-P47 HydrophobicContact CD1-CB 3.86Å; L5-I50 HydrophobicContact CB-CG2 3.98Å; L5-I50 HydrophobicContact CD1-CB 4.08Å; L5-I50 HydrophobicContact CD1-CD1 4.3Å; L5-I50 HydrophobicContact CD1-CG2 3.97Å; L5-I50 HydrophobicContact CG-CG2 4.46Å; L5-K51 HydrophobicContact CD2-CG 4.06Å
6	K	86.6	Confident	84.4	Confident	158 Å²	158	87.4 Å²	87.4	69%	0.687	46%	0.456	S	S	*	.	H	α-helix	trans	-62.3	-35.7	179.8	-171.9	177	-179.2	179	0	111.6	N3 P4 M10	N3-K6 HydrophobicContact CB-CB 4.19Å; N3-K6 VanDerWaalsContact O-CB 3.31Å; N3-K6 WeakPolarHBondContact O-CB 3.43Å; N3-K6 PolarHBondContact O-N 3.29Å; P4-K6 PolarHBondContact O-N 2.96Å; K6-M10 WeakPolarHBondContact O-CB 3.12Å; K6-M10 PolarHBondContact O-N 2.96Å; K6-M10 VanDerWaalsContact O-N 3.08Å
7	G	90.3	Very high	85	Confident	31 Å²	31	85 Å²	85	32%	0.32	44%	0.444	S	S	.	.	H	α-helix	trans	-65.4	-43	175.9	0	0	0	0	0	112.3	L5 M10 R11	L5-G7 PolarHBondContact O-N 3.3Å; G7-M10 PolarHBondContact O-N 3.39Å; G7-R11 WeakPolarHBondContact O-CG 3.43Å; G7-R11 PolarHBondContact O-N 2.88Å
8	E	90.9	Very high	85.4	Confident	75 Å²	75	88.7 Å²	88.7	35%	0.35	45%	0.452	S	S	.	.	H	α-helix	trans	-62.1	-50.3	176.9	-76.6	169	-149.3	0	0	111.9	L5 M10 R11 L12	L5-E8 WeakPolarHBondContact O-CB 3.3Å; L5-E8 PolarHBondContact O-N 3.28Å; L5-E8 VanDerWaalsContact O-N 3.17Å; E8-M10 VanDerWaalsContact C-N 3.28Å; E8-M10 PolarHBondContact O-N 3.39Å; E8-R11 PolarHBondContact O-N 3.1Å; E8-R11 VanDerWaalsContact O-N 3.17Å; E8-L12 WeakPolarHBondContact O-CB 3.46Å; E8-L12 PolarHBondContact O-N 3.35Å
9	V	92.7	Very high	85.8	Confident	47 Å²	47	85.4 Å²	85.4	29%	0.285	44%	0.435	S	S	.	.	H	α-helix	trans	-59.7	-40.7	178.5	178.3	0	0	0	0	111.1	L5 L12 Y13 F38 I50 V54	L5-V9 WeakPolarHBondContact O-CG2 3.47Å; L5-V9 PolarHBondContact O-N 3.41Å; V9-L12 PolarHBondContact O-N 2.92Å; V9-Y13 PolarHBondContact O-N 3.31Å; V9-F38 HydrophobicContact CG1-CD1 4.02Å; V9-F38 HydrophobicContact CG1-CE1 3.72Å; V9-I50 HydrophobicContact CG2-CG2 3.94Å; V9-V54 HydrophobicContact CG2-CG2 3.8Å
10	M	93.2	Very high	86.1	Confident	111 Å²	111	81.2 Å²	81.2	55%	0.547	42%	0.415	S	S	.	.	H	α-helix	trans	-67.1	-39.9	178.2	-171.3	174.8	-172.1	0	0	112.5	K6 G7 E8 K14	K6-M10 WeakPolarHBondContact O-CB 3.12Å; K6-M10 PolarHBondContact O-N 2.96Å; K6-M10 VanDerWaalsContact O-N 3.08Å; G7-M10 PolarHBondContact O-N 3.39Å; E8-M10 VanDerWaalsContact C-N 3.28Å; E8-M10 PolarHBondContact O-N 3.39Å; M10-K14 WeakPolarHBondContact O-CG 3.38Å; M10-K14 PolarHBondContact O-N 3.37Å; M10-K14 VanDerWaalsContact O-N 3.17Å
11	R	94.6	Very high	86.3	Confident	151 Å²	151	85.2 Å²	85.2	57%	0.57	43%	0.425	S	S	*	.	H	α-helix	trans	-62.1	-49.3	173.8	-74.7	-169.4	-57.1	-94.1	7.5	110.5	G7 E8 Y13 K14 T15	G7-R11 WeakPolarHBondContact O-CG 3.43Å; G7-R11 PolarHBondContact O-N 2.88Å; E8-R11 PolarHBondContact O-N 3.1Å; E8-R11 VanDerWaalsContact O-N 3.17Å; R11-Y13 VanDerWaalsContact C-N 3.32Å; R11-Y13 PolarHBondContact O-N 3.2Å; R11-K14 PolarHBondContact O-N 3.36Å; R11-K14 VanDerWaalsContact O-N 3.14Å; R11-T15 PolarHBondContact O-N 3.5Å; R11-T15 PolarHBondContact O-OG1 3.36Å; R11-T15 VanDerWaalsContact O-OG1 3.08Å
12	L	95	Very high	88.3	Confident	12 Å²	12	79 Å²	79	6%	0.063	39%	0.393	C	S	.	.	H	α-helix	trans	-54.8	-47.2	178	177.8	65	0	0	0	111.9	E8 V9 K14 T15 L16 F38 V54 I61	E8-L12 WeakPolarHBondContact O-CB 3.46Å; E8-L12 PolarHBondContact O-N 3.35Å; V9-L12 PolarHBondContact O-N 2.92Å; L12-K14 PolarHBondContact O-N 3.34Å; L12-T15 PolarHBondContact O-N 3.31Å; L12-L16 HydrophobicContact CD1-CD1 3.91Å; L12-L16 HydrophobicContact CD1-CG 4.19Å; L12-L16 HydrophobicContact CG-CD1 3.96Å; L12-L16 WeakPolarHBondContact O-CB 3.47Å; L12-L16 WeakPolarHBondContact O-CG 3.28Å; L12-L16 PolarHBondContact O-N 3.42Å; L12-F38 HydrophobicContact CD2-CZ 4.13Å; L12-F38 HydrophobicContact CG-CZ 4.16Å; L12-V54 HydrophobicContact CD2-CB 4.45Å; L12-V54 HydrophobicContact CD2-CG1 4.39Å; L12-V54 HydrophobicContact CD2-CG2 4.39Å; L12-I61 HydrophobicContact CD1-CD1 3.76Å
13	Y	95	Very high	90	Very high	62 Å²	62	77.5 Å²	77.5	24%	0.243	37%	0.367	C	S	.	.	H	α-helix	trans	-59.2	-45	178	-177.1	-96.8	0	0	0	112.4	V9 R11 L17 L34 F38	V9-Y13 PolarHBondContact O-N 3.31Å; R11-Y13 VanDerWaalsContact C-N 3.32Å; R11-Y13 PolarHBondContact O-N 3.2Å; Y13-L17 HydrophobicContact CE1-CD2 4.34Å; Y13-L17 VanDerWaalsContact O-CB 3.27Å; Y13-L17 WeakPolarHBondContact O-CB 3.31Å; Y13-L17 PolarHBondContact O-N 3.47Å; Y13-L34 HydrophobicContact CD2-CD2 3.95Å; Y13-L34 HydrophobicContact CD2-CG 4.07Å; Y13-L34 HydrophobicContact CE2-CD2 3.76Å; Y13-L34 HydrophobicContact CE2-CG 3.86Å; Y13-F38 AromaticContact CD2-CD1 3.93Å; Y13-F38 HydrophobicContact CD2-CD1 3.93Å; Y13-F38 AromaticContact CD2-CD2 3.85Å; Y13-F38 HydrophobicContact CD2-CD2 3.85Å; Y13-F38 AromaticContact CD2-CE1 4Å; Y13-F38 HydrophobicContact CD2-CE1 4Å; Y13-F38 AromaticContact CD2-CE2 3.94Å; Y13-F38 HydrophobicContact CD2-CE2 3.94Å; Y13-F38 AromaticContact CD2-CG 3.85Å; Y13-F38 HydrophobicContact CD2-CG 3.85Å; Y13-F38 AromaticContact CD2-CZ 4Å; Y13-F38 HydrophobicContact CD2-CZ 4Å; Y13-F38 HydrophobicContact CE2-CD2 4.4Å; Y13-F38 HydrophobicContact CE2-CG 4.42Å; Y13-F38 HydrophobicContact CG-CE1 4.37Å; Y13-F38 HydrophobicContact CG-CZ 4.48Å
14	K	95.3	Very high	91	Very high	129 Å²	129	77.7 Å²	77.7	56%	0.561	37%	0.373	S	S	*	.	H	α-helix	trans	-65.4	-42.4	178.4	-73	179.8	177.4	-176.9	0	111.8	M10 R11 L12 L17 Y18	M10-K14 WeakPolarHBondContact O-CG 3.38Å; M10-K14 PolarHBondContact O-N 3.37Å; M10-K14 VanDerWaalsContact O-N 3.17Å; R11-K14 PolarHBondContact O-N 3.36Å; R11-K14 VanDerWaalsContact O-N 3.14Å; L12-K14 PolarHBondContact O-N 3.34Å; K14-L17 PolarHBondContact O-N 3.25Å; K14-Y18 PolarHBondContact O-N 3.23Å
15	T	95.3	Very high	91.6	Very high	62 Å²	62	79.3 Å²	79.3	38%	0.38	37%	0.369	S	S	.	.	H	α-helix	trans	-63	-49	178	-57.3	0	0	0	0	111.2	R11 L12 L17 Y18 L19 I61	R11-T15 PolarHBondContact O-N 3.5Å; R11-T15 PolarHBondContact O-OG1 3.36Å; R11-T15 VanDerWaalsContact O-OG1 3.08Å; L12-T15 PolarHBondContact O-N 3.31Å; T15-L17 VanDerWaalsContact C-N 3.31Å; T15-L17 PolarHBondContact O-N 2.91Å; T15-Y18 PolarHBondContact O-N 3.04Å; T15-L19 HydrophobicContact CG2-CD1 4.04Å; T15-L19 WeakPolarHBondContact O-CG 3.2Å; T15-L19 PolarHBondContact O-N 3.48Å; T15-I61 HydrophobicContact CG2-CD1 3.63Å; T15-I61 HydrophobicContact CG2-CG1 4.33Å
16	L	94.8	Very high	92	Very high	6 Å²	6	80 Å²	80	3%	0.031	38%	0.381	C	S	.	.	H	α-helix	trans	-62	-39	176.5	-75.1	170.4	0	0	0	112	L12 Y18 L19 G20 F30 L34 F38 V60 I61 L64	L12-L16 HydrophobicContact CD1-CD1 3.91Å; L12-L16 HydrophobicContact CD1-CG 4.19Å; L12-L16 HydrophobicContact CG-CD1 3.96Å; L12-L16 WeakPolarHBondContact O-CB 3.47Å; L12-L16 WeakPolarHBondContact O-CG 3.28Å; L12-L16 PolarHBondContact O-N 3.42Å; L16-Y18 VanDerWaalsContact C-N 3.33Å; L16-Y18 PolarHBondContact O-N 3.44Å; L16-L19 PolarHBondContact O-N 3.45Å; L16-G20 PolarHBondContact O-N 3.02Å; L16-F30 VanDerWaalsContact O-CE1 3.23Å; L16-F30 WeakPolarHBondContact O-CE1 3.38Å; L16-L34 HydrophobicContact CB-CD1 3.67Å; L16-L34 HydrophobicContact CB-CD2 4.04Å; L16-L34 HydrophobicContact CD1-CD1 3.65Å; L16-L34 HydrophobicContact CG-CD1 4.26Å; L16-F38 HydrophobicContact CD1-CE2 4.13Å; L16-F38 HydrophobicContact CD1-CZ 4.29Å; L16-V60 HydrophobicContact CD2-CB 4.42Å; L16-V60 HydrophobicContact CD2-CG1 3.97Å; L16-I61 HydrophobicContact CD2-CG1 3.61Å; L16-I61 HydrophobicContact CG-CG1 4.11Å; L16-L64 HydrophobicContact CD2-CD1 4.03Å
17	L	94.5	Very high	92.2	Very high	47 Å²	47	74.8 Å²	74.8	25%	0.246	37%	0.367	C	S	.	.	H	α-helix	trans	-65.3	-37.3	177.1	-173.7	66.4	0	0	0	112.3	Y13 K14 T15 R31 L34	Y13-L17 HydrophobicContact CE1-CD2 4.34Å; Y13-L17 VanDerWaalsContact O-CB 3.27Å; Y13-L17 WeakPolarHBondContact O-CB 3.31Å; Y13-L17 PolarHBondContact O-N 3.47Å; K14-L17 PolarHBondContact O-N 3.25Å; T15-L17 VanDerWaalsContact C-N 3.31Å; T15-L17 PolarHBondContact O-N 2.91Å; L17-R31 HydrophobicContact CD1-CB 4.02Å; L17-R31 HydrophobicContact CD1-CG 3.81Å; L17-L34 HydrophobicContact CB-CD2 4.01Å; L17-L34 HydrophobicContact CD1-CD2 4.28Å
18	Y	93.7	Very high	92.4	Very high	151 Å²	151	77 Å²	77	59%	0.592	38%	0.382	S	S	*	.	H	α-helix	trans	-66.3	-51.3	174.4	176.1	-101	0	0	0	111.1	K14 T15 L16 G20 R21	K14-Y18 PolarHBondContact O-N 3.23Å; T15-Y18 PolarHBondContact O-N 3.04Å; L16-Y18 VanDerWaalsContact C-N 3.33Å; L16-Y18 PolarHBondContact O-N 3.44Å; Y18-G20 PolarHBondContact O-N 3.46Å; Y18-R21 WeakPolarHBondContact O-CB 3.34Å; Y18-R21 WeakPolarHBondContact O-CG 3.38Å; Y18-R21 PolarHBondContact O-N 3.31Å
19	L	92.1	Very high	92.5	Very high	26 Å²	26	77.2 Å²	77.2	14%	0.136	38%	0.38	C	S	.	.	H	α-helix	trans	-65.1	-24.7	177.9	-68.4	174.4	0	0	0	112.6	T15 L16 R21 I61 L64 Y68	T15-L19 HydrophobicContact CG2-CD1 4.04Å; T15-L19 WeakPolarHBondContact O-CG 3.2Å; T15-L19 PolarHBondContact O-N 3.48Å; L16-L19 PolarHBondContact O-N 3.45Å; L19-R21 VanDerWaalsContact C-N 3.26Å; L19-R21 PolarHBondContact O-N 2.76Å; L19-I61 HydrophobicContact CD1-CB 4.2Å; L19-I61 HydrophobicContact CD1-CG1 4.02Å; L19-I61 HydrophobicContact CD1-CG2 3.68Å; L19-L64 HydrophobicContact CB-CD1 4.12Å; L19-Y68 WeakPolarHBondContact O-CE2 3.49Å; L19-Y68 PolarHBondContact O-OH 3.33Å
20	G	91.3	Very high	92.6	Very high	2 Å²	2	76.1 Å²	76.1	2%	0.021	37%	0.372	C	S	.	.	G	3₁₀ helix	trans	-74.7	-9.2	177.4	0	0	0	0	0	115.1	L16 Y18 E22 Y23 F30	L16-G20 PolarHBondContact O-N 3.02Å; Y18-G20 PolarHBondContact O-N 3.46Å; G20-E22 PolarHBondContact O-N 3.33Å; G20-Y23 WeakPolarHBondContact O-CB 3.39Å; G20-Y23 PolarHBondContact O-N 3.27Å; G20-F30 VanDerWaalsContact CA-CD1 3.43Å
21	R	90.6	Very high	92.7	Very high	165 Å²	165	77.8 Å²	77.8	62%	0.623	37%	0.372	S	S	*	.	G	3₁₀ helix	trans	-65.2	-38.5	-174.4	-71	176.8	179.1	-173.2	-1	113.4	Y18 L19 Y23	Y18-R21 WeakPolarHBondContact O-CB 3.34Å; Y18-R21 WeakPolarHBondContact O-CG 3.38Å; Y18-R21 PolarHBondContact O-N 3.31Å; L19-R21 VanDerWaalsContact C-N 3.26Å; L19-R21 PolarHBondContact O-N 2.76Å; R21-Y23 VanDerWaalsContact C-N 3.31Å
22	E	85.8	Confident	92.8	Very high	114 Å²	114	77.5 Å²	77.5	53%	0.533	38%	0.377	S	S	.	.	G	3₁₀ helix	trans	-96.1	17.1	179.4	-60	-177.9	-170.7	0	0	112.4	G20 Y68 R71	G20-E22 PolarHBondContact O-N 3.33Å; E22-Y68 VanDerWaalsContact C-OH 3.25Å; E22-Y68 WeakPolarHBondContact CA-OH 3.39Å; E22-Y68 HydrophobicContact CB-CE1 3.4Å; E22-Y68 VanDerWaalsContact CB-CE1 3.4Å; E22-Y68 VanDerWaalsContact CB-OH 3.3Å; E22-Y68 WeakPolarHBondContact CB-OH 3.07Å; E22-Y68 HydrophobicContact CG-CE1 4.41Å; E22-Y68 PolarHBondContact N-OH 3.44Å; E22-R71 IonicContact OE2-CZ 2.76Å; E22-R71 IonicContact OE2-NH2 3.99Å; E22-R71 PolarHBondContact OE2-NH2 3.04Å
23	Y	90.4	Very high	92.7	Very high	66 Å²	66	84.4 Å²	84.4	26%	0.259	40%	0.402	S	S	.	.			trans	-60.6	137.8	179	-169.8	-104.6	0	0	0	110.7	G20 R21 K25 G26 Y29 F30 L64 L67 Y68	G20-Y23 WeakPolarHBondContact O-CB 3.39Å; G20-Y23 PolarHBondContact O-N 3.27Å; R21-Y23 VanDerWaalsContact C-N 3.31Å; Y23-K25 HydrophobicContact CD1-CB 3.92Å; Y23-K25 HydrophobicContact CE1-CB 3.87Å; Y23-K25 HydrophobicContact CE1-CD 4.29Å; Y23-K25 HydrophobicContact CE1-CG 4.04Å; Y23-K25 PolarHBondContact O-N 2.85Å; Y23-G26 WeakPolarHBondContact O-CA 3.29Å; Y23-G26 PolarHBondContact O-N 3.48Å; Y23-Y29 HydrophobicContact CD1-CD1 4.32Å; Y23-Y29 HydrophobicContact CE1-CD1 4.01Å; Y23-Y29 HydrophobicContact CE1-CE1 4.17Å; Y23-F30 HydrophobicContact CD1-CB 4.24Å; Y23-F30 HydrophobicContact CD1-CD2 4.21Å; Y23-F30 AromaticContact CD2-CD2 3.74Å; Y23-F30 HydrophobicContact CD2-CD2 3.74Å; Y23-F30 HydrophobicContact CD2-CE2 4.24Å; Y23-F30 HydrophobicContact CE2-CD2 4.18Å; Y23-F30 HydrophobicContact CG-CB 4.2Å; Y23-F30 AromaticContact CG-CD2 3.76Å; Y23-F30 HydrophobicContact CG-CD2 3.76Å; Y23-F30 HydrophobicContact CG-CG 4.36Å; Y23-L64 HydrophobicContact CD2-CD2 3.9Å; Y23-L64 HydrophobicContact CE2-CD2 4.11Å; Y23-L67 HydrophobicContact CE2-CD2 4.38Å; Y23-Y68 PolarHBondContact N-OH 3.49Å
24	P	88.4	Confident	92.7	Very high	96 Å²	96	82.1 Å²	82.1	62%	0.623	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	-29.1	-171.9	-28.4	35	0	0	0	115.6	G26 L67	P24-G26 VanDerWaalsContact C-N 3.31Å; P24-L67 HydrophobicContact CG-CD2 4.07Å
25	K	89.8	Confident	92.7	Very high	138 Å²	138	82 Å²	82	60%	0.6	39%	0.393	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.1	4.7	177.1	-62.6	-173.6	173.8	-175.5	0	113.8	Y23 Y29	Y23-K25 HydrophobicContact CD1-CB 3.92Å; Y23-K25 HydrophobicContact CE1-CB 3.87Å; Y23-K25 HydrophobicContact CE1-CD 4.29Å; Y23-K25 HydrophobicContact CE1-CG 4.04Å; Y23-K25 PolarHBondContact O-N 2.85Å; K25-Y29 HydrophobicContact CB-CD1 3.73Å; K25-Y29 HydrophobicContact CB-CE1 4.29Å; K25-Y29 HydrophobicContact CB-CG 3.92Å; K25-Y29 HydrophobicContact CD-CD1 4.02Å; K25-Y29 HydrophobicContact CD-CE1 3.69Å; K25-Y29 HydrophobicContact CD-CE2 4.34Å; K25-Y29 HydrophobicContact CD-CG 4.5Å; K25-Y29 HydrophobicContact CG-CD1 4.49Å
26	G	91.3	Very high	92.8	Very high	32 Å²	32	85.2 Å²	85.2	33%	0.33	40%	0.404	S	S	.	.			trans	92.8	155.7	-178.8	0	0	0	0	0	114.3	Y23 P24 A28 Y29 F30	Y23-G26 WeakPolarHBondContact O-CA 3.29Å; Y23-G26 PolarHBondContact O-N 3.48Å; P24-G26 VanDerWaalsContact C-N 3.31Å; G26-A28 PolarHBondContact O-N 2.98Å; G26-Y29 PolarHBondContact O-N 3.11Å; G26-F30 PolarHBondContact O-N 3.2Å
27	A	91.9	Very high	92.7	Very high	47 Å²	47	87.2 Å²	87.2	39%	0.388	42%	0.422	S	S	.	.	H	α-helix	trans	-63.9	-36	-176.6	0	0	0	0	0	113.4	F30 R31	A27-F30 PolarHBondContact O-N 2.92Å; A27-R31 VanDerWaalsContact O-CB 3.25Å; A27-R31 WeakPolarHBondContact O-CB 3.36Å; A27-R31 PolarHBondContact O-N 3.27Å
28	A	93.2	Very high	92.7	Very high	78 Å²	78	87.6 Å²	87.6	65%	0.645	42%	0.421	S	S	*	.	H	α-helix	trans	-64.2	-47	179.7	0	0	0	0	0	111.5	G26 F30 R31 E32	G26-A28 PolarHBondContact O-N 2.98Å; A28-F30 VanDerWaalsContact C-N 3.34Å; A28-F30 PolarHBondContact O-N 3.08Å; A28-R31 PolarHBondContact O-N 3.3Å; A28-E32 PolarHBondContact O-N 3.33Å
29	Y	94.1	Very high	92.7	Very high	79 Å²	79	85.2 Å²	85.2	31%	0.31	42%	0.417	S	S	.	.	H	α-helix	trans	-57.5	-46.8	176.2	179.6	-88.7	0	0	0	111.5	Y23 K25 G26 R33	Y23-Y29 HydrophobicContact CD1-CD1 4.32Å; Y23-Y29 HydrophobicContact CE1-CD1 4.01Å; Y23-Y29 HydrophobicContact CE1-CE1 4.17Å; K25-Y29 HydrophobicContact CB-CD1 3.73Å; K25-Y29 HydrophobicContact CB-CE1 4.29Å; K25-Y29 HydrophobicContact CB-CG 3.92Å; K25-Y29 HydrophobicContact CD-CD1 4.02Å; K25-Y29 HydrophobicContact CD-CE1 3.69Å; K25-Y29 HydrophobicContact CD-CE2 4.34Å; K25-Y29 HydrophobicContact CD-CG 4.5Å; K25-Y29 HydrophobicContact CG-CD1 4.49Å; G26-Y29 PolarHBondContact O-N 3.11Å; Y29-R33 HydrophobicContact CE1-CG 4.16Å; Y29-R33 WeakPolarHBondContact O-CG 3.38Å; Y29-R33 PolarHBondContact O-N 3.03Å; Y29-R33 PolarHBondContact OH-NH2 3.08Å
30	F	94.8	Very high	92.9	Very high	24 Å²	24	92 Å²	92	11%	0.105	45%	0.445	C	S	.	.	H	α-helix	trans	-65.1	-45.7	179	-172.8	-85.2	0	0	0	111.7	L16 G20 Y23 G26 A27 A28 E32 R33 L34 L64	L16-F30 VanDerWaalsContact O-CE1 3.23Å; L16-F30 WeakPolarHBondContact O-CE1 3.38Å; G20-F30 VanDerWaalsContact CA-CD1 3.43Å; Y23-F30 HydrophobicContact CD1-CB 4.24Å; Y23-F30 HydrophobicContact CD1-CD2 4.21Å; Y23-F30 AromaticContact CD2-CD2 3.74Å; Y23-F30 HydrophobicContact CD2-CD2 3.74Å; Y23-F30 HydrophobicContact CD2-CE2 4.24Å; Y23-F30 HydrophobicContact CE2-CD2 4.18Å; Y23-F30 HydrophobicContact CG-CB 4.2Å; Y23-F30 AromaticContact CG-CD2 3.76Å; Y23-F30 HydrophobicContact CG-CD2 3.76Å; Y23-F30 HydrophobicContact CG-CG 4.36Å; G26-F30 PolarHBondContact O-N 3.2Å; A27-F30 PolarHBondContact O-N 2.92Å; A28-F30 VanDerWaalsContact C-N 3.34Å; A28-F30 PolarHBondContact O-N 3.08Å; F30-E32 VanDerWaalsContact C-N 3.32Å; F30-E32 PolarHBondContact O-N 2.89Å; F30-R33 PolarHBondContact O-N 3.32Å; F30-L34 HydrophobicContact CD1-CB 4.37Å; F30-L34 HydrophobicContact CE1-CB 4.18Å; F30-L34 HydrophobicContact CE1-CD1 4.36Å; F30-L34 HydrophobicContact CE1-CD2 4.21Å; F30-L34 HydrophobicContact CE1-CG 4.49Å; F30-L34 WeakPolarHBondContact O-CB 3.31Å; F30-L34 PolarHBondContact O-N 3.47Å; F30-L64 HydrophobicContact CE2-CD1 3.96Å; F30-L64 HydrophobicContact CE2-CD2 4.03Å; F30-L64 HydrophobicContact CZ-CD1 3.75Å
31	R	94.7	Very high	92.9	Very high	147 Å²	147	95 Å²	95	56%	0.555	46%	0.461	S	S	*	.	H	α-helix	trans	-59.1	-42.1	-179.4	178.1	177.2	177.3	159.8	-1	112.2	L17 A27 A28 L34 K35	L17-R31 HydrophobicContact CD1-CB 4.02Å; L17-R31 HydrophobicContact CD1-CG 3.81Å; A27-R31 VanDerWaalsContact O-CB 3.25Å; A27-R31 WeakPolarHBondContact O-CB 3.36Å; A27-R31 PolarHBondContact O-N 3.27Å; A28-R31 PolarHBondContact O-N 3.3Å; R31-L34 PolarHBondContact O-N 2.98Å; R31-K35 WeakPolarHBondContact O-CB 3.18Å; R31-K35 PolarHBondContact O-N 3.3Å
32	E	96	Very high	92.9	Very high	144 Å²	144	93.5 Å²	93.5	67%	0.673	46%	0.459	S	S	*	.	H	α-helix	trans	-63.2	-47.2	178.5	-169	-174.1	174.6	0	0	111.4	A28 F30 L34 K35 H36	A28-E32 PolarHBondContact O-N 3.33Å; F30-E32 VanDerWaalsContact C-N 3.32Å; F30-E32 PolarHBondContact O-N 2.89Å; E32-L34 PolarHBondContact O-N 3.17Å; E32-K35 PolarHBondContact O-N 3.29Å; E32-H36 WeakPolarHBondContact O-CB 3.31Å; E32-H36 PolarHBondContact O-N 3.41Å
33	R	94.6	Very high	93.1	Very high	158 Å²	158	94.1 Å²	94.1	60%	0.596	47%	0.466	S	S	*	.	H	α-helix	trans	-62.7	-42.8	176.9	-68.1	-69.6	-169.1	159.3	0.3	112.3	Y29 F30 H36 A37	Y29-R33 HydrophobicContact CE1-CG 4.16Å; Y29-R33 WeakPolarHBondContact O-CG 3.38Å; Y29-R33 PolarHBondContact O-N 3.03Å; Y29-R33 PolarHBondContact OH-NH2 3.08Å; F30-R33 PolarHBondContact O-N 3.32Å; R33-H36 PolarHBondContact O-N 2.91Å; R33-A37 PolarHBondContact O-N 3.42Å
34	L	94.9	Very high	93.1	Very high	13 Å²	13	93.8 Å²	93.8	7%	0.068	47%	0.467	C	S	.	.	H	α-helix	trans	-59.3	-51.4	175.5	-176.8	70.8	0	0	0	110.3	Y13 L16 L17 F30 R31 E32 H36 A37 F38	Y13-L34 HydrophobicContact CD2-CD2 3.95Å; Y13-L34 HydrophobicContact CD2-CG 4.07Å; Y13-L34 HydrophobicContact CE2-CD2 3.76Å; Y13-L34 HydrophobicContact CE2-CG 3.86Å; L16-L34 HydrophobicContact CB-CD1 3.67Å; L16-L34 HydrophobicContact CB-CD2 4.04Å; L16-L34 HydrophobicContact CD1-CD1 3.65Å; L16-L34 HydrophobicContact CG-CD1 4.26Å; L17-L34 HydrophobicContact CB-CD2 4.01Å; L17-L34 HydrophobicContact CD1-CD2 4.28Å; F30-L34 HydrophobicContact CD1-CB 4.37Å; F30-L34 HydrophobicContact CE1-CB 4.18Å; F30-L34 HydrophobicContact CE1-CD1 4.36Å; F30-L34 HydrophobicContact CE1-CD2 4.21Å; F30-L34 HydrophobicContact CE1-CG 4.49Å; F30-L34 WeakPolarHBondContact O-CB 3.31Å; F30-L34 PolarHBondContact O-N 3.47Å; R31-L34 PolarHBondContact O-N 2.98Å; E32-L34 PolarHBondContact O-N 3.17Å; L34-H36 VanDerWaalsContact C-N 3.31Å; L34-H36 PolarHBondContact O-N 3.02Å; L34-A37 PolarHBondContact O-N 3.3Å; L34-F38 HydrophobicContact CD1-CD2 3.97Å; L34-F38 HydrophobicContact CD1-CE2 3.5Å; L34-F38 HydrophobicContact CG-CD2 4.22Å; L34-F38 HydrophobicContact CG-CE2 4.15Å; L34-F38 VanDerWaalsContact O-CD2 3.29Å; L34-F38 WeakPolarHBondContact O-CD2 3.5Å; L34-F38 PolarHBondContact O-N 3.41Å; L34-F38 VanDerWaalsContact O-N 3.11Å
35	K	95	Very high	93.1	Very high	126 Å²	126	95.1 Å²	95.1	55%	0.548	47%	0.473	S	S	.	.	H	α-helix	trans	-56.7	-46.7	177.6	-176.5	-177.9	177.5	-172.9	0	111	R31 E32 A37 F38 M39	R31-K35 WeakPolarHBondContact O-CB 3.18Å; R31-K35 PolarHBondContact O-N 3.3Å; E32-K35 PolarHBondContact O-N 3.29Å; K35-A37 VanDerWaalsContact C-N 3.34Å; K35-A37 PolarHBondContact O-N 3.02Å; K35-F38 PolarHBondContact O-N 3.12Å; K35-M39 HydrophobicContact CG-CG 4.13Å; K35-M39 WeakPolarHBondContact O-CB 3.47Å; K35-M39 WeakPolarHBondContact O-CG 3.36Å; K35-M39 PolarHBondContact O-N 2.95Å
36	H	96	Very high	93.2	Very high	131 Å²	131	91.5 Å²	91.5	61%	0.606	46%	0.46	S	S	*	.	H	α-helix	trans	-60.5	-41.8	179.5	-172.1	-111.3	0	0	0	112.4	E32 R33 L34 F38 M39 K40	E32-H36 WeakPolarHBondContact O-CB 3.31Å; E32-H36 PolarHBondContact O-N 3.41Å; R33-H36 PolarHBondContact O-N 2.91Å; L34-H36 VanDerWaalsContact C-N 3.31Å; L34-H36 PolarHBondContact O-N 3.02Å; H36-F38 PolarHBondContact O-N 3.15Å; H36-M39 PolarHBondContact O-N 3.31Å; H36-K40 WeakPolarHBondContact O-CB 3.47Å; H36-K40 PolarHBondContact O-N 3.28Å
37	A	94.1	Very high	93.1	Very high	48 Å²	48	93.3 Å²	93.3	40%	0.397	47%	0.466	S	S	.	.	H	α-helix	trans	-63.6	-40.7	177.8	0	0	0	0	0	113	R33 L34 K35 N41	R33-A37 PolarHBondContact O-N 3.42Å; L34-A37 PolarHBondContact O-N 3.3Å; K35-A37 VanDerWaalsContact C-N 3.34Å; K35-A37 PolarHBondContact O-N 3.02Å; A37-N41 PolarHBondContact O-ND2 3.43Å
38	F	94.4	Very high	93.1	Very high	55 Å²	55	95.9 Å²	95.9	24%	0.241	47%	0.47	C	S	.	.	H	α-helix	trans	-71.7	-40.4	176.2	-81.8	-107.4	0	0	0	111.6	V9 L12 Y13 L16 L34 K35 H36 K40 N41 K42	V9-F38 HydrophobicContact CG1-CD1 4.02Å; V9-F38 HydrophobicContact CG1-CE1 3.72Å; L12-F38 HydrophobicContact CD2-CZ 4.13Å; L12-F38 HydrophobicContact CG-CZ 4.16Å; Y13-F38 AromaticContact CD2-CD1 3.93Å; Y13-F38 HydrophobicContact CD2-CD1 3.93Å; Y13-F38 AromaticContact CD2-CD2 3.85Å; Y13-F38 HydrophobicContact CD2-CD2 3.85Å; Y13-F38 AromaticContact CD2-CE1 4Å; Y13-F38 HydrophobicContact CD2-CE1 4Å; Y13-F38 AromaticContact CD2-CE2 3.94Å; Y13-F38 HydrophobicContact CD2-CE2 3.94Å; Y13-F38 AromaticContact CD2-CG 3.85Å; Y13-F38 HydrophobicContact CD2-CG 3.85Å; Y13-F38 AromaticContact CD2-CZ 4Å; Y13-F38 HydrophobicContact CD2-CZ 4Å; Y13-F38 HydrophobicContact CE2-CD2 4.4Å; Y13-F38 HydrophobicContact CE2-CG 4.42Å; Y13-F38 HydrophobicContact CG-CE1 4.37Å; Y13-F38 HydrophobicContact CG-CZ 4.48Å; L16-F38 HydrophobicContact CD1-CE2 4.13Å; L16-F38 HydrophobicContact CD1-CZ 4.29Å; L34-F38 HydrophobicContact CD1-CD2 3.97Å; L34-F38 HydrophobicContact CD1-CE2 3.5Å; L34-F38 HydrophobicContact CG-CD2 4.22Å; L34-F38 HydrophobicContact CG-CE2 4.15Å; L34-F38 VanDerWaalsContact O-CD2 3.29Å; L34-F38 WeakPolarHBondContact O-CD2 3.5Å; L34-F38 PolarHBondContact O-N 3.41Å; L34-F38 VanDerWaalsContact O-N 3.11Å; K35-F38 PolarHBondContact O-N 3.12Å; H36-F38 PolarHBondContact O-N 3.15Å; F38-K40 VanDerWaalsContact C-N 3.3Å; F38-K40 PolarHBondContact O-N 3.28Å; F38-N41 PolarHBondContact O-N 3.44Å; F38-K42 PolarHBondContact O-N 3.45Å
39	M	94.4	Very high	93.1	Very high	101 Å²	101	96.6 Å²	96.6	50%	0.498	46%	0.459	S	S	.	.	H	α-helix	trans	-64.2	-33.6	177.5	-71.7	-63.2	-68.8	0	0	112.6	K35 H36 N41 K42	K35-M39 HydrophobicContact CG-CG 4.13Å; K35-M39 WeakPolarHBondContact O-CB 3.47Å; K35-M39 WeakPolarHBondContact O-CG 3.36Å; K35-M39 PolarHBondContact O-N 2.95Å; H36-M39 PolarHBondContact O-N 3.31Å; M39-N41 PolarHBondContact O-N 3.45Å; M39-K42 HydrophobicContact CE-CD 4.11Å; M39-K42 WeakPolarHBondContact O-CB 3.5Å; M39-K42 VanDerWaalsContact O-CG 3.3Å; M39-K42 WeakPolarHBondContact O-CG 3.48Å; M39-K42 PolarHBondContact O-N 2.88Å
40	K	94.6	Very high	93	Very high	167 Å²	167	94 Å²	94	73%	0.726	45%	0.45	S	S	*	.	H	α-helix	trans	-60.8	-30.9	176.2	-175.4	178.2	177.9	-178.1	0	112.9	H36 F38	H36-K40 WeakPolarHBondContact O-CB 3.47Å; H36-K40 PolarHBondContact O-N 3.28Å; F38-K40 VanDerWaalsContact C-N 3.3Å; F38-K40 PolarHBondContact O-N 3.28Å
41	N	91.3	Very high	92.9	Very high	66 Å²	66	97.4 Å²	97.4	35%	0.353	47%	0.465	S	S	.	.	T	Hydrogen-bonded Turn	trans	-107.6	16.6	-177.2	-57.4	-69	0	0	0	112.6	A37 F38 M39 D43 E44 L53	A37-N41 PolarHBondContact O-ND2 3.43Å; F38-N41 PolarHBondContact O-N 3.44Å; M39-N41 PolarHBondContact O-N 3.45Å; N41-D43 VanDerWaalsContact C-N 3.25Å; N41-D43 PolarHBondContact O-N 3.42Å; N41-E44 WeakPolarHBondContact O-CB 3.46Å; N41-E44 PolarHBondContact O-N 2.98Å; N41-L53 HydrophobicContact CB-CD1 3.88Å
42	K	90.5	Very high	92.8	Very high	134 Å²	134	96.9 Å²	96.9	58%	0.583	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64	-29.3	-173.3	74.6	-179.3	-173.8	168.4	0	113.7	F38 M39	F38-K42 PolarHBondContact O-N 3.45Å; M39-K42 HydrophobicContact CE-CD 4.11Å; M39-K42 WeakPolarHBondContact O-CB 3.5Å; M39-K42 VanDerWaalsContact O-CG 3.3Å; M39-K42 WeakPolarHBondContact O-CG 3.48Å; M39-K42 PolarHBondContact O-N 2.88Å
43	D	90.3	Very high	92.7	Very high	126 Å²	126	92.9 Å²	92.9	67%	0.674	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.9	2.5	-174.7	-56.4	-51.9	0	0	0	111.8	N41 T45	N41-D43 VanDerWaalsContact C-N 3.25Å; N41-D43 PolarHBondContact O-N 3.42Å; D43-T45 PolarHBondContact O-N 3.38Å
44	E	90.1	Very high	92.7	Very high	60 Å²	60	86 Å²	86	28%	0.28	43%	0.427	S	S	.	.			trans	-73.9	121.8	177.2	-172.9	59.7	-99.3	0	0	110.1	N41 D46 K49 I50	N41-E44 WeakPolarHBondContact O-CB 3.46Å; N41-E44 PolarHBondContact O-N 2.98Å; E44-D46 WeakPolarHBondContact OE1-CB 3.23Å; E44-D46 PolarHBondContact OE1-N 2.9Å; E44-K49 VanDerWaalsContact CD-CD 3.42Å; E44-K49 HydrophobicContact CG-CB 4.03Å; E44-K49 HydrophobicContact CG-CD 4.33Å; E44-K49 IonicContact OE1-NZ 3.71Å; E44-K49 WeakPolarHBondContact OE2-CD 3.35Å; E44-K49 IonicContact OE2-NZ 3.4Å; E44-K49 PolarHBondContact OE2-NZ 3.34Å; E44-I50 HydrophobicContact CG-CG1 4.29Å
45	T	88.5	Confident	92.7	Very high	124 Å²	124	87.5 Å²	87.5	76%	0.761	44%	0.441	S	S	*	.			trans	-111.7	-11.9	-177.9	55.6	0	0	0	0	112.9	D43 P47	D43-T45 PolarHBondContact O-N 3.38Å; T45-P47 VanDerWaalsContact O-CD 3.31Å; T45-P47 WeakPolarHBondContact O-CD 3.46Å
46	D	91.6	Very high	92.6	Very high	61 Å²	61	90.1 Å²	90.1	33%	0.326	45%	0.448	S	S	.	.			trans	-71.4	116.7	-179.6	-178.3	-2.8	0	0	0	111	E44 E48 K49 I50	E44-D46 WeakPolarHBondContact OE1-CB 3.23Å; E44-D46 PolarHBondContact OE1-N 2.9Å; D46-E48 VanDerWaalsContact C-N 3.28Å; D46-E48 PolarHBondContact O-N 3.4Å; D46-E48 PolarHBondContact OD1-N 2.95Å; D46-E48 VanDerWaalsContact OD1-N 3.1Å; D46-K49 HydrophobicContact CB-CB 4.14Å; D46-K49 HydrophobicContact CB-CD 4Å; D46-K49 HydrophobicContact CB-CG 4.16Å; D46-K49 PolarHBondContact O-N 3.14Å; D46-K49 WeakPolarHBondContact OD2-CG 3.32Å; D46-I50 VanDerWaalsContact O-CG1 3.28Å; D46-I50 WeakPolarHBondContact O-CG1 3.25Å; D46-I50 PolarHBondContact O-N 2.97Å
47	P	90.2	Very high	92.5	Very high	70 Å²	70	84.3 Å²	84.3	46%	0.455	42%	0.423	S	S	.	.	H	α-helix	trans	-56.6	-37.3	-179.5	-25.7	35.8	0	0	0	114.1	L5 T45 I50 K51	L5-P47 HydrophobicContact CD1-CB 3.86Å; T45-P47 VanDerWaalsContact O-CD 3.31Å; T45-P47 WeakPolarHBondContact O-CD 3.46Å; P47-I50 PolarHBondContact O-N 3.31Å; P47-K51 WeakPolarHBondContact O-CG 3.27Å; P47-K51 PolarHBondContact O-N 2.92Å; P47-K51 VanDerWaalsContact O-N 3.08Å
48	E	91.8	Very high	92.6	Very high	102 Å²	102	85.6 Å²	85.6	48%	0.477	42%	0.423	S	S	.	.	H	α-helix	trans	-71.9	-41.5	-177.1	-73.7	-56.4	129	0	0	111.3	D46 I50 K51 Q52	D46-E48 VanDerWaalsContact C-N 3.28Å; D46-E48 PolarHBondContact O-N 3.4Å; D46-E48 PolarHBondContact OD1-N 2.95Å; D46-E48 VanDerWaalsContact OD1-N 3.1Å; E48-I50 VanDerWaalsContact C-N 3.34Å; E48-I50 PolarHBondContact O-N 2.92Å; E48-K51 PolarHBondContact O-N 3.36Å; E48-K51 IonicContact OE1-NZ 2.78Å; E48-K51 PolarHBondContact OE1-NZ 3.42Å; E48-Q52 WeakPolarHBondContact O-CG 3.48Å; E48-Q52 PolarHBondContact O-N 2.9Å
49	K	92.3	Very high	92.6	Very high	93 Å²	93	88.5 Å²	88.5	40%	0.404	44%	0.438	S	S	.	.	H	α-helix	trans	-64.4	-39	173.1	-70	179.6	-168.1	167.7	0	112.3	E44 D46 K51 Q52 L53	E44-K49 VanDerWaalsContact CD-CD 3.42Å; E44-K49 HydrophobicContact CG-CB 4.03Å; E44-K49 HydrophobicContact CG-CD 4.33Å; E44-K49 IonicContact OE1-NZ 3.71Å; E44-K49 WeakPolarHBondContact OE2-CD 3.35Å; E44-K49 IonicContact OE2-NZ 3.4Å; E44-K49 PolarHBondContact OE2-NZ 3.34Å; D46-K49 HydrophobicContact CB-CB 4.14Å; D46-K49 HydrophobicContact CB-CD 4Å; D46-K49 HydrophobicContact CB-CG 4.16Å; D46-K49 PolarHBondContact O-N 3.14Å; D46-K49 WeakPolarHBondContact OD2-CG 3.32Å; K49-K51 VanDerWaalsContact C-N 3.33Å; K49-K51 PolarHBondContact O-N 3.17Å; K49-Q52 PolarHBondContact O-N 3.17Å; K49-L53 WeakPolarHBondContact O-CG 3.45Å; K49-L53 PolarHBondContact O-N 3.01Å
50	I	92.1	Very high	92.6	Very high	23 Å²	23	86 Å²	86	12%	0.118	43%	0.428	C	S	.	.	H	α-helix	trans	-60.2	-45.3	176.2	-67.7	165	0	0	0	110.1	L5 V9 E44 D46 P47 E48 Q52 L53 V54	L5-I50 HydrophobicContact CB-CG2 3.98Å; L5-I50 HydrophobicContact CD1-CB 4.08Å; L5-I50 HydrophobicContact CD1-CD1 4.3Å; L5-I50 HydrophobicContact CD1-CG2 3.97Å; L5-I50 HydrophobicContact CG-CG2 4.46Å; V9-I50 HydrophobicContact CG2-CG2 3.94Å; E44-I50 HydrophobicContact CG-CG1 4.29Å; D46-I50 VanDerWaalsContact O-CG1 3.28Å; D46-I50 WeakPolarHBondContact O-CG1 3.25Å; D46-I50 PolarHBondContact O-N 2.97Å; P47-I50 PolarHBondContact O-N 3.31Å; E48-I50 VanDerWaalsContact C-N 3.34Å; E48-I50 PolarHBondContact O-N 2.92Å; I50-Q52 VanDerWaalsContact C-N 3.35Å; I50-Q52 PolarHBondContact O-N 2.98Å; I50-L53 PolarHBondContact O-N 3.32Å; I50-V54 HydrophobicContact CG2-CG2 4.39Å; I50-V54 VanDerWaalsContact O-CG2 3.31Å; I50-V54 WeakPolarHBondContact O-CG2 3.48Å; I50-V54 PolarHBondContact O-N 3.08Å
51	K	92.8	Very high	92.5	Very high	97 Å²	97	79.1 Å²	79.1	42%	0.422	40%	0.399	S	S	.	.	H	α-helix	trans	-59.8	-43.5	175.5	-70.5	171.8	-172.2	169.7	0	112.2	L5 P47 E48 K49 L53 V54 A55	L5-K51 HydrophobicContact CD2-CG 4.06Å; P47-K51 WeakPolarHBondContact O-CG 3.27Å; P47-K51 PolarHBondContact O-N 2.92Å; P47-K51 VanDerWaalsContact O-N 3.08Å; E48-K51 PolarHBondContact O-N 3.36Å; E48-K51 IonicContact OE1-NZ 2.78Å; E48-K51 PolarHBondContact OE1-NZ 3.42Å; K49-K51 VanDerWaalsContact C-N 3.33Å; K49-K51 PolarHBondContact O-N 3.17Å; K51-L53 VanDerWaalsContact C-N 3.35Å; K51-L53 PolarHBondContact O-N 3.49Å; K51-V54 PolarHBondContact O-N 3.43Å; K51-A55 WeakPolarHBondContact O-CB 3.38Å; K51-A55 PolarHBondContact O-N 3.13Å
52	Q	94.2	Very high	92.7	Very high	136 Å²	136	82.5 Å²	82.5	64%	0.636	41%	0.41	S	S	*	.	H	α-helix	trans	-62.1	-41.3	176.8	-70	175.9	11.6	0	0	112.2	E48 K49 I50 A55 R56	E48-Q52 WeakPolarHBondContact O-CG 3.48Å; E48-Q52 PolarHBondContact O-N 2.9Å; K49-Q52 PolarHBondContact O-N 3.17Å; I50-Q52 VanDerWaalsContact C-N 3.35Å; I50-Q52 PolarHBondContact O-N 2.98Å; Q52-A55 PolarHBondContact O-N 3.36Å; Q52-R56 WeakPolarHBondContact O-CB 3.45Å; Q52-R56 PolarHBondContact O-N 3.46Å
53	L	94.1	Very high	92.8	Very high	59 Å²	59	82.3 Å²	82.3	31%	0.309	41%	0.412	S	S	.	.	H	α-helix	trans	-66.3	-38.9	176	-71.5	171.9	0	0	0	112.1	N41 K49 I50 K51 R56 G57	N41-L53 HydrophobicContact CB-CD1 3.88Å; K49-L53 WeakPolarHBondContact O-CG 3.45Å; K49-L53 PolarHBondContact O-N 3.01Å; I50-L53 PolarHBondContact O-N 3.32Å; K51-L53 VanDerWaalsContact C-N 3.35Å; K51-L53 PolarHBondContact O-N 3.49Å; L53-R56 WeakPolarHBondContact O-CB 3.49Å; L53-R56 PolarHBondContact O-N 3.07Å; L53-G57 PolarHBondContact O-N 3.16Å
54	V	93.3	Very high	92.9	Very high	15 Å²	15	76.8 Å²	76.8	9%	0.091	38%	0.382	C	S	.	.	H	α-helix	trans	-63.2	-48.6	174.5	170.5	0	0	0	0	110.5	V9 L12 I50 K51 R56 G57 D58	V9-V54 HydrophobicContact CG2-CG2 3.8Å; L12-V54 HydrophobicContact CD2-CB 4.45Å; L12-V54 HydrophobicContact CD2-CG1 4.39Å; L12-V54 HydrophobicContact CD2-CG2 4.39Å; I50-V54 HydrophobicContact CG2-CG2 4.39Å; I50-V54 VanDerWaalsContact O-CG2 3.31Å; I50-V54 WeakPolarHBondContact O-CG2 3.48Å; I50-V54 PolarHBondContact O-N 3.08Å; K51-V54 PolarHBondContact O-N 3.43Å; V54-R56 VanDerWaalsContact C-N 3.28Å; V54-R56 PolarHBondContact O-N 3.31Å; V54-G57 CarbonylContact O-C 3.59Å; V54-G57 WeakPolarHBondContact O-CA 3.48Å; V54-G57 PolarHBondContact O-N 2.83Å; V54-D58 PolarHBondContact O-N 3.14Å
55	A	94.5	Very high	93	Very high	44 Å²	44	78 Å²	78	36%	0.364	39%	0.387	S	S	.	.	H	α-helix	trans	-58.1	-41.1	176.5	0	0	0	0	0	111.9	K51 Q52 G57 D58 H59	K51-A55 WeakPolarHBondContact O-CB 3.38Å; K51-A55 PolarHBondContact O-N 3.13Å; Q52-A55 PolarHBondContact O-N 3.36Å; A55-G57 VanDerWaalsContact C-N 3.29Å; A55-G57 PolarHBondContact O-N 3.05Å; A55-D58 WeakPolarHBondContact O-CB 3.4Å; A55-D58 PolarHBondContact O-N 3.07Å; A55-D58 VanDerWaalsContact O-N 3.16Å; A55-H59 PolarHBondContact O-CD2 2.8Å; A55-H59 PolarHBondContact O-N 3.02Å
56	R	94.3	Very high	93.2	Very high	181 Å²	181	74.8 Å²	74.8	68%	0.683	37%	0.373	S	S	*	.	H	α-helix	trans	-59.8	-40.3	172.5	-175.7	178.9	178.2	170.1	3.4	111.9	Q52 L53 V54 D58 H59 V60	Q52-R56 WeakPolarHBondContact O-CB 3.45Å; Q52-R56 PolarHBondContact O-N 3.46Å; L53-R56 WeakPolarHBondContact O-CB 3.49Å; L53-R56 PolarHBondContact O-N 3.07Å; V54-R56 VanDerWaalsContact C-N 3.28Å; V54-R56 PolarHBondContact O-N 3.31Å; R56-D58 VanDerWaalsContact C-N 3.33Å; R56-H59 WeakPolarHBondContact O-CB 3.45Å; R56-H59 PolarHBondContact O-N 3.38Å; R56-V60 WeakPolarHBondContact O-CG2 3.45Å; R56-V60 PolarHBondContact O-N 3.13Å; R56-V60 VanDerWaalsContact O-N 3.15Å
57	G	94.3	Very high	93.2	Very high	9 Å²	9	75 Å²	75	9%	0.093	37%	0.374	C	S	.	.	H	α-helix	trans	-61.2	-40	173.9	0	0	0	0	0	113.1	L53 V54 A55 H59 V60 I61	L53-G57 PolarHBondContact O-N 3.16Å; V54-G57 CarbonylContact O-C 3.59Å; V54-G57 WeakPolarHBondContact O-CA 3.48Å; V54-G57 PolarHBondContact O-N 2.83Å; A55-G57 VanDerWaalsContact C-N 3.29Å; A55-G57 PolarHBondContact O-N 3.05Å; G57-H59 VanDerWaalsContact C-N 3.31Å; G57-H59 PolarHBondContact O-N 3.38Å; G57-V60 WeakPolarHBondContact O-CB 3.41Å; G57-V60 PolarHBondContact O-N 3.45Å; G57-V60 VanDerWaalsContact O-N 3.14Å; G57-I61 PolarHBondContact O-N 2.98Å
58	D	94.4	Very high	93.2	Very high	75 Å²	75	73.1 Å²	73.1	40%	0.401	36%	0.358	S	S	.	.	H	α-helix	trans	-65.8	-33.8	176.2	-65.7	-32.9	0	0	0	112.3	V54 A55 R56 I61 K62	V54-D58 PolarHBondContact O-N 3.14Å; A55-D58 WeakPolarHBondContact O-CB 3.4Å; A55-D58 PolarHBondContact O-N 3.07Å; A55-D58 VanDerWaalsContact O-N 3.16Å; R56-D58 VanDerWaalsContact C-N 3.33Å; D58-I61 WeakPolarHBondContact O-CB 3.45Å; D58-I61 PolarHBondContact O-N 3.44Å; D58-K62 PolarHBondContact O-N 3.25Å
59	H	95.3	Very high	93.1	Very high	116 Å²	116	75 Å²	75	54%	0.537	37%	0.365	S	S	.	.	H	α-helix	trans	-63.2	-43	170	-76.7	-74.9	0	0	0	112	A55 R56 G57 I61 K62 E63	A55-H59 PolarHBondContact O-CD2 2.8Å; A55-H59 PolarHBondContact O-N 3.02Å; R56-H59 WeakPolarHBondContact O-CB 3.45Å; R56-H59 PolarHBondContact O-N 3.38Å; G57-H59 VanDerWaalsContact C-N 3.31Å; G57-H59 PolarHBondContact O-N 3.38Å; H59-I61 VanDerWaalsContact C-N 3.27Å; H59-I61 PolarHBondContact O-N 3.21Å; H59-K62 WeakPolarHBondContact O-CB 3.21Å; H59-K62 PolarHBondContact O-N 3.46Å; H59-K62 VanDerWaalsContact O-N 3.13Å; H59-E63 PolarHBondContact O-N 3.27Å
60	V	93.6	Very high	93.1	Very high	49 Å²	49	74 Å²	74	30%	0.297	36%	0.364	S	S	.	.	H	α-helix	trans	-62.9	-34.9	177.1	174.8	0	0	0	0	111.7	L16 R56 G57 K62 E63 L64	L16-V60 HydrophobicContact CD2-CB 4.42Å; L16-V60 HydrophobicContact CD2-CG1 3.97Å; R56-V60 WeakPolarHBondContact O-CG2 3.45Å; R56-V60 PolarHBondContact O-N 3.13Å; R56-V60 VanDerWaalsContact O-N 3.15Å; G57-V60 WeakPolarHBondContact O-CB 3.41Å; G57-V60 PolarHBondContact O-N 3.45Å; G57-V60 VanDerWaalsContact O-N 3.14Å; V60-K62 PolarHBondContact O-N 2.92Å; V60-E63 PolarHBondContact O-N 3.47Å; V60-L64 HydrophobicContact CG1-CD1 4.32Å; V60-L64 WeakPolarHBondContact O-CG 3.33Å; V60-L64 PolarHBondContact O-N 3.2Å
61	I	94.3	Very high	93	Very high	22 Å²	22	79.2 Å²	79.2	11%	0.113	38%	0.382	C	S	.	.	H	α-helix	trans	-56.9	-49.8	172.6	-73.4	172.9	0	0	0	110.5	L12 T15 L16 L19 G57 D58 H59 E63 L64 E65	L12-I61 HydrophobicContact CD1-CD1 3.76Å; T15-I61 HydrophobicContact CG2-CD1 3.63Å; T15-I61 HydrophobicContact CG2-CG1 4.33Å; L16-I61 HydrophobicContact CD2-CG1 3.61Å; L16-I61 HydrophobicContact CG-CG1 4.11Å; L19-I61 HydrophobicContact CD1-CB 4.2Å; L19-I61 HydrophobicContact CD1-CG1 4.02Å; L19-I61 HydrophobicContact CD1-CG2 3.68Å; G57-I61 PolarHBondContact O-N 2.98Å; D58-I61 WeakPolarHBondContact O-CB 3.45Å; D58-I61 PolarHBondContact O-N 3.44Å; H59-I61 VanDerWaalsContact C-N 3.27Å; H59-I61 PolarHBondContact O-N 3.21Å; I61-E63 VanDerWaalsContact C-N 3.31Å; I61-E63 PolarHBondContact O-N 3.25Å; I61-L64 WeakPolarHBondContact O-CB 3.41Å; I61-L64 PolarHBondContact O-N 3.41Å; I61-L64 VanDerWaalsContact O-N 3.16Å; I61-E65 WeakPolarHBondContact O-CG 3.3Å; I61-E65 PolarHBondContact O-N 3.38Å
62	K	94.6	Very high	92.9	Very high	137 Å²	137	81.2 Å²	81.2	60%	0.596	39%	0.391	S	S	*	.	H	α-helix	trans	-62.5	-37.4	179.6	-66.1	178.5	-178.7	178.4	0	112.4	D58 H59 V60 E65 A66	D58-K62 PolarHBondContact O-N 3.25Å; H59-K62 WeakPolarHBondContact O-CB 3.21Å; H59-K62 PolarHBondContact O-N 3.46Å; H59-K62 VanDerWaalsContact O-N 3.13Å; V60-K62 PolarHBondContact O-N 2.92Å; K62-E65 PolarHBondContact O-N 2.97Å; K62-A66 WeakPolarHBondContact O-CB 3.41Å; K62-A66 PolarHBondContact O-N 3.38Å
63	E	93	Very high	92.9	Very high	130 Å²	130	80.7 Å²	80.7	61%	0.607	38%	0.384	S	S	*	.	H	α-helix	trans	-63.9	-41.7	175	-69.3	177.5	166.7	0	0	112	H59 V60 I61 A66 L67	H59-E63 PolarHBondContact O-N 3.27Å; V60-E63 PolarHBondContact O-N 3.47Å; I61-E63 VanDerWaalsContact C-N 3.31Å; I61-E63 PolarHBondContact O-N 3.25Å; E63-A66 PolarHBondContact O-N 3.16Å; E63-L67 PolarHBondContact O-N 2.92Å
64	L	91.8	Very high	92.7	Very high	10 Å²	10	85.9 Å²	85.9	5%	0.052	40%	0.399	C	S	.	.	H	α-helix	trans	-64.7	-43.1	175.6	-71.3	171.6	0	0	0	111.5	L16 L19 Y23 F30 V60 I61 L67 Y68	L16-L64 HydrophobicContact CD2-CD1 4.03Å; L19-L64 HydrophobicContact CB-CD1 4.12Å; Y23-L64 HydrophobicContact CD2-CD2 3.9Å; Y23-L64 HydrophobicContact CE2-CD2 4.11Å; F30-L64 HydrophobicContact CE2-CD1 3.96Å; F30-L64 HydrophobicContact CE2-CD2 4.03Å; F30-L64 HydrophobicContact CZ-CD1 3.75Å; V60-L64 HydrophobicContact CG1-CD1 4.32Å; V60-L64 WeakPolarHBondContact O-CG 3.33Å; V60-L64 PolarHBondContact O-N 3.2Å; I61-L64 WeakPolarHBondContact O-CB 3.41Å; I61-L64 PolarHBondContact O-N 3.41Å; I61-L64 VanDerWaalsContact O-N 3.16Å; L64-L67 WeakPolarHBondContact O-CB 3.46Å; L64-L67 PolarHBondContact O-N 3.41Å; L64-Y68 HydrophobicContact CB-CE2 4.44Å; L64-Y68 WeakPolarHBondContact O-CD2 3.49Å; L64-Y68 PolarHBondContact O-N 2.49Å
65	E	91.8	Very high	92.6	Very high	84 Å²	84	87.5 Å²	87.5	39%	0.393	41%	0.414	S	S	.	.	H	α-helix	trans	-60	-45.7	174.4	-71.2	176.4	164	0	0	111.9	I61 K62 L67 Y68 F69	I61-E65 WeakPolarHBondContact O-CG 3.3Å; I61-E65 PolarHBondContact O-N 3.38Å; K62-E65 PolarHBondContact O-N 2.97Å; E65-L67 VanDerWaalsContact C-N 3.3Å; E65-L67 PolarHBondContact O-N 3.45Å; E65-Y68 WeakPolarHBondContact O-CA 3.47Å; E65-Y68 WeakPolarHBondContact O-CB 3.01Å; E65-Y68 PolarHBondContact O-N 2.97Å; E65-F69 HydrophobicContact CB-CE2 4.29Å; E65-F69 WeakPolarHBondContact O-CD2 3.5Å; E65-F69 PolarHBondContact O-N 2.89Å
66	A	93.3	Very high	92.5	Very high	57 Å²	57	90 Å²	90	47%	0.471	42%	0.42	S	S	.	.	H	α-helix	trans	-59.3	-41.3	175.5	0	0	0	0	0	111.9	K62 E63 Y68 F69 L70	K62-A66 WeakPolarHBondContact O-CB 3.41Å; K62-A66 PolarHBondContact O-N 3.38Å; E63-A66 PolarHBondContact O-N 3.16Å; A66-Y68 VanDerWaalsContact C-N 3.31Å; A66-Y68 PolarHBondContact O-N 2.99Å; A66-F69 PolarHBondContact O-N 3.31Å; A66-L70 WeakPolarHBondContact O-CB 3.36Å; A66-L70 PolarHBondContact O-N 3.45Å
67	L	91.1	Very high	92.4	Very high	65 Å²	65	86.4 Å²	86.4	34%	0.34	41%	0.409	S	S	.	.	H	α-helix	trans	-61.4	-40.3	174.2	-173.8	68.9	0	0	0	111.6	Y23 P24 E63 L64 E65 L70 R71	Y23-L67 HydrophobicContact CE2-CD2 4.38Å; P24-L67 HydrophobicContact CG-CD2 4.07Å; E63-L67 PolarHBondContact O-N 2.92Å; L64-L67 WeakPolarHBondContact O-CB 3.46Å; L64-L67 PolarHBondContact O-N 3.41Å; E65-L67 VanDerWaalsContact C-N 3.3Å; E65-L67 PolarHBondContact O-N 3.45Å; L67-L70 PolarHBondContact O-N 3.07Å; L67-R71 WeakPolarHBondContact O-CB 3.48Å; L67-R71 PolarHBondContact O-N 2.78Å
68	Y	90.1	Very high	92.2	Very high	31 Å²	31	93.1 Å²	93.1	12%	0.122	44%	0.436	C	S	.	.	H	α-helix	trans	-62.7	-46.3	174.7	-74.6	-55.1	0	0	0	112.6	L19 E22 Y23 L64 E65 A66 R71 K72	L19-Y68 WeakPolarHBondContact O-CE2 3.49Å; L19-Y68 PolarHBondContact O-OH 3.33Å; E22-Y68 VanDerWaalsContact C-OH 3.25Å; E22-Y68 WeakPolarHBondContact CA-OH 3.39Å; E22-Y68 HydrophobicContact CB-CE1 3.4Å; E22-Y68 VanDerWaalsContact CB-CE1 3.4Å; E22-Y68 VanDerWaalsContact CB-OH 3.3Å; E22-Y68 WeakPolarHBondContact CB-OH 3.07Å; E22-Y68 HydrophobicContact CG-CE1 4.41Å; E22-Y68 PolarHBondContact N-OH 3.44Å; Y23-Y68 PolarHBondContact N-OH 3.49Å; L64-Y68 HydrophobicContact CB-CE2 4.44Å; L64-Y68 WeakPolarHBondContact O-CD2 3.49Å; L64-Y68 PolarHBondContact O-N 2.49Å; E65-Y68 WeakPolarHBondContact O-CA 3.47Å; E65-Y68 WeakPolarHBondContact O-CB 3.01Å; E65-Y68 PolarHBondContact O-N 2.97Å; A66-Y68 VanDerWaalsContact C-N 3.31Å; A66-Y68 PolarHBondContact O-N 2.99Å; Y68-R71 PolarHBondContact O-N 3.04Å; Y68-K72 WeakPolarHBondContact O-CG 3.45Å; Y68-K72 PolarHBondContact O-N 3.41Å
69	F	91	Very high	92	Very high	141 Å²	141	99.4 Å²	99.4	62%	0.618	45%	0.454	S	S	*	.	H	α-helix	trans	-61.8	-43.6	176.2	-70.2	-59	0	0	0	111.8	E65 A66 R71 K72 Y73	E65-F69 HydrophobicContact CB-CE2 4.29Å; E65-F69 WeakPolarHBondContact O-CD2 3.5Å; E65-F69 PolarHBondContact O-N 2.89Å; A66-F69 PolarHBondContact O-N 3.31Å; F69-R71 VanDerWaalsContact C-N 3.33Å; F69-R71 PolarHBondContact O-N 3.41Å; F69-K72 PolarHBondContact O-N 2.93Å; F69-Y73 WeakPolarHBondContact O-CB 3.31Å; F69-Y73 PolarHBondContact O-N 3.27Å
70	L	91.8	Very high	91.7	Very high	74 Å²	74	102.3 Å²	102.3	39%	0.387	46%	0.461	S	S	.	.	H	α-helix	trans	-61.2	-42	177.5	-176.7	63	0	0	0	111.8	A66 L67 Y73 R74	A66-L70 WeakPolarHBondContact O-CB 3.36Å; A66-L70 PolarHBondContact O-N 3.45Å; L67-L70 PolarHBondContact O-N 3.07Å; L70-Y73 PolarHBondContact O-N 2.98Å; L70-R74 WeakPolarHBondContact O-CB 3.49Å; L70-R74 VanDerWaalsContact O-CG 3.31Å; L70-R74 WeakPolarHBondContact O-CG 3.41Å; L70-R74 PolarHBondContact O-N 2.91Å
71	R	89.8	Confident	91.2	Very high	131 Å²	131	108.2 Å²	108.2	49%	0.494	48%	0.48	S	S	.	.	H	α-helix	trans	-62	-45.9	176.1	-172.7	175.7	71.7	132.5	-3.3	111.5	E22 L67 Y68 F69 R74 A75	E22-R71 IonicContact OE2-CZ 2.76Å; E22-R71 IonicContact OE2-NH2 3.99Å; E22-R71 PolarHBondContact OE2-NH2 3.04Å; L67-R71 WeakPolarHBondContact O-CB 3.48Å; L67-R71 PolarHBondContact O-N 2.78Å; Y68-R71 PolarHBondContact O-N 3.04Å; F69-R71 VanDerWaalsContact C-N 3.33Å; F69-R71 PolarHBondContact O-N 3.41Å; R71-R74 PolarHBondContact O-N 3.48Å; R71-A75 PolarHBondContact O-N 3.42Å
72	K	90.5	Very high	90.1	Very high	140 Å²	140	112.7 Å²	112.7	61%	0.609	50%	0.504	S	S	*	.	H	α-helix	trans	-61.1	-46.3	176.3	-74.3	-179.9	178.7	180	0	111.4	Y68 F69 R74 A75 M76	Y68-K72 WeakPolarHBondContact O-CG 3.45Å; Y68-K72 PolarHBondContact O-N 3.41Å; F69-K72 PolarHBondContact O-N 2.93Å; K72-R74 PolarHBondContact O-N 2.81Å; K72-A75 PolarHBondContact O-N 2.85Å; K72-M76 WeakPolarHBondContact O-CB 3.41Å; K72-M76 PolarHBondContact O-N 3.36Å
73	Y	93.8	Very high	88.5	Confident	125 Å²	125	111.6 Å²	111.6	49%	0.49	51%	0.511	S	S	.	.	H	α-helix	trans	-59.4	-46.9	176.9	174.2	-100.7	0	0	0	112	F69 L70 A75 M76 K77	F69-Y73 WeakPolarHBondContact O-CB 3.31Å; F69-Y73 PolarHBondContact O-N 3.27Å; L70-Y73 PolarHBondContact O-N 2.98Å; Y73-A75 VanDerWaalsContact C-N 3.33Å; Y73-A75 PolarHBondContact O-N 3.24Å; Y73-M76 HydrophobicContact CD2-CE 4.21Å; Y73-M76 PolarHBondContact O-N 3.07Å; Y73-K77 HydrophobicContact CE1-CD 4.29Å; Y73-K77 WeakPolarHBondContact O-CB 3.48Å; Y73-K77 PolarHBondContact O-N 3.4Å
74	R	90.5	Very high	86.9	Confident	167 Å²	167	113.9 Å²	113.9	63%	0.63	52%	0.521	S	S	*	.	H	α-helix	trans	-59.4	-42.6	176.6	-74.6	175.8	179.1	178.9	-0.3	112.3	L70 R71 K72 K78	L70-R74 WeakPolarHBondContact O-CB 3.49Å; L70-R74 VanDerWaalsContact O-CG 3.31Å; L70-R74 WeakPolarHBondContact O-CG 3.41Å; L70-R74 PolarHBondContact O-N 2.91Å; R71-R74 PolarHBondContact O-N 3.48Å; K72-R74 PolarHBondContact O-N 2.81Å; R74-K78 WeakPolarHBondContact O-CB 3.47Å; R74-K78 PolarHBondContact O-N 3.27Å
75	A	91	Very high	85	Confident	49 Å²	49	126.9 Å²	126.9	41%	0.405	58%	0.577	S	S	.	*	H	α-helix	trans	-65	-43.4	177.2	0	0	0	0	0	112.2	R71 K72 Y73 R79	R71-A75 PolarHBondContact O-N 3.42Å; K72-A75 PolarHBondContact O-N 2.85Å; Y73-A75 VanDerWaalsContact C-N 3.33Å; Y73-A75 PolarHBondContact O-N 3.24Å; A75-R79 WeakPolarHBondContact O-CG 3.37Å; A75-R79 PolarHBondContact O-N 3.41Å
76	M	92.4	Very high	84.6	Confident	96 Å²	96	129.1 Å²	129.1	47%	0.473	59%	0.587	S	S	.	*	H	α-helix	trans	-63.1	-48.4	175.6	-173.2	-178.6	77.5	0	0	111.1	K72 Y73 K78 R79 Y80	K72-M76 WeakPolarHBondContact O-CB 3.41Å; K72-M76 PolarHBondContact O-N 3.36Å; Y73-M76 HydrophobicContact CD2-CE 4.21Å; Y73-M76 PolarHBondContact O-N 3.07Å; M76-K78 VanDerWaalsContact C-N 3.3Å; M76-K78 PolarHBondContact O-N 2.9Å; M76-R79 PolarHBondContact O-N 3.11Å; M76-Y80 HydrophobicContact CG-CD2 3.68Å; M76-Y80 HydrophobicContact CG-CE2 3.84Å; M76-Y80 WeakPolarHBondContact O-CD2 3.33Å; M76-Y80 PolarHBondContact O-N 3.22Å; M76-Y80 VanDerWaalsContact O-N 3.11Å
77	K	92.8	Very high	84.2	Confident	106 Å²	106	132.8 Å²	132.8	46%	0.461	59%	0.593	S	S	.	*	H	α-helix	trans	-55.6	-46.4	178.8	-175.3	178.7	177.3	179.2	0	111.3	Y73 R79 Y80 Y81	Y73-K77 HydrophobicContact CE1-CD 4.29Å; Y73-K77 WeakPolarHBondContact O-CB 3.48Å; Y73-K77 PolarHBondContact O-N 3.4Å; K77-R79 VanDerWaalsContact C-N 3.31Å; K77-R79 PolarHBondContact O-N 2.92Å; K77-Y80 PolarHBondContact O-N 3.04Å; K77-Y81 HydrophobicContact CG-CD2 4.09Å; K77-Y81 WeakPolarHBondContact O-CB 3.25Å; K77-Y81 PolarHBondContact O-N 3.32Å
78	K	90.5	Very high	83.8	Confident	151 Å²	151	136.6 Å²	136.6	66%	0.657	61%	0.607	S	S	*	*	H	α-helix	trans	-59.6	-38.6	177.1	-172.6	177.9	-180	-177.9	0	112.8	R74 M76 D82	R74-K78 WeakPolarHBondContact O-CB 3.47Å; R74-K78 PolarHBondContact O-N 3.27Å; M76-K78 VanDerWaalsContact C-N 3.3Å; M76-K78 PolarHBondContact O-N 2.9Å; K78-D82 PolarHBondContact O-N 3.45Å
79	R	90.2	Very high	83.4	Confident	207 Å²	207	142.8 Å²	142.8	78%	0.781	64%	0.635	S	S	*	*	H	α-helix	trans	-72.5	-36.3	-178.6	-72	177.5	-177.3	-162.8	-0.5	113.7	A75 M76 K77	A75-R79 WeakPolarHBondContact O-CG 3.37Å; A75-R79 PolarHBondContact O-N 3.41Å; M76-R79 PolarHBondContact O-N 3.11Å; K77-R79 VanDerWaalsContact C-N 3.31Å; K77-R79 PolarHBondContact O-N 2.92Å
80	Y	88.9	Confident	82.9	Confident	177 Å²	177	142.9 Å²	142.9	69%	0.694	64%	0.636	S	S	*	*	H	α-helix	trans	-99.8	-23.1	-172.9	-71.5	-78.3	0	0	0	114.1	M76 K77	M76-Y80 HydrophobicContact CG-CD2 3.68Å; M76-Y80 HydrophobicContact CG-CE2 3.84Å; M76-Y80 WeakPolarHBondContact O-CD2 3.33Å; M76-Y80 PolarHBondContact O-N 3.22Å; M76-Y80 VanDerWaalsContact O-N 3.11Å; K77-Y80 PolarHBondContact O-N 3.04Å
81	Y	81.9	Confident	82.4	Confident	173 Å²	173	147.5 Å²	147.5	68%	0.678	65%	0.653	S	S	*	*	H	α-helix	trans	-120.7	-7	-172.3	-60.4	-86.7	0	0	0	114.8	K77 P83	K77-Y81 HydrophobicContact CG-CD2 4.09Å; K77-Y81 WeakPolarHBondContact O-CB 3.25Å; K77-Y81 PolarHBondContact O-N 3.32Å; Y81-P83 VanDerWaalsContact O-CD 3.25Å; Y81-P83 WeakPolarHBondContact O-CD 3.38Å
82	D	71.9	Confident	81.8	Confident	115 Å²	115	148.7 Å²	148.7	62%	0.615	66%	0.664	S	S	*	*			trans	-111.2	75.6	165.8	-76.9	-37.1	0	0	0	109.1	K78 E84	K78-D82 PolarHBondContact O-N 3.45Å; D82-E84 PolarHBondContact O-N 3.24Å
83	P	60.4	Low	81.2	Confident	115 Å²	115	149.4 Å²	149.4	75%	0.747	67%	0.669	S	S	*	*			trans	-72.5	-4.6	-176.4	30.3	-35.4	0	0	0	114.4	Y81	Y81-P83 VanDerWaalsContact O-CD 3.25Å; Y81-P83 WeakPolarHBondContact O-CD 3.38Å
84	E	59.8	Low	80.1	Confident	177 Å²	177	151.4 Å²	151.4	83%	0.827	68%	0.684	S	S	*	*			trans	-130.1	102.5	-172.8	-68.8	-177.3	169.8	0	0	113.2	D82	D82-E84 PolarHBondContact O-N 3.24Å
85	K	51	Low	79.2	Confident	284 Å²	284	150 Å²	150	100%	1.235	69%	0.688	S	S	*	*			trans	-137.5	0	133.8	-104.6	-163.7	179.8	-169.1	0	109.1

Retrieved 85 of 85 residues in 203.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).