A0A087XCD6_POEFO Loading...

MICOS complex subunit MIC13

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

AlphaFold DB , UniProt , Accession A0A087XCD6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 113 aa.

						>A0A087XCD6_POEFO|A0A087XCD6
MAPRIWPLVKLVSKVTIAGGAVYVAYDSGLLGSSEQGSMALEKAKAVVPPALEEWMKYFGLEAQLPTMPKIEFSPVNSWNAGVRWTISSLSEAPTRATEYTNQGLQYVKDLTK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.2	Low	79.9	Confident	208 Å²	208	120.2 Å²	120.2	100%	1.025	61%	0.611	S	S	*	*				0	-31.9	0	-59.8	-155.3	-147.8	0	0	113.9	P3 R4	M1-P3 VanDerWaalsContact C-CD 3.42Å; M1-R4 PolarHBondContact O-N 2.79Å
2	A	60.7	Low	81.1	Confident	75 Å²	75	117.6 Å²	117.6	62%	0.62	61%	0.605	S	S	*	*	H	α-helix	trans	-52.9	-38.5	175.9	0	0	0	0	0	117.8	R4 I5 W6	A2-R4 VanDerWaalsContact C-N 3.29Å; A2-R4 PolarHBondContact O-N 3.22Å; A2-I5 PolarHBondContact O-N 3.48Å; A2-W6 PolarHBondContact O-N 3.42Å
3	P	62.1	Low	82.2	Confident	105 Å²	105	113.1 Å²	113.1	68%	0.682	59%	0.59	S	S	*	*	H	α-helix	trans	-71.2	-19.5	-174	24.6	-33	0	0	0	114.5	M1 P7	M1-P3 VanDerWaalsContact C-CD 3.42Å; P3-P7 VanDerWaalsContact O-CD 3.27Å; P3-P7 WeakPolarHBondContact O-CD 3.42Å
4	R	70.1	Confident	83.1	Confident	221 Å²	221	116 Å²	116	83%	0.834	60%	0.596	S	S	*	*	H	α-helix	trans	-84.2	-22.5	174.6	-82.2	-176.5	173.3	166.5	-2.3	113.4	M1 A2	M1-R4 PolarHBondContact O-N 2.79Å; A2-R4 VanDerWaalsContact C-N 3.29Å; A2-R4 PolarHBondContact O-N 3.22Å
5	I	83.6	Confident	83.9	Confident	96 Å²	96	114.3 Å²	114.3	49%	0.492	59%	0.593	S	S	.	*	H	α-helix	trans	-87.1	-32	-177.2	-62.5	165.6	0	0	0	110.8	A2 L8 V9	A2-I5 PolarHBondContact O-N 3.48Å; I5-L8 WeakPolarHBondContact O-CB 3.38Å; I5-L8 PolarHBondContact O-N 3.07Å; I5-L8 VanDerWaalsContact O-N 3.09Å; I5-V9 HydrophobicContact CG2-CG2 3.9Å; I5-V9 WeakPolarHBondContact O-CG2 3.38Å; I5-V9 PolarHBondContact O-N 3.39Å
6	W	88.9	Confident	84.7	Confident	155 Å²	155	112.9 Å²	112.9	59%	0.587	59%	0.59	S	S	*	*	H	α-helix	trans	-56.2	-44	-179.9	179.1	-116.4	0	0	0	115.1	A2 L8 V9 K10	A2-W6 PolarHBondContact O-N 3.42Å; W6-L8 VanDerWaalsContact C-N 3.31Å; W6-L8 PolarHBondContact O-N 3.42Å; W6-V9 PolarHBondContact O-N 3.3Å; W6-K10 HydrophobicContact CZ2-CD 4.44Å; W6-K10 VanDerWaalsContact CZ2-CE 3.41Å; W6-K10 VanDerWaalsContact NE1-NZ 3.19Å; W6-K10 PolarHBondContact O-N 3.44Å
7	P	88.8	Confident	85.3	Confident	75 Å²	75	113.5 Å²	113.5	49%	0.487	59%	0.593	S	S	.	*	H	α-helix	trans	-61.7	-37.7	174.4	-22.9	34.5	0	0	0	113.1	P3 K10 L11	P3-P7 VanDerWaalsContact O-CD 3.27Å; P3-P7 WeakPolarHBondContact O-CD 3.42Å; P7-K10 PolarHBondContact O-N 3.05Å; P7-L11 PolarHBondContact O-N 3.35Å
8	L	90.5	Very high	85.9	Confident	107 Å²	107	110.4 Å²	110.4	56%	0.56	59%	0.586	S	S	*	*	H	α-helix	trans	-68.2	-44.9	178.4	-71.5	166.7	0	0	0	111.4	I5 W6 K10 L11 V12	I5-L8 WeakPolarHBondContact O-CB 3.38Å; I5-L8 PolarHBondContact O-N 3.07Å; I5-L8 VanDerWaalsContact O-N 3.09Å; W6-L8 VanDerWaalsContact C-N 3.31Å; W6-L8 PolarHBondContact O-N 3.42Å; L8-K10 VanDerWaalsContact C-N 3.32Å; L8-K10 PolarHBondContact O-N 3.13Å; L8-L11 PolarHBondContact O-N 2.97Å; L8-V12 WeakPolarHBondContact O-CG2 3.3Å; L8-V12 PolarHBondContact O-N 3.37Å
9	V	93.3	Very high	86.4	Confident	69 Å²	69	106.7 Å²	106.7	42%	0.418	58%	0.577	S	S	.	*	H	α-helix	trans	-58.6	-46.4	175.6	173.7	0	0	0	0	110.3	I5 W6 L11 V12 S13	I5-V9 HydrophobicContact CG2-CG2 3.9Å; I5-V9 WeakPolarHBondContact O-CG2 3.38Å; I5-V9 PolarHBondContact O-N 3.39Å; W6-V9 PolarHBondContact O-N 3.3Å; V9-L11 VanDerWaalsContact C-N 3.34Å; V9-L11 PolarHBondContact O-N 3.36Å; V9-V12 PolarHBondContact O-N 2.93Å; V9-S13 WeakPolarHBondContact O-CB 3.34Å; V9-S13 PolarHBondContact O-N 3.07Å; V9-S13 PolarHBondContact O-OG 2.91Å
10	K	92	Very high	86.8	Confident	106 Å²	106	103.2 Å²	103.2	46%	0.461	57%	0.567	S	S	.	*	H	α-helix	trans	-57.8	-44	175.7	-81.5	-178.3	165.5	176.8	0	112.8	W6 P7 L8 K14	W6-K10 HydrophobicContact CZ2-CD 4.44Å; W6-K10 VanDerWaalsContact CZ2-CE 3.41Å; W6-K10 VanDerWaalsContact NE1-NZ 3.19Å; W6-K10 PolarHBondContact O-N 3.44Å; P7-K10 PolarHBondContact O-N 3.05Å; L8-K10 VanDerWaalsContact C-N 3.32Å; L8-K10 PolarHBondContact O-N 3.13Å; K10-K14 WeakPolarHBondContact O-CG 3.44Å; K10-K14 PolarHBondContact O-N 3.08Å; K10-K14 VanDerWaalsContact O-N 3.16Å
11	L	94.3	Very high	87.1	Confident	105 Å²	105	101.2 Å²	101.2	55%	0.55	56%	0.564	S	S	.	*	H	α-helix	trans	-65	-49.3	179.5	-177.9	66.6	0	0	0	110.9	P7 L8 V9 S13 K14 V15	P7-L11 PolarHBondContact O-N 3.35Å; L8-L11 PolarHBondContact O-N 2.97Å; V9-L11 VanDerWaalsContact C-N 3.34Å; V9-L11 PolarHBondContact O-N 3.36Å; L11-S13 PolarHBondContact O-N 3.33Å; L11-K14 PolarHBondContact O-N 2.93Å; L11-V15 HydrophobicContact CD1-CG2 4.23Å; L11-V15 HydrophobicContact CG-CG2 4.4Å; L11-V15 WeakPolarHBondContact O-CG2 3.39Å; L11-V15 PolarHBondContact O-N 2.93Å
12	V	95.3	Very high	88.9	Confident	89 Å²	89	95.7 Å²	95.7	54%	0.539	54%	0.542	S	S	.	.	H	α-helix	trans	-59	-47.7	179.7	172.6	0	0	0	0	110.4	L8 V9 K14 V15 T16	L8-V12 WeakPolarHBondContact O-CG2 3.3Å; L8-V12 PolarHBondContact O-N 3.37Å; V9-V12 PolarHBondContact O-N 2.93Å; V12-K14 VanDerWaalsContact C-N 3.33Å; V12-K14 PolarHBondContact O-N 2.72Å; V12-V15 PolarHBondContact O-N 3.43Å; V12-T16 WeakPolarHBondContact O-CB 3.47Å; V12-T16 PolarHBondContact O-N 3.29Å; V12-T16 PolarHBondContact O-OG1 3.3Å
13	S	94.2	Very high	90.5	Very high	59 Å²	59	99.3 Å²	99.3	41%	0.413	54%	0.541	S	S	.	.	H	α-helix	trans	-57.5	-44.6	177.5	-60.5	0	0	0	0	112.4	V9 L11 T16 I17	V9-S13 WeakPolarHBondContact O-CB 3.34Å; V9-S13 PolarHBondContact O-N 3.07Å; V9-S13 PolarHBondContact O-OG 2.91Å; L11-S13 PolarHBondContact O-N 3.33Å; S13-T16 PolarHBondContact O-N 2.95Å; S13-I17 WeakPolarHBondContact O-CD1 3.33Å; S13-I17 VanDerWaalsContact O-CG1 3.24Å; S13-I17 WeakPolarHBondContact O-CG1 3.49Å; S13-I17 PolarHBondContact O-N 2.94Å
14	K	95.3	Very high	91.9	Very high	154 Å²	154	98.7 Å²	98.7	67%	0.67	54%	0.535	S	S	*	.	H	α-helix	trans	-64.7	-46	178.8	-74.8	-179.8	175.1	-167.3	0	112.2	K10 L11 V12 T16 I17 A18	K10-K14 WeakPolarHBondContact O-CG 3.44Å; K10-K14 PolarHBondContact O-N 3.08Å; K10-K14 VanDerWaalsContact O-N 3.16Å; L11-K14 PolarHBondContact O-N 2.93Å; V12-K14 VanDerWaalsContact C-N 3.33Å; V12-K14 PolarHBondContact O-N 2.72Å; K14-T16 VanDerWaalsContact C-N 3.33Å; K14-I17 PolarHBondContact O-N 3.31Å; K14-A18 WeakPolarHBondContact O-CB 3.27Å; K14-A18 PolarHBondContact O-N 3.47Å
15	V	96	Very high	92.8	Very high	91 Å²	91	89.1 Å²	89.1	55%	0.552	50%	0.503	S	S	*	.	H	α-helix	trans	-64.4	-40.7	179.6	173.1	0	0	0	0	110.5	L11 V12 A18 G19	L11-V15 HydrophobicContact CD1-CG2 4.23Å; L11-V15 HydrophobicContact CG-CG2 4.4Å; L11-V15 WeakPolarHBondContact O-CG2 3.39Å; L11-V15 PolarHBondContact O-N 2.93Å; V12-V15 PolarHBondContact O-N 3.43Å; V15-A18 PolarHBondContact O-N 3.4Å; V15-G19 PolarHBondContact O-N 3.31Å
16	T	95.7	Very high	93.1	Very high	91 Å²	91	92.8 Å²	92.8	56%	0.558	51%	0.512	S	S	*	.	H	α-helix	trans	-63.7	-45.5	176.3	-60.1	0	0	0	0	111.8	V12 S13 K14 G20	V12-T16 WeakPolarHBondContact O-CB 3.47Å; V12-T16 PolarHBondContact O-N 3.29Å; V12-T16 PolarHBondContact O-OG1 3.3Å; S13-T16 PolarHBondContact O-N 2.95Å; K14-T16 VanDerWaalsContact C-N 3.33Å; T16-G20 PolarHBondContact O-N 3.26Å
17	I	95.9	Very high	93.2	Very high	124 Å²	124	91 Å²	91	64%	0.636	51%	0.514	S	S	*	.	H	α-helix	trans	-63	-46.5	178.2	-68.1	165	0	0	0	110.4	S13 K14 A21	S13-I17 WeakPolarHBondContact O-CD1 3.33Å; S13-I17 VanDerWaalsContact O-CG1 3.24Å; S13-I17 WeakPolarHBondContact O-CG1 3.49Å; S13-I17 PolarHBondContact O-N 2.94Å; K14-I17 PolarHBondContact O-N 3.31Å; I17-A21 WeakPolarHBondContact O-CB 3.23Å; I17-A21 PolarHBondContact O-N 3.48Å
18	A	94.8	Very high	93.1	Very high	57 Å²	57	90.3 Å²	90.3	47%	0.471	51%	0.511	S	S	.	.	H	α-helix	trans	-63.8	-47.6	179	0	0	0	0	0	111.9	K14 V15 A21 V22	K14-A18 WeakPolarHBondContact O-CB 3.27Å; K14-A18 PolarHBondContact O-N 3.47Å; V15-A18 PolarHBondContact O-N 3.4Å; A18-A21 PolarHBondContact O-N 2.92Å; A18-V22 WeakPolarHBondContact O-CG2 3.29Å; A18-V22 PolarHBondContact O-N 2.96Å
19	G	95.6	Very high	93	Very high	40 Å²	40	85.9 Å²	85.9	41%	0.412	49%	0.492	S	S	.	.	H	α-helix	trans	-63.6	-41.7	178.4	0	0	0	0	0	112.4	V15 V22 Y23	V15-G19 PolarHBondContact O-N 3.31Å; G19-V22 PolarHBondContact O-N 3.27Å; G19-Y23 WeakPolarHBondContact O-CB 3.47Å; G19-Y23 PolarHBondContact O-N 3.49Å
20	G	95.2	Very high	92.8	Very high	36 Å²	36	86.7 Å²	86.7	37%	0.371	49%	0.493	S	S	.	.	H	α-helix	trans	-62.4	-43.1	175	0	0	0	0	0	112.4	T16 V22 Y23 V24	T16-G20 PolarHBondContact O-N 3.26Å; G20-V22 PolarHBondContact O-N 2.83Å; G20-Y23 PolarHBondContact O-N 3.36Å; G20-V24 WeakPolarHBondContact O-CG2 3.43Å; G20-V24 PolarHBondContact O-N 3.45Å
21	A	92.7	Very high	92.6	Very high	62 Å²	62	87 Å²	87	51%	0.512	50%	0.499	S	S	.	.	H	α-helix	trans	-62.1	-43.1	175.9	0	0	0	0	0	112.1	I17 A18 V24 A25	I17-A21 WeakPolarHBondContact O-CB 3.23Å; I17-A21 PolarHBondContact O-N 3.48Å; A18-A21 PolarHBondContact O-N 2.92Å; A21-V24 PolarHBondContact O-N 3Å; A21-A25 WeakPolarHBondContact O-CB 3.45Å; A21-A25 PolarHBondContact O-N 2.95Å
22	V	92.9	Very high	92.3	Very high	93 Å²	93	84.1 Å²	84.1	56%	0.564	50%	0.495	S	S	*	.	H	α-helix	trans	-64.5	-43	175.9	173.3	0	0	0	0	111.2	A18 G19 G20 A25 Y26	A18-V22 WeakPolarHBondContact O-CG2 3.29Å; A18-V22 PolarHBondContact O-N 2.96Å; G19-V22 PolarHBondContact O-N 3.27Å; G20-V22 PolarHBondContact O-N 2.83Å; V22-A25 PolarHBondContact O-N 3.17Å; V22-Y26 WeakPolarHBondContact O-CB 3.42Å; V22-Y26 PolarHBondContact O-N 2.9Å
23	Y	92.8	Very high	91.9	Very high	150 Å²	150	82.6 Å²	82.6	59%	0.588	49%	0.488	S	S	*	.	H	α-helix	trans	-60.1	-48.4	177.3	178	-91.6	0	0	0	111.5	G19 G20 A25 Y26 D27	G19-Y23 WeakPolarHBondContact O-CB 3.47Å; G19-Y23 PolarHBondContact O-N 3.49Å; G20-Y23 PolarHBondContact O-N 3.36Å; Y23-A25 VanDerWaalsContact C-N 3.33Å; Y23-A25 PolarHBondContact O-N 3Å; Y23-Y26 WeakPolarHBondContact O-CB 3.33Å; Y23-Y26 PolarHBondContact O-N 2.96Å; Y23-Y26 VanDerWaalsContact O-N 3.16Å; Y23-D27 HydrophobicContact CE1-CB 4.25Å; Y23-D27 WeakPolarHBondContact O-CB 3.36Å; Y23-D27 PolarHBondContact O-N 3.48Å
24	V	91.6	Very high	91.3	Very high	92 Å²	92	85 Å²	85	56%	0.558	51%	0.505	S	S	*	.	H	α-helix	trans	-62.6	-40.5	178	171.5	0	0	0	0	111.2	G20 A21 Y26 D27 S28	G20-V24 WeakPolarHBondContact O-CG2 3.43Å; G20-V24 PolarHBondContact O-N 3.45Å; A21-V24 PolarHBondContact O-N 3Å; V24-Y26 VanDerWaalsContact C-N 3.3Å; V24-Y26 PolarHBondContact O-N 3.22Å; V24-D27 PolarHBondContact O-N 3.29Å; V24-S28 WeakPolarHBondContact O-CB 3.39Å; V24-S28 PolarHBondContact O-N 2.88Å; V24-S28 PolarHBondContact O-OG 3.09Å
25	A	89.6	Confident	90.9	Very high	20 Å²	20	84.4 Å²	84.4	17%	0.165	50%	0.504	C	S	.	.	H	α-helix	trans	-63.6	-36.5	175.7	0	0	0	0	0	112.3	A21 V22 Y23 S28 L30 L31	A21-A25 WeakPolarHBondContact O-CB 3.45Å; A21-A25 PolarHBondContact O-N 2.95Å; V22-A25 PolarHBondContact O-N 3.17Å; Y23-A25 VanDerWaalsContact C-N 3.33Å; Y23-A25 PolarHBondContact O-N 3Å; A25-S28 PolarHBondContact O-OG 3.42Å; A25-L30 HydrophobicContact CB-CD2 4.27Å; A25-L30 VanDerWaalsContact O-CB 3.31Å; A25-L30 WeakPolarHBondContact O-CB 3.36Å; A25-L30 PolarHBondContact O-N 3.3Å; A25-L30 VanDerWaalsContact O-N 3.11Å; A25-L31 HydrophobicContact CB-CD1 4.12Å; A25-L31 HydrophobicContact CB-CG 4.14Å; A25-L31 PolarHBondContact O-N 3.49Å
26	Y	89.6	Confident	90.4	Very high	173 Å²	173	84.7 Å²	84.7	68%	0.678	50%	0.5	S	S	*	.	H	α-helix	trans	-70.1	-50.7	175.3	-176.1	-93.5	0	0	0	111.8	V22 Y23 V24 S28 G29	V22-Y26 WeakPolarHBondContact O-CB 3.42Å; V22-Y26 PolarHBondContact O-N 2.9Å; Y23-Y26 WeakPolarHBondContact O-CB 3.33Å; Y23-Y26 PolarHBondContact O-N 2.96Å; Y23-Y26 VanDerWaalsContact O-N 3.16Å; V24-Y26 VanDerWaalsContact C-N 3.3Å; V24-Y26 PolarHBondContact O-N 3.22Å; Y26-S28 PolarHBondContact O-N 3.23Å; Y26-G29 PolarHBondContact O-N 3.01Å
27	D	91.6	Very high	90	Very high	117 Å²	117	81 Å²	81	63%	0.626	48%	0.479	S	S	*	.	H	α-helix	trans	-64.7	-37.8	-177	-174	62.5	0	0	0	112.8	Y23 V24 G29	Y23-D27 HydrophobicContact CE1-CB 4.25Å; Y23-D27 WeakPolarHBondContact O-CB 3.36Å; Y23-D27 PolarHBondContact O-N 3.48Å; V24-D27 PolarHBondContact O-N 3.29Å; D27-G29 PolarHBondContact O-N 3.4Å; D27-G29 VanDerWaalsContact O-N 3.12Å
28	S	86.6	Confident	89.5	Confident	61 Å²	61	77.7 Å²	77.7	43%	0.427	47%	0.467	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68	-7.4	174.7	58.7	0	0	0	0	114.1	V24 A25 Y26 L30 A40	V24-S28 WeakPolarHBondContact O-CB 3.39Å; V24-S28 PolarHBondContact O-N 2.88Å; V24-S28 PolarHBondContact O-OG 3.09Å; A25-S28 PolarHBondContact O-OG 3.42Å; Y26-S28 PolarHBondContact O-N 3.23Å; S28-L30 PolarHBondContact O-N 3.1Å; S28-A40 WeakPolarHBondContact O-CB 3.46Å
29	G	88.6	Confident	89.1	Confident	15 Å²	15	79 Å²	79	16%	0.155	47%	0.465	C	S	.	.	T	Hydrogen-bonded Turn	trans	75.5	10	-175.7	0	0	0	0	0	113.7	Y26 D27 L31 G32 Q36 G37	Y26-G29 PolarHBondContact O-N 3.01Å; D27-G29 PolarHBondContact O-N 3.4Å; D27-G29 VanDerWaalsContact O-N 3.12Å; G29-L31 VanDerWaalsContact C-N 3.27Å; G29-L31 PolarHBondContact O-N 3.36Å; G29-G32 PolarHBondContact O-N 2.9Å; G29-Q36 CarbonylContact O-C 3.41Å; G29-G37 PolarHBondContact O-N 3.03Å
30	L	87.9	Confident	88.8	Confident	86 Å²	86	77.8 Å²	77.8	45%	0.45	45%	0.451	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.6	-37.2	178.4	-176.2	65.6	0	0	0	111.9	A25 S28 G32 A40	A25-L30 HydrophobicContact CB-CD2 4.27Å; A25-L30 VanDerWaalsContact O-CB 3.31Å; A25-L30 WeakPolarHBondContact O-CB 3.36Å; A25-L30 PolarHBondContact O-N 3.3Å; A25-L30 VanDerWaalsContact O-N 3.11Å; S28-L30 PolarHBondContact O-N 3.1Å; L30-G32 VanDerWaalsContact C-N 3.3Å; L30-A40 HydrophobicContact CB-CB 4.36Å; L30-A40 HydrophobicContact CD1-CB 4.43Å
31	L	89.5	Confident	88.3	Confident	113 Å²	113	78.3 Å²	78.3	59%	0.592	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.3	10.4	176.9	-55.9	-179.6	0	0	0	113.1	A25 G29	A25-L31 HydrophobicContact CB-CD1 4.12Å; A25-L31 HydrophobicContact CB-CG 4.14Å; A25-L31 PolarHBondContact O-N 3.49Å; G29-L31 VanDerWaalsContact C-N 3.27Å; G29-L31 PolarHBondContact O-N 3.36Å
32	G	86.9	Confident	87.9	Confident	44 Å²	44	82 Å²	82	45%	0.454	45%	0.452	S	S	.	.	S	Bend	trans	-84.1	-145	-179	0	0	0	0	0	113.1	G29 L30	G29-G32 PolarHBondContact O-N 2.9Å; L30-G32 VanDerWaalsContact C-N 3.3Å
33	S	87.4	Confident	87.7	Confident	56 Å²	56	84.6 Å²	84.6	39%	0.392	46%	0.455	S	S	.	.			trans	-67	163.1	173.9	77.4	0	0	0	0	111.7	E35 Q36 G37	S33-E35 PolarHBondContact O-N 3.44Å; S33-Q36 PolarHBondContact O-N 3.22Å; S33-Q36 VanDerWaalsContact O-N 3.13Å; S33-Q36 WeakPolarHBondContact OG-CG 3.48Å; S33-Q36 PolarHBondContact OG-N 3.28Å; S33-G37 PolarHBondContact O-N 2.93Å
34	S	81.8	Confident	87.3	Confident	110 Å²	110	79.5 Å²	79.5	77%	0.769	44%	0.444	S	S	*	.	H	α-helix	trans	-53.7	-39.1	176	-175.9	0	0	0	0	112.6	S38	S34-S38 VanDerWaalsContact O-CB 3.27Å; S34-S38 WeakPolarHBondContact O-CB 3.34Å; S34-S38 PolarHBondContact O-N 3.39Å
35	E	85.9	Confident	86.9	Confident	141 Å²	141	79.9 Å²	79.9	66%	0.659	44%	0.438	S	S	*	.	H	α-helix	trans	-68.5	-46.7	177.5	-171.9	-179.8	179	0	0	111.8	S33 G37 S38 M39	S33-E35 PolarHBondContact O-N 3.44Å; E35-G37 PolarHBondContact O-N 3.42Å; E35-S38 PolarHBondContact O-N 3.18Å; E35-M39 HydrophobicContact CG-CE 4.19Å; E35-M39 WeakPolarHBondContact O-CG 3.35Å; E35-M39 PolarHBondContact O-N 3.42Å
36	Q	86.9	Confident	86.7	Confident	97 Å²	97	82.2 Å²	82.2	45%	0.453	46%	0.457	S	S	.	.	H	α-helix	trans	-61	-45.1	177.2	-71.3	173.1	-23.7	0	0	111.4	G29 S33 M39 A40	G29-Q36 CarbonylContact O-C 3.41Å; S33-Q36 PolarHBondContact O-N 3.22Å; S33-Q36 VanDerWaalsContact O-N 3.13Å; S33-Q36 WeakPolarHBondContact OG-CG 3.48Å; S33-Q36 PolarHBondContact OG-N 3.28Å; Q36-M39 PolarHBondContact O-N 3.03Å; Q36-A40 WeakPolarHBondContact O-CB 3.36Å; Q36-A40 PolarHBondContact O-N 3.02Å
37	G	86.3	Confident	86.5	Confident	13 Å²	13	78.4 Å²	78.4	13%	0.134	45%	0.452	C	S	.	.	H	α-helix	trans	-65.7	-39.2	177.5	0	0	0	0	0	112.9	G29 S33 E35 A40 L41	G29-G37 PolarHBondContact O-N 3.03Å; S33-G37 PolarHBondContact O-N 2.93Å; E35-G37 PolarHBondContact O-N 3.42Å; G37-A40 PolarHBondContact O-N 3Å; G37-L41 WeakPolarHBondContact O-CB 3.35Å; G37-L41 PolarHBondContact O-N 2.91Å
38	S	84.9	Confident	86.1	Confident	55 Å²	55	76 Å²	76	39%	0.385	44%	0.441	S	S	.	.	H	α-helix	trans	-64.4	-44.2	175.7	-171.1	0	0	0	0	111.7	S34 E35 L41 E42	S34-S38 VanDerWaalsContact O-CB 3.27Å; S34-S38 WeakPolarHBondContact O-CB 3.34Å; S34-S38 PolarHBondContact O-N 3.39Å; E35-S38 PolarHBondContact O-N 3.18Å; S38-L41 PolarHBondContact O-N 3.49Å; S38-E42 PolarHBondContact O-N 3.16Å
39	M	87.5	Confident	86	Confident	85 Å²	85	74.8 Å²	74.8	42%	0.419	43%	0.432	S	S	.	.	H	α-helix	trans	-64.9	-40.7	175.3	-72.2	-171.3	-66.5	0	0	112.1	E35 Q36 L41 E42 K43	E35-M39 HydrophobicContact CG-CE 4.19Å; E35-M39 WeakPolarHBondContact O-CG 3.35Å; E35-M39 PolarHBondContact O-N 3.42Å; Q36-M39 PolarHBondContact O-N 3.03Å; M39-L41 VanDerWaalsContact C-N 3.34Å; M39-E42 PolarHBondContact O-N 3.42Å; M39-K43 WeakPolarHBondContact O-CG 3.39Å; M39-K43 PolarHBondContact O-N 2.79Å
40	A	87.9	Confident	85.7	Confident	14 Å²	14	76.8 Å²	76.8	12%	0.116	44%	0.442	C	S	.	.	H	α-helix	trans	-62.2	-42.6	176.4	0	0	0	0	0	111.3	S28 L30 Q36 G37 K43 A44	S28-A40 WeakPolarHBondContact O-CB 3.46Å; L30-A40 HydrophobicContact CB-CB 4.36Å; L30-A40 HydrophobicContact CD1-CB 4.43Å; Q36-A40 WeakPolarHBondContact O-CB 3.36Å; Q36-A40 PolarHBondContact O-N 3.02Å; G37-A40 PolarHBondContact O-N 3Å; A40-K43 PolarHBondContact O-N 3.46Å; A40-A44 WeakPolarHBondContact O-CB 3.27Å; A40-A44 PolarHBondContact O-N 3.35Å
41	L	85	Confident	85.6	Confident	48 Å²	48	75.2 Å²	75.2	25%	0.251	44%	0.441	S	S	.	.	H	α-helix	trans	-64.7	-42.3	176	179.7	64.6	0	0	0	112.2	G37 S38 M39 A44 K45 F73 P75	G37-L41 WeakPolarHBondContact O-CB 3.35Å; G37-L41 PolarHBondContact O-N 2.91Å; S38-L41 PolarHBondContact O-N 3.49Å; M39-L41 VanDerWaalsContact C-N 3.34Å; L41-A44 PolarHBondContact O-N 2.88Å; L41-K45 WeakPolarHBondContact O-CB 3.3Å; L41-K45 PolarHBondContact O-N 3.48Å; L41-F73 HydrophobicContact CD2-CD1 3.83Å; L41-P75 HydrophobicContact CD2-CG 3.89Å
42	E	85.6	Confident	85.1	Confident	140 Å²	140	73.3 Å²	73.3	65%	0.654	43%	0.432	S	S	*	.	H	α-helix	trans	-61.8	-45	177	-171.7	-177.8	175.7	0	0	111.4	S38 M39 K45 A46	S38-E42 PolarHBondContact O-N 3.16Å; M39-E42 PolarHBondContact O-N 3.42Å; E42-K45 WeakPolarHBondContact O-CB 3.47Å; E42-K45 PolarHBondContact O-N 2.91Å; E42-A46 PolarHBondContact O-N 2.89Å; E42-A46 VanDerWaalsContact O-N 3.08Å
43	K	87.4	Confident	84.9	Confident	147 Å²	147	76.9 Å²	76.9	64%	0.639	44%	0.436	S	S	*	.	H	α-helix	trans	-61.6	-44.8	174	-72.2	174.7	-178.7	177.5	0	111.9	M39 A40 K45 A46 V47	M39-K43 WeakPolarHBondContact O-CG 3.39Å; M39-K43 PolarHBondContact O-N 2.79Å; A40-K43 PolarHBondContact O-N 3.46Å; K43-K45 VanDerWaalsContact C-N 3.32Å; K43-K45 PolarHBondContact O-N 3.04Å; K43-A46 PolarHBondContact O-N 3.33Å; K43-A46 VanDerWaalsContact O-N 3.16Å; K43-V47 WeakPolarHBondContact O-CB 3.48Å; K43-V47 WeakPolarHBondContact O-CG2 3.36Å; K43-V47 PolarHBondContact O-N 3.46Å
44	A	85.4	Confident	84.7	Confident	42 Å²	42	81 Å²	81	35%	0.347	45%	0.45	S	S	.	.	H	α-helix	trans	-61.3	-42.4	177	0	0	0	0	0	111.3	A40 L41 A46 V47 V48	A40-A44 WeakPolarHBondContact O-CB 3.27Å; A40-A44 PolarHBondContact O-N 3.35Å; L41-A44 PolarHBondContact O-N 2.88Å; A44-A46 VanDerWaalsContact C-N 3.25Å; A44-A46 PolarHBondContact O-N 3.09Å; A44-V47 PolarHBondContact O-N 2.92Å; A44-V48 HydrophobicContact CB-CG2 4.19Å; A44-V48 WeakPolarHBondContact O-CB 3.35Å; A44-V48 WeakPolarHBondContact O-CG2 3.41Å; A44-V48 PolarHBondContact O-N 2.8Å
45	K	83.1	Confident	84.8	Confident	101 Å²	101	81.9 Å²	81.9	44%	0.439	44%	0.436	S	S	.	.	H	α-helix	trans	-60.8	-33.6	175.7	-177.1	178.1	174.3	167.4	0	112.6	L41 E42 K43 P49 I71	L41-K45 WeakPolarHBondContact O-CB 3.3Å; L41-K45 PolarHBondContact O-N 3.48Å; E42-K45 WeakPolarHBondContact O-CB 3.47Å; E42-K45 PolarHBondContact O-N 2.91Å; K43-K45 VanDerWaalsContact C-N 3.32Å; K43-K45 PolarHBondContact O-N 3.04Å; K45-P49 WeakPolarHBondContact O-CD 3.38Å; K45-P49 VanDerWaalsContact O-CG 3.26Å; K45-P49 WeakPolarHBondContact O-CG 3.24Å; K45-I71 WeakPolarHBondContact CD-O 3.38Å; K45-I71 WeakPolarHBondContact CE-O 3.21Å; K45-I71 PolarHBondContact NZ-O 3.13Å
46	A	84.6	Confident	84.7	Confident	68 Å²	68	76.6 Å²	76.6	56%	0.562	41%	0.412	S	S	*	.	H	α-helix	trans	-79.5	-37	178.2	0	0	0	0	0	113.3	E42 K43 A44 P50	E42-A46 PolarHBondContact O-N 2.89Å; E42-A46 VanDerWaalsContact O-N 3.08Å; K43-A46 PolarHBondContact O-N 3.33Å; K43-A46 VanDerWaalsContact O-N 3.16Å; A44-A46 VanDerWaalsContact C-N 3.25Å; A44-A46 PolarHBondContact O-N 3.09Å; A46-P50 VanDerWaalsContact O-CD 3.23Å; A46-P50 WeakPolarHBondContact O-CD 3.5Å; A46-P50 WeakPolarHBondContact O-CG 3.49Å
47	V	86.1	Confident	84.5	Confident	94 Å²	94	79.3 Å²	79.3	57%	0.57	42%	0.422	S	S	*	.	H	α-helix	trans	-99.7	-33.6	-168.7	179.4	0	0	0	0	113.4	K43 A44 P50 A51	K43-V47 WeakPolarHBondContact O-CB 3.48Å; K43-V47 WeakPolarHBondContact O-CG2 3.36Å; K43-V47 PolarHBondContact O-N 3.46Å; A44-V47 PolarHBondContact O-N 2.92Å; V47-P50 VanDerWaalsContact O-CD 3.31Å; V47-P50 WeakPolarHBondContact O-CD 3.4Å; V47-P50 WeakPolarHBondContact O-CG 3.33Å; V47-A51 VanDerWaalsContact O-CB 3.31Å; V47-A51 WeakPolarHBondContact O-CB 3.33Å; V47-A51 PolarHBondContact O-N 3.34Å
48	V	83.3	Confident	84.3	Confident	67 Å²	67	87.6 Å²	87.6	41%	0.406	45%	0.451	S	S	.	.	H	α-helix	trans	-65.3	-43	-177.5	173.9	0	0	0	0	112	A44 L52	A44-V48 HydrophobicContact CB-CG2 4.19Å; A44-V48 WeakPolarHBondContact O-CB 3.35Å; A44-V48 WeakPolarHBondContact O-CG2 3.41Å; A44-V48 PolarHBondContact O-N 2.8Å; V48-L52 HydrophobicContact CG1-CD1 3.68Å; V48-L52 HydrophobicContact CG1-CG 4.37Å; V48-L52 WeakPolarHBondContact O-CB 3.47Å; V48-L52 PolarHBondContact O-N 2.96Å
49	P	83.3	Confident	84.3	Confident	35 Å²	35	90.2 Å²	90.2	23%	0.227	46%	0.455	C	S	.	.	H	α-helix	trans	-58.5	-54.2	178.3	-24.6	35.2	0	0	0	115.8	K45 A51 L52 E53 M68	K45-P49 WeakPolarHBondContact O-CD 3.38Å; K45-P49 VanDerWaalsContact O-CG 3.26Å; K45-P49 WeakPolarHBondContact O-CG 3.24Å; P49-A51 PolarHBondContact O-N 2.86Å; P49-L52 PolarHBondContact O-N 3.46Å; P49-E53 WeakPolarHBondContact O-CG 3.27Å; P49-E53 PolarHBondContact O-N 3Å; P49-M68 WeakPolarHBondContact CA-SD 3.37Å; P49-M68 HydrophobicContact CB-CE 4.16Å; P49-M68 HydrophobicContact CB-SD 3.5Å; P49-M68 VanDerWaalsContact CB-SD 3.5Å; P49-M68 HydrophobicContact CG-SD 3.76Å; P49-M68 WeakPolarHBondContact O-CE 3.36Å
50	P	83.9	Confident	83.9	Confident	57 Å²	57	89 Å²	89	37%	0.37	47%	0.465	S	S	.	.	H	α-helix	trans	-65	-38.4	-179.9	24.7	-33.9	0	0	0	112.4	A46 V47 L52 E53 E54	A46-P50 VanDerWaalsContact O-CD 3.23Å; A46-P50 WeakPolarHBondContact O-CD 3.5Å; A46-P50 WeakPolarHBondContact O-CG 3.49Å; V47-P50 VanDerWaalsContact O-CD 3.31Å; V47-P50 WeakPolarHBondContact O-CD 3.4Å; V47-P50 WeakPolarHBondContact O-CG 3.33Å; P50-L52 VanDerWaalsContact C-N 3.31Å; P50-L52 PolarHBondContact O-N 2.94Å; P50-E53 PolarHBondContact O-N 3.48Å; P50-E54 WeakPolarHBondContact O-CG 3.31Å; P50-E54 PolarHBondContact O-N 2.93Å
51	A	84.6	Confident	83.4	Confident	52 Å²	52	90.4 Å²	90.4	43%	0.43	47%	0.47	S	S	.	.	H	α-helix	trans	-63	-38.3	179.2	0	0	0	0	0	112.4	V47 P49 W55	V47-A51 VanDerWaalsContact O-CB 3.31Å; V47-A51 WeakPolarHBondContact O-CB 3.33Å; V47-A51 PolarHBondContact O-N 3.34Å; P49-A51 PolarHBondContact O-N 2.86Å; A51-W55 WeakPolarHBondContact O-CB 3.39Å; A51-W55 PolarHBondContact O-N 3.36Å; A51-W55 VanDerWaalsContact O-N 3.1Å
52	L	80.1	Confident	82.6	Confident	74 Å²	74	94.4 Å²	94.4	39%	0.387	49%	0.487	S	S	.	.	H	α-helix	trans	-70.1	-39.3	174.7	-84.5	170.2	0	0	0	111.8	V48 P49 P50 W55 M56 M68	V48-L52 HydrophobicContact CG1-CD1 3.68Å; V48-L52 HydrophobicContact CG1-CG 4.37Å; V48-L52 WeakPolarHBondContact O-CB 3.47Å; V48-L52 PolarHBondContact O-N 2.96Å; P49-L52 PolarHBondContact O-N 3.46Å; P50-L52 VanDerWaalsContact C-N 3.31Å; P50-L52 PolarHBondContact O-N 2.94Å; L52-W55 PolarHBondContact O-N 3.13Å; L52-M56 HydrophobicContact CB-CE 4.36Å; L52-M56 WeakPolarHBondContact O-CB 3.32Å; L52-M56 WeakPolarHBondContact O-CE 3.22Å; L52-M56 WeakPolarHBondContact O-CG 3.3Å; L52-M56 PolarHBondContact O-N 3.38Å; L52-M68 HydrophobicContact CB-CE 3.48Å; L52-M68 VanDerWaalsContact CB-CE 3.48Å; L52-M68 HydrophobicContact CD1-CE 3.69Å; L52-M68 HydrophobicContact CD1-SD 4.26Å; L52-M68 HydrophobicContact CG-CE 4.24Å
53	E	81	Confident	81.6	Confident	118 Å²	118	92.7 Å²	92.7	55%	0.551	50%	0.497	S	S	*	.	H	α-helix	trans	-59.6	-46	175.3	-73.7	176.3	-175.8	0	0	112	P49 P50 W55 M56 K57	P49-E53 WeakPolarHBondContact O-CG 3.27Å; P49-E53 PolarHBondContact O-N 3Å; P50-E53 PolarHBondContact O-N 3.48Å; E53-W55 VanDerWaalsContact C-N 3.34Å; E53-W55 PolarHBondContact O-N 3.06Å; E53-M56 HydrophobicContact CB-CE 4.46Å; E53-M56 HydrophobicContact CG-CE 4.05Å; E53-M56 PolarHBondContact O-N 3.48Å; E53-K57 WeakPolarHBondContact O-CB 3.34Å; E53-K57 PolarHBondContact O-N 2.92Å
54	E	84.8	Confident	80.6	Confident	144 Å²	144	93.3 Å²	93.3	67%	0.673	50%	0.502	S	S	*	.	H	α-helix	trans	-61.2	-42.8	175.5	-71.7	179.9	179.4	0	0	112.1	P50 K57 Y58	P50-E54 WeakPolarHBondContact O-CG 3.31Å; P50-E54 PolarHBondContact O-N 2.93Å; E54-K57 PolarHBondContact O-N 3.32Å; E54-Y58 WeakPolarHBondContact O-CB 3.14Å; E54-Y58 PolarHBondContact O-N 2.95Å
55	W	84.3	Confident	79.6	Confident	128 Å²	128	95.2 Å²	95.2	49%	0.485	51%	0.506	S	S	.	.	H	α-helix	trans	-65.1	-44.6	177.3	-171.1	86.9	0	0	0	111.7	A51 L52 E53 K57 Y58 F59 L61	A51-W55 WeakPolarHBondContact O-CB 3.39Å; A51-W55 PolarHBondContact O-N 3.36Å; A51-W55 VanDerWaalsContact O-N 3.1Å; L52-W55 PolarHBondContact O-N 3.13Å; E53-W55 VanDerWaalsContact C-N 3.34Å; E53-W55 PolarHBondContact O-N 3.06Å; W55-K57 VanDerWaalsContact C-N 3.3Å; W55-K57 PolarHBondContact O-N 3.4Å; W55-Y58 PolarHBondContact O-N 3.39Å; W55-F59 AromaticContact CD1-CD2 3.81Å; W55-F59 AromaticContact CD1-CE2 3.52Å; W55-F59 AromaticContact CD2-CD2 3.68Å; W55-F59 HydrophobicContact CD2-CD2 3.68Å; W55-F59 HydrophobicContact CD2-CE2 4.09Å; W55-F59 AromaticContact CE2-CD2 3.37Å; W55-F59 AromaticContact CE2-CE2 3.43Å; W55-F59 VanDerWaalsContact CE2-CE2 3.43Å; W55-F59 HydrophobicContact CE3-CD2 4.34Å; W55-F59 AromaticContact CG-CD2 3.95Å; W55-F59 HydrophobicContact CG-CD2 3.95Å; W55-F59 HydrophobicContact CG-CE2 4.13Å; W55-F59 HydrophobicContact CH2-CD2 4.41Å; W55-F59 AromaticContact CZ2-CD2 3.77Å; W55-F59 HydrophobicContact CZ2-CD2 3.77Å; W55-F59 AromaticContact CZ2-CE2 3.91Å; W55-F59 HydrophobicContact CZ2-CE2 3.91Å; W55-F59 HydrophobicContact CZ2-CG 4.4Å; W55-F59 AromaticContact NE1-CD2 3.49Å; W55-F59 AromaticContact NE1-CE2 3.06Å; W55-F59 VanDerWaalsContact O-CD2 3.3Å; W55-F59 WeakPolarHBondContact O-CD2 3.27Å; W55-F59 PolarHBondContact O-N 3.48Å; W55-L61 HydrophobicContact CE3-CD1 4.45Å; W55-L61 HydrophobicContact CH2-CD1 3.87Å; W55-L61 HydrophobicContact CZ3-CD1 3.6Å
56	M	82.4	Confident	78.8	Confident	29 Å²	29	95.8 Å²	95.8	14%	0.143	52%	0.52	C	S	.	.	H	α-helix	trans	-60	-41.8	176.6	-75	-174.9	-67.9	0	0	111.6	L52 E53 F59 G60 L61 L65 M68	L52-M56 HydrophobicContact CB-CE 4.36Å; L52-M56 WeakPolarHBondContact O-CB 3.32Å; L52-M56 WeakPolarHBondContact O-CE 3.22Å; L52-M56 WeakPolarHBondContact O-CG 3.3Å; L52-M56 PolarHBondContact O-N 3.38Å; E53-M56 HydrophobicContact CB-CE 4.46Å; E53-M56 HydrophobicContact CG-CE 4.05Å; E53-M56 PolarHBondContact O-N 3.48Å; M56-F59 PolarHBondContact O-N 2.82Å; M56-G60 PolarHBondContact O-N 3.39Å; M56-L61 PolarHBondContact O-N 2.97Å; M56-L65 HydrophobicContact CG-CD1 3.78Å; M56-L65 HydrophobicContact SD-CB 3.95Å; M56-L65 HydrophobicContact SD-CD1 3.69Å; M56-L65 HydrophobicContact SD-CG 4.48Å; M56-M68 HydrophobicContact CE-CE 4.28Å
57	K	82.9	Confident	78	Confident	155 Å²	155	99.2 Å²	99.2	67%	0.674	53%	0.534	S	S	*	.	H	α-helix	trans	-63.4	-44.7	174.9	-177.3	174.9	-179.7	178.1	0	112.1	E53 E54 W55 F59 G60 E62	E53-K57 WeakPolarHBondContact O-CB 3.34Å; E53-K57 PolarHBondContact O-N 2.92Å; E54-K57 PolarHBondContact O-N 3.32Å; W55-K57 VanDerWaalsContact C-N 3.3Å; W55-K57 PolarHBondContact O-N 3.4Å; K57-F59 VanDerWaalsContact C-N 3.33Å; K57-F59 PolarHBondContact O-N 2.86Å; K57-G60 PolarHBondContact O-N 3.31Å; K57-E62 WeakPolarHBondContact CA-OE1 3.35Å; K57-E62 WeakPolarHBondContact CB-OE1 3.36Å; K57-E62 WeakPolarHBondContact CG-OE1 3.41Å
58	Y	82.9	Confident	77	Confident	187 Å²	187	97.1 Å²	97.1	73%	0.733	52%	0.519	S	S	*	.	H	α-helix	trans	-61.8	-40.3	178.8	-178.6	-91.2	0	0	0	112.4	E54 W55	E54-Y58 WeakPolarHBondContact O-CB 3.14Å; E54-Y58 PolarHBondContact O-N 2.95Å; W55-Y58 PolarHBondContact O-N 3.39Å
59	F	83.8	Confident	76	Confident	109 Å²	109	98.8 Å²	98.8	48%	0.478	53%	0.531	S	S	.	.	H	α-helix	trans	-90.4	0.6	-179.3	-73.2	-76.3	0	0	0	114.1	W55 M56 K57 L61	W55-F59 AromaticContact CD1-CD2 3.81Å; W55-F59 AromaticContact CD1-CE2 3.52Å; W55-F59 AromaticContact CD2-CD2 3.68Å; W55-F59 HydrophobicContact CD2-CD2 3.68Å; W55-F59 HydrophobicContact CD2-CE2 4.09Å; W55-F59 AromaticContact CE2-CD2 3.37Å; W55-F59 AromaticContact CE2-CE2 3.43Å; W55-F59 VanDerWaalsContact CE2-CE2 3.43Å; W55-F59 HydrophobicContact CE3-CD2 4.34Å; W55-F59 AromaticContact CG-CD2 3.95Å; W55-F59 HydrophobicContact CG-CD2 3.95Å; W55-F59 HydrophobicContact CG-CE2 4.13Å; W55-F59 HydrophobicContact CH2-CD2 4.41Å; W55-F59 AromaticContact CZ2-CD2 3.77Å; W55-F59 HydrophobicContact CZ2-CD2 3.77Å; W55-F59 AromaticContact CZ2-CE2 3.91Å; W55-F59 HydrophobicContact CZ2-CE2 3.91Å; W55-F59 HydrophobicContact CZ2-CG 4.4Å; W55-F59 AromaticContact NE1-CD2 3.49Å; W55-F59 AromaticContact NE1-CE2 3.06Å; W55-F59 VanDerWaalsContact O-CD2 3.3Å; W55-F59 WeakPolarHBondContact O-CD2 3.27Å; W55-F59 PolarHBondContact O-N 3.48Å; M56-F59 PolarHBondContact O-N 2.82Å; K57-F59 VanDerWaalsContact C-N 3.33Å; K57-F59 PolarHBondContact O-N 2.86Å; F59-L61 HydrophobicContact CB-CD1 3.72Å; F59-L61 HydrophobicContact CB-CG 3.91Å; F59-L61 PolarHBondContact O-N 3.34Å
60	G	80.4	Confident	75.2	Confident	60 Å²	60	105.8 Å²	105.8	62%	0.619	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	64.2	25.4	-178.9	0	0	0	0	0	113.9	M56 K57 E62	M56-G60 PolarHBondContact O-N 3.39Å; K57-G60 PolarHBondContact O-N 3.31Å; G60-E62 VanDerWaalsContact C-N 3.33Å
61	L	76.3	Confident	74.4	Confident	43 Å²	43	107 Å²	107	23%	0.225	56%	0.56	C	S	.	*			trans	-90.5	6	-174.5	-68.3	169.9	0	0	0	113.5	W55 M56 F59 A63 Q64 L65	W55-L61 HydrophobicContact CE3-CD1 4.45Å; W55-L61 HydrophobicContact CH2-CD1 3.87Å; W55-L61 HydrophobicContact CZ3-CD1 3.6Å; M56-L61 PolarHBondContact O-N 2.97Å; F59-L61 HydrophobicContact CB-CD1 3.72Å; F59-L61 HydrophobicContact CB-CG 3.91Å; F59-L61 PolarHBondContact O-N 3.34Å; L61-A63 PolarHBondContact O-N 2.99Å; L61-Q64 PolarHBondContact O-N 3.48Å; L61-L65 HydrophobicContact CB-CD1 4.19Å; L61-L65 PolarHBondContact O-N 3.21Å
62	E	68.6	Low	73.8	Confident	132 Å²	132	112.1 Å²	112.1	62%	0.617	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.1	-29.3	-176.2	-64.2	-178.5	173	0	0	113.7	K57 G60	K57-E62 WeakPolarHBondContact CA-OE1 3.35Å; K57-E62 WeakPolarHBondContact CB-OE1 3.36Å; K57-E62 WeakPolarHBondContact CG-OE1 3.41Å; G60-E62 VanDerWaalsContact C-N 3.33Å
63	A	65.3	Low	73.5	Confident	104 Å²	104	113.8 Å²	113.8	86%	0.86	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.8	-11.4	-179.5	0	0	0	0	0	114.8	L61	L61-A63 PolarHBondContact O-N 2.99Å
64	Q	65.8	Low	73.5	Confident	160 Å²	160	110.1 Å²	110.1	75%	0.748	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.9	-22.7	-174.5	-74.5	-176.4	28.2	0	0	113.9	L61	L61-Q64 PolarHBondContact O-N 3.48Å
65	L	65	Low	73.3	Confident	83 Å²	83	105.4 Å²	105.4	44%	0.435	55%	0.549	S	S	.	.	S	Bend	trans	-97.9	133.9	-179.1	-75	164.5	0	0	0	110.7	M56 L61	M56-L65 HydrophobicContact CG-CD1 3.78Å; M56-L65 HydrophobicContact SD-CB 3.95Å; M56-L65 HydrophobicContact SD-CD1 3.69Å; M56-L65 HydrophobicContact SD-CG 4.48Å; L61-L65 HydrophobicContact CB-CD1 4.19Å; L61-L65 PolarHBondContact O-N 3.21Å
66	P	66.3	Low	73.3	Confident	112 Å²	112	103.6 Å²	103.6	73%	0.727	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-61.2	147.4	175.8	25.9	-32.8	0	0	0	110.3	M68	P66-M68 PolarHBondContact O-N 3Å
67	T	67.3	Low	73.5	Confident	141 Å²	141	107.3 Å²	107.3	87%	0.865	57%	0.572	S	S	*	*	P	Polyproline II helix	trans	-47.2	129.6	174.6	-54.9	0	0	0	0	109.8
68	M	64.3	Low	73.7	Confident	50 Å²	50	102.6 Å²	102.6	25%	0.246	56%	0.559	C	S	.	*	P	Polyproline II helix	trans	-56.3	129.3	-173.5	-167.2	178.7	-52.9	0	0	110.9	P49 L52 M56 P66 K70	P49-M68 WeakPolarHBondContact CA-SD 3.37Å; P49-M68 HydrophobicContact CB-CE 4.16Å; P49-M68 HydrophobicContact CB-SD 3.5Å; P49-M68 VanDerWaalsContact CB-SD 3.5Å; P49-M68 HydrophobicContact CG-SD 3.76Å; P49-M68 WeakPolarHBondContact O-CE 3.36Å; L52-M68 HydrophobicContact CB-CE 3.48Å; L52-M68 VanDerWaalsContact CB-CE 3.48Å; L52-M68 HydrophobicContact CD1-CE 3.69Å; L52-M68 HydrophobicContact CD1-SD 4.26Å; L52-M68 HydrophobicContact CG-CE 4.24Å; M56-M68 HydrophobicContact CE-CE 4.28Å; P66-M68 PolarHBondContact O-N 3Å; M68-K70 PolarHBondContact O-N 2.91Å
69	P	63	Low	73.9	Confident	102 Å²	102	102.6 Å²	102.6	66%	0.662	56%	0.558	S	S	*	*	P	Polyproline II helix	trans	-64	127.4	177.9	25.1	-32.1	0	0	0	109	I71	P69-I71 PolarHBondContact O-N 3.05Å
70	K	66.9	Low	74.3	Confident	182 Å²	182	100.3 Å²	100.3	79%	0.791	55%	0.551	S	S	*	*			trans	-63.8	111.7	169.8	-68	-178.1	-179.3	179.6	0	107.8	M68 E72	M68-K70 PolarHBondContact O-N 2.91Å; K70-E72 VanDerWaalsContact C-N 3.28Å; K70-E72 HydrophobicContact CB-CG 4.35Å; K70-E72 PolarHBondContact O-N 2.85Å
71	I	65.8	Low	74.9	Confident	81 Å²	81	100 Å²	100	42%	0.415	54%	0.542	S	S	.	.			trans	-75.6	86.3	177.8	-55	174.7	0	0	0	107.8	K45 P69 F73	K45-I71 WeakPolarHBondContact CD-O 3.38Å; K45-I71 WeakPolarHBondContact CE-O 3.21Å; K45-I71 PolarHBondContact NZ-O 3.13Å; P69-I71 PolarHBondContact O-N 3.05Å; I71-F73 VanDerWaalsContact C-N 3.25Å; I71-F73 HydrophobicContact CG2-CB 4.13Å; I71-F73 PolarHBondContact O-N 3.21Å
72	E	72	Confident	75.6	Confident	160 Å²	160	99.6 Å²	99.6	75%	0.748	55%	0.548	S	S	*	.			trans	-94.2	46.5	173.2	-66.3	-173.3	-176.6	0	0	111	K70	K70-E72 VanDerWaalsContact C-N 3.28Å; K70-E72 HydrophobicContact CB-CG 4.35Å; K70-E72 PolarHBondContact O-N 2.85Å
73	F	75.1	Confident	76.9	Confident	109 Å²	109	96.1 Å²	96.1	48%	0.478	54%	0.536	S	S	.	.			trans	-86.5	125.1	175.9	-173.3	-104.4	0	0	0	110.3	L41 I71 P75 S78	L41-F73 HydrophobicContact CD2-CD1 3.83Å; I71-F73 VanDerWaalsContact C-N 3.25Å; I71-F73 HydrophobicContact CG2-CB 4.13Å; I71-F73 PolarHBondContact O-N 3.21Å; F73-P75 HydrophobicContact CD1-CG 3.93Å; F73-P75 HydrophobicContact CE1-CB 3.95Å; F73-P75 HydrophobicContact CE1-CG 3.75Å; F73-S78 WeakPolarHBondContact CE2-OG 3.06Å
74	S	81	Confident	78.3	Confident	41 Å²	41	99.5 Å²	99.5	29%	0.287	53%	0.527	S	S	.	.			trans	-111	107.1	168	167.7	0	0	0	0	108.4	V76 N77 S78	S74-V76 PolarHBondContact O-N 2.85Å; S74-N77 PolarHBondContact O-N 3.16Å; S74-N77 VanDerWaalsContact O-N 3.14Å; S74-N77 PolarHBondContact OG-N 3.44Å; S74-N77 PolarHBondContact OG-ND2 2.91Å; S74-S78 PolarHBondContact O-N 3.43Å; S74-S78 PolarHBondContact O-OG 3.45Å
75	P	80.4	Confident	79.7	Confident	45 Å²	45	100.5 Å²	100.5	29%	0.292	52%	0.523	S	S	.	.	H	α-helix	trans	-53.1	-42	-178.2	-25.7	31.9	0	0	0	112.9	L41 F73 W79	L41-P75 HydrophobicContact CD2-CG 3.89Å; F73-P75 HydrophobicContact CD1-CG 3.93Å; F73-P75 HydrophobicContact CE1-CB 3.95Å; F73-P75 HydrophobicContact CE1-CG 3.75Å; P75-W79 WeakPolarHBondContact O-CB 3.36Å; P75-W79 PolarHBondContact O-N 3.38Å
76	V	83.8	Confident	81.2	Confident	91 Å²	91	99.5 Å²	99.5	55%	0.552	52%	0.521	S	S	*	.	H	α-helix	trans	-66.8	-44.4	-179.3	177.9	0	0	0	0	111.5	S74 W79 N80	S74-V76 PolarHBondContact O-N 2.85Å; V76-W79 PolarHBondContact O-N 3.49Å; V76-N80 WeakPolarHBondContact O-CB 3.37Å; V76-N80 VanDerWaalsContact O-CG 3.23Å; V76-N80 PolarHBondContact O-N 3.44Å; V76-N80 PolarHBondContact O-ND2 3.06Å
77	N	86.4	Confident	82.6	Confident	106 Å²	106	99.4 Å²	99.4	57%	0.567	51%	0.513	S	S	*	.	H	α-helix	trans	-66.8	-43	-179.8	-70.7	-17.1	0	0	0	111.2	S74 N80 A81	S74-N77 PolarHBondContact O-N 3.16Å; S74-N77 VanDerWaalsContact O-N 3.14Å; S74-N77 PolarHBondContact OG-N 3.44Å; S74-N77 PolarHBondContact OG-ND2 2.91Å; N77-N80 PolarHBondContact O-N 3.29Å; N77-A81 VanDerWaalsContact O-CB 3.27Å; N77-A81 WeakPolarHBondContact O-CB 3.46Å; N77-A81 PolarHBondContact O-N 3.12Å
78	S	86.9	Confident	83.9	Confident	56 Å²	56	95.6 Å²	95.6	39%	0.392	49%	0.492	S	S	.	.	H	α-helix	trans	-63.8	-42.7	177.3	-63.8	0	0	0	0	112	F73 S74 A81 G82	F73-S78 WeakPolarHBondContact CE2-OG 3.06Å; S74-S78 PolarHBondContact O-N 3.43Å; S74-S78 PolarHBondContact O-OG 3.45Å; S78-A81 PolarHBondContact O-N 3.2Å; S78-G82 PolarHBondContact O-N 2.94Å
79	W	87.6	Confident	85.3	Confident	187 Å²	187	95.4 Å²	95.4	71%	0.708	50%	0.496	S	S	*	.	H	α-helix	trans	-60.7	-51	174.5	-179.5	-103.1	0	0	0	112	P75 V76 A81 G82 V83	P75-W79 WeakPolarHBondContact O-CB 3.36Å; P75-W79 PolarHBondContact O-N 3.38Å; V76-W79 PolarHBondContact O-N 3.49Å; W79-A81 VanDerWaalsContact C-N 3.3Å; W79-A81 PolarHBondContact O-N 3.39Å; W79-G82 PolarHBondContact O-N 3.11Å; W79-G82 VanDerWaalsContact O-N 3.13Å; W79-V83 HydrophobicContact CD2-CG2 4.5Å; W79-V83 HydrophobicContact CZ2-CG2 4.32Å; W79-V83 WeakPolarHBondContact O-CG2 3.3Å; W79-V83 PolarHBondContact O-N 3.28Å
80	N	91.6	Very high	86.9	Confident	62 Å²	62	96 Å²	96	33%	0.332	49%	0.493	S	S	.	.	H	α-helix	trans	-62.9	-36.5	179.9	-73.4	-23.4	0	0	0	112.4	V76 N77 R84	V76-N80 WeakPolarHBondContact O-CB 3.37Å; V76-N80 VanDerWaalsContact O-CG 3.23Å; V76-N80 PolarHBondContact O-N 3.44Å; V76-N80 PolarHBondContact O-ND2 3.06Å; N77-N80 PolarHBondContact O-N 3.29Å; N80-R84 WeakPolarHBondContact O-CB 3.34Å; N80-R84 VanDerWaalsContact O-CG 3.3Å; N80-R84 WeakPolarHBondContact O-CG 3.39Å; N80-R84 PolarHBondContact O-N 2.95Å
81	A	92.9	Very high	88.2	Confident	54 Å²	54	91.7 Å²	91.7	45%	0.446	49%	0.486	S	S	.	.	H	α-helix	trans	-64.1	-43.8	174	0	0	0	0	0	111.3	N77 S78 W79 R84 W85	N77-A81 VanDerWaalsContact O-CB 3.27Å; N77-A81 WeakPolarHBondContact O-CB 3.46Å; N77-A81 PolarHBondContact O-N 3.12Å; S78-A81 PolarHBondContact O-N 3.2Å; W79-A81 VanDerWaalsContact C-N 3.3Å; W79-A81 PolarHBondContact O-N 3.39Å; A81-R84 PolarHBondContact O-N 3Å; A81-W85 WeakPolarHBondContact O-CB 3.5Å; A81-W85 PolarHBondContact O-N 2.86Å
82	G	92.7	Very high	89.6	Confident	34 Å²	34	92.5 Å²	92.5	35%	0.351	49%	0.488	S	S	.	.	H	α-helix	trans	-59.4	-50.4	175.6	0	0	0	0	0	112.3	S78 W79 R84 W85 T86	S78-G82 PolarHBondContact O-N 2.94Å; W79-G82 PolarHBondContact O-N 3.11Å; W79-G82 VanDerWaalsContact O-N 3.13Å; G82-R84 VanDerWaalsContact C-N 3.35Å; G82-R84 PolarHBondContact O-N 3.44Å; G82-W85 PolarHBondContact O-N 3.43Å; G82-T86 PolarHBondContact O-N 3.38Å; G82-T86 PolarHBondContact O-OG1 3.32Å; G82-T86 VanDerWaalsContact O-OG1 3.09Å
83	V	95.9	Very high	90.7	Very high	58 Å²	58	86.9 Å²	86.9	35%	0.352	47%	0.469	S	S	.	.	H	α-helix	trans	-57.2	-47.5	177.5	172.2	0	0	0	0	111.3	W79 W85 T86 I87	W79-V83 HydrophobicContact CD2-CG2 4.5Å; W79-V83 HydrophobicContact CZ2-CG2 4.32Å; W79-V83 WeakPolarHBondContact O-CG2 3.3Å; W79-V83 PolarHBondContact O-N 3.28Å; V83-W85 PolarHBondContact O-N 3.47Å; V83-T86 PolarHBondContact O-N 2.71Å; V83-I87 HydrophobicContact CG1-CD1 3.74Å; V83-I87 WeakPolarHBondContact O-CG1 3.35Å; V83-I87 PolarHBondContact O-N 2.94Å
84	R	94.1	Very high	91.5	Very high	176 Å²	176	85.7 Å²	85.7	66%	0.664	47%	0.472	S	S	*	.	H	α-helix	trans	-60.9	-45.3	177.8	-75	179.9	-175.9	113.9	-0.1	111.9	N80 A81 G82 I87 S88	N80-R84 WeakPolarHBondContact O-CB 3.34Å; N80-R84 VanDerWaalsContact O-CG 3.3Å; N80-R84 WeakPolarHBondContact O-CG 3.39Å; N80-R84 PolarHBondContact O-N 2.95Å; A81-R84 PolarHBondContact O-N 3Å; G82-R84 VanDerWaalsContact C-N 3.35Å; G82-R84 PolarHBondContact O-N 3.44Å; R84-I87 PolarHBondContact O-N 2.9Å; R84-S88 VanDerWaalsContact O-CB 3.3Å; R84-S88 WeakPolarHBondContact O-CB 3.23Å; R84-S88 PolarHBondContact O-N 3.45Å
85	W	95.9	Very high	92.2	Very high	180 Å²	180	88.5 Å²	88.5	68%	0.682	49%	0.488	S	S	*	.	H	α-helix	trans	-61.7	-44.6	179.1	177.3	82.4	0	0	0	111.9	A81 G82 V83 S88 S89	A81-W85 WeakPolarHBondContact O-CB 3.5Å; A81-W85 PolarHBondContact O-N 2.86Å; G82-W85 PolarHBondContact O-N 3.43Å; V83-W85 PolarHBondContact O-N 3.47Å; W85-S88 PolarHBondContact O-N 3.37Å; W85-S89 VanDerWaalsContact O-CB 3.27Å; W85-S89 WeakPolarHBondContact O-CB 3.16Å; W85-S89 PolarHBondContact O-N 3.24Å; W85-S89 PolarHBondContact O-OG 2.84Å
86	T	95.9	Very high	92.8	Very high	63 Å²	63	91.8 Å²	91.8	39%	0.387	49%	0.494	S	S	.	.	H	α-helix	trans	-63.2	-48	178.5	-59.9	0	0	0	0	111.5	G82 V83 S88 S89 L90	G82-T86 PolarHBondContact O-N 3.38Å; G82-T86 PolarHBondContact O-OG1 3.32Å; G82-T86 VanDerWaalsContact O-OG1 3.09Å; V83-T86 PolarHBondContact O-N 2.71Å; T86-S88 PolarHBondContact O-N 2.9Å; T86-S89 PolarHBondContact O-N 3.4Å; T86-L90 HydrophobicContact CG2-CD1 3.83Å; T86-L90 HydrophobicContact CG2-CG 4.34Å; T86-L90 WeakPolarHBondContact O-CB 3.26Å; T86-L90 VanDerWaalsContact O-CG 3.29Å; T86-L90 WeakPolarHBondContact O-CG 3.31Å; T86-L90 PolarHBondContact O-N 2.96Å
87	I	95.9	Very high	93.3	Very high	110 Å²	110	90 Å²	90	56%	0.564	49%	0.489	S	S	*	.	H	α-helix	trans	-63.4	-43.9	179.3	-67.1	171	0	0	0	110.7	V83 R84 S89 L90 S91	V83-I87 HydrophobicContact CG1-CD1 3.74Å; V83-I87 WeakPolarHBondContact O-CG1 3.35Å; V83-I87 PolarHBondContact O-N 2.94Å; R84-I87 PolarHBondContact O-N 2.9Å; I87-S89 PolarHBondContact O-N 3.48Å; I87-L90 PolarHBondContact O-N 2.88Å; I87-S91 WeakPolarHBondContact O-CB 3.36Å; I87-S91 PolarHBondContact O-N 2.96Å
88	S	94.1	Very high	93.7	Very high	61 Å²	61	88.9 Å²	88.9	43%	0.427	49%	0.486	S	S	.	.	H	α-helix	trans	-60	-47.5	177.1	-164.8	0	0	0	0	111.1	R84 W85 T86 L90 S91 E92	R84-S88 VanDerWaalsContact O-CB 3.3Å; R84-S88 WeakPolarHBondContact O-CB 3.23Å; R84-S88 PolarHBondContact O-N 3.45Å; W85-S88 PolarHBondContact O-N 3.37Å; T86-S88 PolarHBondContact O-N 2.9Å; S88-L90 PolarHBondContact O-N 3.3Å; S88-S91 WeakPolarHBondContact O-CB 3.31Å; S88-S91 PolarHBondContact O-N 3.36Å; S88-E92 PolarHBondContact O-N 3.14Å; S88-E92 VanDerWaalsContact O-N 3.1Å
89	S	93.9	Very high	94.1	Very high	45 Å²	45	90 Å²	90	32%	0.315	49%	0.485	S	S	.	.	H	α-helix	trans	-65.3	-41.6	-178.7	-60.5	0	0	0	0	111.8	W85 T86 I87 S91 E92 A93	W85-S89 VanDerWaalsContact O-CB 3.27Å; W85-S89 WeakPolarHBondContact O-CB 3.16Å; W85-S89 PolarHBondContact O-N 3.24Å; W85-S89 PolarHBondContact O-OG 2.84Å; T86-S89 PolarHBondContact O-N 3.4Å; I87-S89 PolarHBondContact O-N 3.48Å; S89-S91 VanDerWaalsContact C-N 3.33Å; S89-E92 PolarHBondContact O-N 3.21Å; S89-A93 PolarHBondContact O-N 3.29Å
90	L	95.3	Very high	94.4	Very high	116 Å²	116	87.9 Å²	87.9	61%	0.607	48%	0.478	S	S	*	.	H	α-helix	trans	-68.2	-32.4	175.8	-72.3	175.6	0	0	0	112.5	T86 I87 S88 E92 A93 P94	T86-L90 HydrophobicContact CG2-CD1 3.83Å; T86-L90 HydrophobicContact CG2-CG 4.34Å; T86-L90 WeakPolarHBondContact O-CB 3.26Å; T86-L90 VanDerWaalsContact O-CG 3.29Å; T86-L90 WeakPolarHBondContact O-CG 3.31Å; T86-L90 PolarHBondContact O-N 2.96Å; I87-L90 PolarHBondContact O-N 2.88Å; S88-L90 PolarHBondContact O-N 3.3Å; L90-E92 VanDerWaalsContact C-N 3.31Å; L90-A93 WeakPolarHBondContact O-CB 3.14Å; L90-A93 PolarHBondContact O-N 3.39Å; L90-P94 WeakPolarHBondContact O-CD 3.5Å
91	S	95.8	Very high	94.6	Very high	91 Å²	91	89 Å²	89	64%	0.636	49%	0.487	S	S	*	.	H	α-helix	trans	-67.1	-33.6	174.2	-175	0	0	0	0	112.2	I87 S88 S89	I87-S91 WeakPolarHBondContact O-CB 3.36Å; I87-S91 PolarHBondContact O-N 2.96Å; S88-S91 WeakPolarHBondContact O-CB 3.31Å; S88-S91 PolarHBondContact O-N 3.36Å; S89-S91 VanDerWaalsContact C-N 3.33Å
92	E	95.2	Very high	94.7	Very high	97 Å²	97	90.6 Å²	90.6	45%	0.453	49%	0.488	S	S	.	.	H	α-helix	trans	-83	-19.8	177.4	-70	177.8	-153.9	0	0	112.9	S88 S89 L90 T95 R96	S88-E92 PolarHBondContact O-N 3.14Å; S88-E92 VanDerWaalsContact O-N 3.1Å; S89-E92 PolarHBondContact O-N 3.21Å; L90-E92 VanDerWaalsContact C-N 3.31Å; E92-T95 PolarHBondContact O-N 3.06Å; E92-T95 VanDerWaalsContact O-N 3.17Å; E92-R96 WeakPolarHBondContact O-CG 3.41Å; E92-R96 PolarHBondContact O-N 3Å
93	A	93.9	Very high	94.9	Very high	43 Å²	43	93.6 Å²	93.6	36%	0.355	49%	0.493	S	S	.	.	H	α-helix	trans	-55.3	-42.4	-174	0	0	0	0	0	114.6	S89 L90 T95 R96 A97	S89-A93 PolarHBondContact O-N 3.29Å; L90-A93 WeakPolarHBondContact O-CB 3.14Å; L90-A93 PolarHBondContact O-N 3.39Å; A93-T95 PolarHBondContact O-N 3.3Å; A93-R96 PolarHBondContact O-N 3.4Å; A93-A97 VanDerWaalsContact O-CB 3.3Å; A93-A97 WeakPolarHBondContact O-CB 3.49Å; A93-A97 PolarHBondContact O-N 2.85Å
94	P	93	Very high	94.8	Very high	83 Å²	83	92.5 Å²	92.5	54%	0.539	49%	0.494	S	S	.	.	H	α-helix	trans	-63.1	-41	178.1	-23.1	34.2	0	0	0	113	L90 A97 T98	L90-P94 WeakPolarHBondContact O-CD 3.5Å; P94-A97 PolarHBondContact O-N 3.43Å; P94-T98 PolarHBondContact O-N 3.2Å; P94-T98 VanDerWaalsContact O-N 3.07Å; P94-T98 PolarHBondContact O-OG1 2.9Å
95	T	94.2	Very high	94.9	Very high	101 Å²	101	89.7 Å²	89.7	62%	0.62	49%	0.491	S	S	*	.	H	α-helix	trans	-65.3	-45.9	177.5	-52.5	0	0	0	0	110.3	E92 A93 T98 E99	E92-T95 PolarHBondContact O-N 3.06Å; E92-T95 VanDerWaalsContact O-N 3.17Å; A93-T95 PolarHBondContact O-N 3.3Å; T95-T98 PolarHBondContact O-N 3.4Å; T95-E99 WeakPolarHBondContact O-CB 3.43Å; T95-E99 PolarHBondContact O-N 3.26Å
96	R	93.3	Very high	94.9	Very high	114 Å²	114	87.2 Å²	87.2	43%	0.43	49%	0.487	S	S	.	.	H	α-helix	trans	-63.2	-41.3	176.7	-66.7	-60.8	-172.6	175.8	5	112.9	E92 A93 T98 E99 Y100	E92-R96 WeakPolarHBondContact O-CG 3.41Å; E92-R96 PolarHBondContact O-N 3Å; A93-R96 PolarHBondContact O-N 3.4Å; R96-T98 VanDerWaalsContact C-N 3.31Å; R96-T98 PolarHBondContact O-N 2.92Å; R96-E99 IonicContact CZ-OE2 3.95Å; R96-E99 IonicContact NH1-OE2 3Å; R96-E99 PolarHBondContact NH1-OE2 3.06Å; R96-E99 PolarHBondContact O-N 3.25Å; R96-Y100 HydrophobicContact CB-CE2 4.26Å; R96-Y100 VanDerWaalsContact O-CD2 3.23Å; R96-Y100 WeakPolarHBondContact O-CD2 3.47Å; R96-Y100 PolarHBondContact O-N 3Å
97	A	94.5	Very high	94.8	Very high	53 Å²	53	91.4 Å²	91.4	44%	0.438	50%	0.497	S	S	.	.	H	α-helix	trans	-61.8	-41	176.6	0	0	0	0	0	111.6	A93 P94 T101	A93-A97 VanDerWaalsContact O-CB 3.3Å; A93-A97 WeakPolarHBondContact O-CB 3.49Å; A93-A97 PolarHBondContact O-N 2.85Å; P94-A97 PolarHBondContact O-N 3.43Å; A97-T101 WeakPolarHBondContact O-CB 3.49Å; A97-T101 PolarHBondContact O-N 3.47Å; A97-T101 PolarHBondContact O-OG1 2.96Å
98	T	94.1	Very high	94.8	Very high	83 Å²	83	90.4 Å²	90.4	51%	0.509	50%	0.496	S	S	.	.	H	α-helix	trans	-65.4	-44.3	175.7	-56	0	0	0	0	111.2	P94 T95 R96 T101 N102	P94-T98 PolarHBondContact O-N 3.2Å; P94-T98 VanDerWaalsContact O-N 3.07Å; P94-T98 PolarHBondContact O-OG1 2.9Å; T95-T98 PolarHBondContact O-N 3.4Å; R96-T98 VanDerWaalsContact C-N 3.31Å; R96-T98 PolarHBondContact O-N 2.92Å; T98-T101 PolarHBondContact O-N 2.98Å; T98-N102 WeakPolarHBondContact O-CB 3.2Å; T98-N102 PolarHBondContact O-N 3.34Å; T98-N102 PolarHBondContact O-ND2 2.87Å
99	E	96.1	Very high	94.8	Very high	78 Å²	78	93.9 Å²	93.9	36%	0.364	50%	0.503	S	S	.	.	H	α-helix	trans	-58.3	-49.6	177.1	-172.3	173.9	-159.7	0	0	111.5	T95 R96 T101 N102 Q103	T95-E99 WeakPolarHBondContact O-CB 3.43Å; T95-E99 PolarHBondContact O-N 3.26Å; R96-E99 IonicContact CZ-OE2 3.95Å; R96-E99 IonicContact NH1-OE2 3Å; R96-E99 PolarHBondContact NH1-OE2 3.06Å; R96-E99 PolarHBondContact O-N 3.25Å; E99-T101 PolarHBondContact O-N 3.34Å; E99-N102 PolarHBondContact O-N 3.33Å; E99-Q103 WeakPolarHBondContact O-CG 3.35Å; E99-Q103 PolarHBondContact O-N 3.02Å
100	Y	94.8	Very high	94.9	Very high	143 Å²	143	96.7 Å²	96.7	56%	0.561	52%	0.515	S	S	*	.	H	α-helix	trans	-66.2	-36.1	177.6	-64.4	-36.4	0	0	0	113.2	R96 Q103 G104	R96-Y100 HydrophobicContact CB-CE2 4.26Å; R96-Y100 VanDerWaalsContact O-CD2 3.23Å; R96-Y100 WeakPolarHBondContact O-CD2 3.47Å; R96-Y100 PolarHBondContact O-N 3Å; Y100-Q103 PolarHBondContact O-N 3.38Å; Y100-G104 PolarHBondContact O-N 3.16Å
101	T	95.1	Very high	94.8	Very high	86 Å²	86	96.4 Å²	96.4	53%	0.528	51%	0.513	S	S	.	.	H	α-helix	trans	-63	-44.9	175.2	-60	0	0	0	0	110.8	A97 T98 E99 G104 L105	A97-T101 WeakPolarHBondContact O-CB 3.49Å; A97-T101 PolarHBondContact O-N 3.47Å; A97-T101 PolarHBondContact O-OG1 2.96Å; T98-T101 PolarHBondContact O-N 2.98Å; E99-T101 PolarHBondContact O-N 3.34Å; T101-G104 PolarHBondContact O-N 3.45Å; T101-L105 HydrophobicContact CG2-CD1 4.06Å; T101-L105 PolarHBondContact O-N 3.25Å
102	N	95.7	Very high	94.6	Very high	88 Å²	88	97.6 Å²	97.6	47%	0.471	52%	0.517	S	S	.	.	H	α-helix	trans	-64	-42.4	177.1	-74	-29.1	0	0	0	112.1	T98 E99 L105 Q106	T98-N102 WeakPolarHBondContact O-CB 3.2Å; T98-N102 PolarHBondContact O-N 3.34Å; T98-N102 PolarHBondContact O-ND2 2.87Å; E99-N102 PolarHBondContact O-N 3.33Å; N102-L105 PolarHBondContact O-N 3.43Å; N102-Q106 WeakPolarHBondContact O-CG 3.45Å; N102-Q106 PolarHBondContact O-N 2.96Å
103	Q	95.8	Very high	93	Very high	96 Å²	96	103.2 Å²	103.2	45%	0.449	54%	0.54	S	S	.	.	H	α-helix	trans	-61.1	-43.3	175.3	-72.5	173.3	7.3	0	0	111.7	E99 Y100 Q106 Y107	E99-Q103 WeakPolarHBondContact O-CG 3.35Å; E99-Q103 PolarHBondContact O-N 3.02Å; Y100-Q103 PolarHBondContact O-N 3.38Å; Q103-Q106 PolarHBondContact O-N 3.42Å; Q103-Y107 WeakPolarHBondContact O-CB 3.39Å; Q103-Y107 PolarHBondContact O-N 3.32Å
104	G	94.7	Very high	93	Very high	36 Å²	36	106.3 Å²	106.3	37%	0.371	55%	0.549	S	S	.	.	H	α-helix	trans	-62.9	-43.4	176.2	0	0	0	0	0	112.8	Y100 T101 Y107 V108	Y100-G104 PolarHBondContact O-N 3.16Å; T101-G104 PolarHBondContact O-N 3.45Å; G104-Y107 PolarHBondContact O-N 3.08Å; G104-V108 WeakPolarHBondContact O-CG2 3.48Å; G104-V108 PolarHBondContact O-N 3.29Å
105	L	95.4	Very high	93	Very high	116 Å²	116	107.5 Å²	107.5	61%	0.607	55%	0.55	S	S	*	.	H	α-helix	trans	-61.5	-43.9	175.1	-97.1	146.8	0	0	0	112.4	T101 N102 K109	T101-L105 HydrophobicContact CG2-CD1 4.06Å; T101-L105 PolarHBondContact O-N 3.25Å; N102-L105 PolarHBondContact O-N 3.43Å; L105-K109 WeakPolarHBondContact O-CB 3.44Å; L105-K109 PolarHBondContact O-N 3.06Å
106	Q	95.4	Very high	92.9	Very high	128 Å²	128	107.8 Å²	107.8	60%	0.598	55%	0.546	S	S	*	.	H	α-helix	trans	-62.8	-45.1	175.7	-76.6	-175.3	-8.3	0	0	111.6	N102 Q103 V108 K109 D110	N102-Q106 WeakPolarHBondContact O-CG 3.45Å; N102-Q106 PolarHBondContact O-N 2.96Å; Q103-Q106 PolarHBondContact O-N 3.42Å; Q106-V108 PolarHBondContact O-N 3.1Å; Q106-K109 WeakPolarHBondContact O-CB 3.48Å; Q106-K109 PolarHBondContact O-N 3.2Å; Q106-K109 VanDerWaalsContact O-N 3.13Å; Q106-D110 PolarHBondContact O-N 2.8Å
107	Y	95.3	Very high	92.9	Very high	152 Å²	152	107.5 Å²	107.5	60%	0.596	55%	0.552	S	S	*	*	H	α-helix	trans	-58.1	-46.9	178.5	177.4	-105.7	0	0	0	112.7	Q103 G104 K109 D110 L111	Q103-Y107 WeakPolarHBondContact O-CB 3.39Å; Q103-Y107 PolarHBondContact O-N 3.32Å; G104-Y107 PolarHBondContact O-N 3.08Å; Y107-K109 VanDerWaalsContact C-N 3.31Å; Y107-K109 PolarHBondContact O-N 3.05Å; Y107-D110 PolarHBondContact O-N 3.38Å; Y107-L111 HydrophobicContact CD1-CD1 3.84Å; Y107-L111 HydrophobicContact CE1-CD1 3.28Å; Y107-L111 HydrophobicContact CE1-CG 4.37Å; Y107-L111 HydrophobicContact CE2-CD1 4.15Å; Y107-L111 HydrophobicContact CE2-CG 4.46Å; Y107-L111 HydrophobicContact CG-CD1 4.48Å; Y107-L111 VanDerWaalsContact CZ-CD1 3.46Å; Y107-L111 PolarHBondContact O-N 3.3Å; Y107-L111 VanDerWaalsContact O-N 3.08Å
108	V	95.8	Very high	92.8	Very high	88 Å²	88	110.9 Å²	110.9	53%	0.533	56%	0.56	S	S	.	*	H	α-helix	trans	-62.8	-40.3	176.6	172.7	0	0	0	0	111.2	G104 Q106 D110 L111 T112	G104-V108 WeakPolarHBondContact O-CG2 3.48Å; G104-V108 PolarHBondContact O-N 3.29Å; Q106-V108 PolarHBondContact O-N 3.1Å; V108-D110 VanDerWaalsContact C-N 3.33Å; V108-D110 PolarHBondContact O-N 3.45Å; V108-L111 PolarHBondContact O-N 2.99Å; V108-T112 PolarHBondContact O-N 3.33Å; V108-T112 PolarHBondContact O-OG1 2.96Å
109	K	93.7	Very high	92.7	Very high	135 Å²	135	112.7 Å²	112.7	59%	0.587	56%	0.563	S	S	*	*	H	α-helix	trans	-62.4	-40.7	177.6	-175.4	-178.2	179.3	-179.2	0	112	L105 Q106 Y107 T112	L105-K109 WeakPolarHBondContact O-CB 3.44Å; L105-K109 PolarHBondContact O-N 3.06Å; Q106-K109 WeakPolarHBondContact O-CB 3.48Å; Q106-K109 PolarHBondContact O-N 3.2Å; Q106-K109 VanDerWaalsContact O-N 3.13Å; Y107-K109 VanDerWaalsContact C-N 3.31Å; Y107-K109 PolarHBondContact O-N 3.05Å; K109-T112 PolarHBondContact O-N 3.31Å
110	D	95.4	Very high	92.5	Very high	104 Å²	104	115.2 Å²	115.2	56%	0.556	58%	0.577	S	S	*	*	H	α-helix	trans	-72.6	-31.7	-180	-69.9	-20.3	0	0	0	112.5	Q106 Y107 V108 T112	Q106-D110 PolarHBondContact O-N 2.8Å; Y107-D110 PolarHBondContact O-N 3.38Å; V108-D110 VanDerWaalsContact C-N 3.33Å; V108-D110 PolarHBondContact O-N 3.45Å; D110-T112 VanDerWaalsContact C-N 3.32Å
111	L	93.4	Very high	92.3	Very high	110 Å²	110	113.1 Å²	113.1	58%	0.576	58%	0.578	S	S	*	*	H	α-helix	trans	-69.7	-25.6	173.1	-83.6	166.7	0	0	0	114.3	Y107 V108	Y107-L111 HydrophobicContact CD1-CD1 3.84Å; Y107-L111 HydrophobicContact CE1-CD1 3.28Å; Y107-L111 HydrophobicContact CE1-CG 4.37Å; Y107-L111 HydrophobicContact CE2-CD1 4.15Å; Y107-L111 HydrophobicContact CE2-CG 4.46Å; Y107-L111 HydrophobicContact CG-CD1 4.48Å; Y107-L111 VanDerWaalsContact CZ-CD1 3.46Å; Y107-L111 PolarHBondContact O-N 3.3Å; Y107-L111 VanDerWaalsContact O-N 3.08Å; V108-L111 PolarHBondContact O-N 2.99Å
112	T	90.9	Very high	92.1	Very high	116 Å²	116	115.3 Å²	115.3	71%	0.712	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.9	-7	-175.5	-47.1	0	0	0	0	112.3	V108 K109 D110	V108-T112 PolarHBondContact O-N 3.33Å; V108-T112 PolarHBondContact O-OG1 2.96Å; K109-T112 PolarHBondContact O-N 3.31Å; D110-T112 VanDerWaalsContact C-N 3.32Å
113	K	63.4	Low	91.8	Very high	215 Å²	215	117.8 Å²	117.8	94%	0.935	59%	0.593	S	S	*	*			trans	-84.8	0	171.2	-86	-177.2	171.1	-178.4	0	111.3

Retrieved 113 of 113 residues in 69.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).