A0A087XCH7_POEFO Loading...

CART prepropeptide

AlphaFold DB , UniProt , Accession A0A087XCH7, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 111 aa.

						>A0A087XCH7_POEFO|A0A087XCH7
SVSTMVNATMLLLSASCWLLVALGSCDERLEERSPEYDVIKTEEEKELIEALQEVLEKLKNKQLPSSEKKLGWLPPCVAGEQCAVRKGARIGKLCGCPRGTLCNFSILQCA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	55.6	Low	70.2	Confident	134 Å²	134	97.7 Å²	97.7	94%	0.937	58%	0.582	S	S	*	*				0	-25.2	0	-55.2	0	0	0	0	115.4	T4	S1-T4 PolarHBondContact O-OG1 3.12Å
2	V	60.1	Low	71.7	Confident	105 Å²	105	100 Å²	100	64%	0.636	59%	0.588	S	S	*	*	H	α-helix	trans	-70.9	-41.5	179.9	-179.6	0	0	0	0	112.4	T4 M5 V6	V2-T4 VanDerWaalsContact C-N 3.31Å; V2-T4 PolarHBondContact O-N 3.18Å; V2-M5 PolarHBondContact O-N 3.49Å; V2-V6 WeakPolarHBondContact O-CG2 3.15Å; V2-V6 PolarHBondContact O-N 2.04Å
3	S	58.3	Low	72.9	Confident	90 Å²	90	100.7 Å²	100.7	63%	0.629	59%	0.587	S	S	*	*	H	α-helix	trans	-65.4	-29.5	-178	-34.5	0	0	0	0	113.9	N7	S3-N7 PolarHBondContact O-N 3.44Å
4	T	63.3	Low	73.9	Confident	97 Å²	97	97.6 Å²	97.6	60%	0.595	57%	0.574	S	S	*	*	H	α-helix	trans	-76.5	-33.3	178.1	51.2	0	0	0	0	112.1	S1 V2 A8	S1-T4 PolarHBondContact O-OG1 3.12Å; V2-T4 VanDerWaalsContact C-N 3.31Å; V2-T4 PolarHBondContact O-N 3.18Å; T4-A8 WeakPolarHBondContact O-CB 3.4Å; T4-A8 PolarHBondContact O-N 3.24Å; T4-A8 VanDerWaalsContact O-N 3.12Å
5	M	61.5	Low	74.9	Confident	116 Å²	116	94.9 Å²	94.9	57%	0.571	57%	0.567	S	S	*	*	H	α-helix	trans	-68.1	-42	173.4	-76.6	-172.4	-66.2	0	0	111.6	V2 N7 A8 T9	V2-M5 PolarHBondContact O-N 3.49Å; M5-N7 PolarHBondContact O-N 2.03Å; M5-A8 PolarHBondContact O-N 2.83Å; M5-T9 WeakPolarHBondContact O-CG2 3.04Å; M5-T9 PolarHBondContact O-N 2.94Å; M5-T9 PolarHBondContact O-OG1 2.02Å; M5-T9 VanDerWaalsContact O-OG1 3.13Å
6	V	69.8	Low	75.6	Confident	68 Å²	68	92.3 Å²	92.3	41%	0.412	56%	0.555	S	S	.	*	H	α-helix	trans	-62.2	-43	177.9	175.2	0	0	0	0	111.2	V2 T9 M10	V2-V6 WeakPolarHBondContact O-CG2 3.15Å; V2-V6 PolarHBondContact O-N 2.04Å; V6-T9 WeakPolarHBondContact CA-OG1 3.13Å; V6-T9 PolarHBondContact O-N 2.83Å; V6-T9 PolarHBondContact O-OG1 3.43Å; V6-M10 WeakPolarHBondContact O-CG 3.17Å; V6-M10 PolarHBondContact O-N 3.47Å
7	N	72.6	Confident	76.1	Confident	107 Å²	107	91 Å²	91	57%	0.572	55%	0.55	S	S	*	*	H	α-helix	trans	-65.2	-40.8	176.7	-73.5	2.1	0	0	0	112.3	S3 M5 M10 L11	S3-N7 PolarHBondContact O-N 3.44Å; M5-N7 PolarHBondContact O-N 2.03Å; N7-M10 PolarHBondContact O-N 2.74Å; N7-L11 VanDerWaalsContact O-CG 3.29Å; N7-L11 WeakPolarHBondContact O-CG 3.03Å; N7-L11 PolarHBondContact O-N 3.37Å; N7-L11 VanDerWaalsContact O-N 3.07Å
8	A	81.1	Confident	76.6	Confident	50 Å²	50	97.6 Å²	97.6	41%	0.413	56%	0.564	S	S	.	*	H	α-helix	trans	-63.6	-42.2	175.9	0	0	0	0	0	111.9	T4 M5 M10 L11 L12	T4-A8 WeakPolarHBondContact O-CB 3.4Å; T4-A8 PolarHBondContact O-N 3.24Å; T4-A8 VanDerWaalsContact O-N 3.12Å; M5-A8 PolarHBondContact O-N 2.83Å; A8-M10 PolarHBondContact O-N 3.25Å; A8-L11 PolarHBondContact O-N 2.86Å; A8-L12 WeakPolarHBondContact O-CG 3.45Å; A8-L12 PolarHBondContact O-N 2.97Å
9	T	79.8	Confident	77	Confident	71 Å²	71	98.3 Å²	98.3	44%	0.436	57%	0.565	S	S	.	*	H	α-helix	trans	-64.7	-39.7	176.4	49.9	0	0	0	0	112.4	M5 V6 L11 L12 L13	M5-T9 WeakPolarHBondContact O-CG2 3.04Å; M5-T9 PolarHBondContact O-N 2.94Å; M5-T9 PolarHBondContact O-OG1 2.02Å; M5-T9 VanDerWaalsContact O-OG1 3.13Å; V6-T9 WeakPolarHBondContact CA-OG1 3.13Å; V6-T9 PolarHBondContact O-N 2.83Å; V6-T9 PolarHBondContact O-OG1 3.43Å; T9-L11 VanDerWaalsContact C-N 3.33Å; T9-L11 PolarHBondContact O-N 2.94Å; T9-L12 PolarHBondContact O-N 2.94Å; T9-L13 VanDerWaalsContact O-CG 3.29Å; T9-L13 WeakPolarHBondContact O-CG 3.41Å; T9-L13 PolarHBondContact O-N 3.39Å
10	M	84	Confident	77.1	Confident	119 Å²	119	99.5 Å²	99.5	59%	0.586	57%	0.568	S	S	*	*	H	α-helix	trans	-65	-37.4	177.2	-73.4	-64.3	179.4	0	0	112.3	V6 N7 A8 L13 S14	V6-M10 WeakPolarHBondContact O-CG 3.17Å; V6-M10 PolarHBondContact O-N 3.47Å; N7-M10 PolarHBondContact O-N 2.74Å; A8-M10 PolarHBondContact O-N 3.25Å; M10-L13 PolarHBondContact O-N 3.04Å; M10-S14 PolarHBondContact O-N 3.2Å; M10-S14 PolarHBondContact O-OG 3.47Å
11	L	86.2	Confident	77.3	Confident	118 Å²	118	99.2 Å²	99.2	62%	0.618	57%	0.568	S	S	*	*	H	α-helix	trans	-68.9	-36.2	176	-69.3	171.2	0	0	0	112.7	N7 A8 T9 S14 A15	N7-L11 VanDerWaalsContact O-CG 3.29Å; N7-L11 WeakPolarHBondContact O-CG 3.03Å; N7-L11 PolarHBondContact O-N 3.37Å; N7-L11 VanDerWaalsContact O-N 3.07Å; A8-L11 PolarHBondContact O-N 2.86Å; T9-L11 VanDerWaalsContact C-N 3.33Å; T9-L11 PolarHBondContact O-N 2.94Å; L11-S14 PolarHBondContact O-OG 2.85Å; L11-A15 VanDerWaalsContact O-CB 3.31Å; L11-A15 WeakPolarHBondContact O-CB 3.02Å; L11-A15 PolarHBondContact O-N 2.61Å
12	L	88.4	Confident	78.3	Confident	125 Å²	125	95.2 Å²	95.2	65%	0.654	54%	0.544	S	S	*	.	H	α-helix	trans	-68.9	-38.3	174.9	-70.2	170	0	0	0	111.8	A8 T9 S16	A8-L12 WeakPolarHBondContact O-CG 3.45Å; A8-L12 PolarHBondContact O-N 2.97Å; T9-L12 PolarHBondContact O-N 2.94Å; L12-S16 WeakPolarHBondContact O-CB 3.48Å; L12-S16 PolarHBondContact O-N 2.77Å; L12-S16 PolarHBondContact O-OG 2.89Å
13	L	87.5	Confident	78.7	Confident	109 Å²	109	95.1 Å²	95.1	57%	0.571	54%	0.539	S	S	*	.	H	α-helix	trans	-67.6	-40.2	175.7	-70	174.7	0	0	0	111.8	T9 M10 S16 C17	T9-L13 VanDerWaalsContact O-CG 3.29Å; T9-L13 WeakPolarHBondContact O-CG 3.41Å; T9-L13 PolarHBondContact O-N 3.39Å; M10-L13 PolarHBondContact O-N 3.04Å; L13-S16 WeakPolarHBondContact CA-OG 2.97Å; L13-S16 PolarHBondContact O-OG 3.36Å; L13-C17 WeakPolarHBondContact O-CB 3.29Å; L13-C17 PolarHBondContact O-N 3.14Å
14	S	86.8	Confident	79.2	Confident	57 Å²	57	93 Å²	93	40%	0.399	53%	0.532	S	S	.	.	H	α-helix	trans	-68.3	-42.1	176.4	67	0	0	0	0	112.1	M10 L11 C17 W18	M10-S14 PolarHBondContact O-N 3.2Å; M10-S14 PolarHBondContact O-OG 3.47Å; L11-S14 PolarHBondContact O-OG 2.85Å; S14-C17 PolarHBondContact O-N 3.43Å; S14-W18 WeakPolarHBondContact O-CB 3.32Å; S14-W18 VanDerWaalsContact O-CD1 3.24Å; S14-W18 PolarHBondContact O-N 3.38Å
15	A	88.4	Confident	78.9	Confident	58 Å²	58	92.4 Å²	92.4	48%	0.479	53%	0.531	S	S	.	.	H	α-helix	trans	-64.5	-42.5	177	0	0	0	0	0	112.2	L11 W18 L19	L11-A15 VanDerWaalsContact O-CB 3.31Å; L11-A15 WeakPolarHBondContact O-CB 3.02Å; L11-A15 PolarHBondContact O-N 2.61Å; A15-W18 PolarHBondContact O-N 2.9Å; A15-L19 WeakPolarHBondContact O-CB 3.06Å; A15-L19 PolarHBondContact O-N 3.09Å
16	S	86.9	Confident	78.4	Confident	53 Å²	53	90 Å²	90	37%	0.371	53%	0.525	S	S	.	.	H	α-helix	trans	-66.9	-40	175.2	55	0	0	0	0	112.2	L12 L13 L19 L20	L12-S16 WeakPolarHBondContact O-CB 3.48Å; L12-S16 PolarHBondContact O-N 2.77Å; L12-S16 PolarHBondContact O-OG 2.89Å; L13-S16 WeakPolarHBondContact CA-OG 2.97Å; L13-S16 PolarHBondContact O-OG 3.36Å; S16-L19 PolarHBondContact O-N 3.28Å; S16-L20 WeakPolarHBondContact O-CB 3.18Å; S16-L20 VanDerWaalsContact O-CG 3.28Å; S16-L20 WeakPolarHBondContact O-CG 3.28Å; S16-L20 PolarHBondContact O-N 3.41Å
17	C	83.9	Confident	77.5	Confident	70 Å²	70	92.8 Å²	92.8	47%	0.473	54%	0.538	S	S	.	.	H	α-helix	trans	-63.8	-42.6	175	-168.2	0	0	0	0	111.8	L13 S14 L19 L20 V21	L13-C17 WeakPolarHBondContact O-CB 3.29Å; L13-C17 PolarHBondContact O-N 3.14Å; S14-C17 PolarHBondContact O-N 3.43Å; C17-L19 VanDerWaalsContact C-N 3.34Å; C17-L19 PolarHBondContact O-N 3.16Å; C17-L20 PolarHBondContact O-N 3.07Å; C17-V21 WeakPolarHBondContact O-CG2 3.49Å; C17-V21 PolarHBondContact O-N 3.42Å
18	W	84.9	Confident	76.2	Confident	210 Å²	210	96.7 Å²	96.7	80%	0.795	55%	0.553	S	S	*	*	H	α-helix	trans	-61.3	-41.8	172.6	-88.6	52	0	0	0	112.3	S14 A15 V21 A22	S14-W18 WeakPolarHBondContact O-CB 3.32Å; S14-W18 VanDerWaalsContact O-CD1 3.24Å; S14-W18 PolarHBondContact O-N 3.38Å; A15-W18 PolarHBondContact O-N 2.9Å; W18-V21 PolarHBondContact O-N 2.91Å; W18-A22 WeakPolarHBondContact O-CB 3.33Å; W18-A22 PolarHBondContact O-N 3.39Å
19	L	83.6	Confident	74.4	Confident	111 Å²	111	105 Å²	105	58%	0.581	57%	0.573	S	S	*	*	H	α-helix	trans	-65.3	-39.5	177.1	-167.1	71.5	0	0	0	111.6	A15 S16 C17 A22 L23	A15-L19 WeakPolarHBondContact O-CB 3.06Å; A15-L19 PolarHBondContact O-N 3.09Å; S16-L19 PolarHBondContact O-N 3.28Å; C17-L19 VanDerWaalsContact C-N 3.34Å; C17-L19 PolarHBondContact O-N 3.16Å; L19-A22 PolarHBondContact O-N 2.79Å; L19-L23 HydrophobicContact CD2-CD1 4.36Å; L19-L23 HydrophobicContact CG-CD1 3.89Å; L19-L23 VanDerWaalsContact O-CB 3.26Å; L19-L23 WeakPolarHBondContact O-CB 3.49Å; L19-L23 WeakPolarHBondContact O-CG 3.41Å; L19-L23 PolarHBondContact O-N 2.85Å
20	L	80.1	Confident	72.7	Confident	121 Å²	121	108.1 Å²	108.1	63%	0.634	59%	0.586	S	S	*	*	H	α-helix	trans	-65.4	-40.4	175.3	-73.2	168.8	0	0	0	112.2	S16 C17 G24	S16-L20 WeakPolarHBondContact O-CB 3.18Å; S16-L20 VanDerWaalsContact O-CG 3.28Å; S16-L20 WeakPolarHBondContact O-CG 3.28Å; S16-L20 PolarHBondContact O-N 3.41Å; C17-L20 PolarHBondContact O-N 3.07Å; L20-G24 PolarHBondContact O-N 3.33Å
21	V	80.1	Confident	70.6	Confident	94 Å²	94	110.3 Å²	110.3	57%	0.57	60%	0.595	S	S	*	*	H	α-helix	trans	-67.4	-41.2	175.5	172.4	0	0	0	0	111	C17 W18 S25	C17-V21 WeakPolarHBondContact O-CG2 3.49Å; C17-V21 PolarHBondContact O-N 3.42Å; W18-V21 PolarHBondContact O-N 2.91Å; V21-S25 WeakPolarHBondContact O-CB 3.46Å; V21-S25 PolarHBondContact O-N 3.49Å; V21-S25 PolarHBondContact O-OG 3.1Å
22	A	76.6	Confident	68.6	Low	51 Å²	51	113.1 Å²	113.1	42%	0.421	61%	0.605	S	S	.	*	H	α-helix	trans	-66.9	-43.1	176.5	0	0	0	0	0	112	W18 L19 S25 C26	W18-A22 WeakPolarHBondContact O-CB 3.33Å; W18-A22 PolarHBondContact O-N 3.39Å; L19-A22 PolarHBondContact O-N 2.79Å; A22-S25 PolarHBondContact O-N 3.25Å; A22-C26 WeakPolarHBondContact O-CB 3.4Å; A22-C26 PolarHBondContact O-N 3.41Å; A22-C26 PolarHBondContact O-SG 2.94Å; A22-C26 VanDerWaalsContact O-SG 3.33Å
23	L	70.1	Confident	66.6	Low	102 Å²	102	117.3 Å²	117.3	53%	0.534	61%	0.613	S	S	.	*	H	α-helix	trans	-65.8	-43.1	175	-80.5	161.4	0	0	0	111.5	L19 S25 C26 D27	L19-L23 HydrophobicContact CD2-CD1 4.36Å; L19-L23 HydrophobicContact CG-CD1 3.89Å; L19-L23 VanDerWaalsContact O-CB 3.26Å; L19-L23 WeakPolarHBondContact O-CB 3.49Å; L19-L23 WeakPolarHBondContact O-CG 3.41Å; L19-L23 PolarHBondContact O-N 2.85Å; L23-S25 VanDerWaalsContact C-N 3.28Å; L23-S25 PolarHBondContact O-N 3.4Å; L23-C26 CarbonylContact O-C 3.42Å; L23-C26 WeakPolarHBondContact O-CA 3.41Å; L23-C26 PolarHBondContact O-N 3.39Å; L23-D27 WeakPolarHBondContact O-CB 3.38Å; L23-D27 PolarHBondContact O-N 3.3Å
24	G	67.1	Low	64.5	Low	47 Å²	47	115 Å²	115	49%	0.485	61%	0.605	S	S	.	*	H	α-helix	trans	-65	-30.9	175.6	0	0	0	0	0	113.2	L20	L20-G24 PolarHBondContact O-N 3.33Å
25	S	57.8	Low	62.8	Low	83 Å²	83	115.5 Å²	115.5	58%	0.58	61%	0.607	S	S	*	*	H	α-helix	trans	-76	-25.5	172.4	-55.9	0	0	0	0	112.5	V21 A22 L23	V21-S25 WeakPolarHBondContact O-CB 3.46Å; V21-S25 PolarHBondContact O-N 3.49Å; V21-S25 PolarHBondContact O-OG 3.1Å; A22-S25 PolarHBondContact O-N 3.25Å; L23-S25 VanDerWaalsContact C-N 3.28Å; L23-S25 PolarHBondContact O-N 3.4Å
26	C	51.1	Low	61	Low	66 Å²	66	119 Å²	119	45%	0.446	61%	0.613	S	S	.	*	H	α-helix	trans	-86	-21.8	172.8	-74.6	0	0	0	0	112.8	A22 L23 E28 R29 L30	A22-C26 WeakPolarHBondContact O-CB 3.4Å; A22-C26 PolarHBondContact O-N 3.41Å; A22-C26 PolarHBondContact O-SG 2.94Å; A22-C26 VanDerWaalsContact O-SG 3.33Å; L23-C26 CarbonylContact O-C 3.42Å; L23-C26 WeakPolarHBondContact O-CA 3.41Å; L23-C26 PolarHBondContact O-N 3.39Å; C26-E28 VanDerWaalsContact C-N 3.27Å; C26-R29 CarbonylContact O-C 3.25Å; C26-R29 VanDerWaalsContact O-C 3.25Å; C26-R29 VanDerWaalsContact O-CA 3.27Å; C26-R29 WeakPolarHBondContact O-CA 3.39Å; C26-R29 WeakPolarHBondContact O-CB 3.13Å; C26-R29 PolarHBondContact O-N 2.87Å; C26-L30 WeakPolarHBondContact O-CB 3.5Å; C26-L30 PolarHBondContact O-N 3.01Å
27	D	49.7	Very low	59.3	Low	127 Å²	127	123.1 Å²	123.1	68%	0.679	62%	0.622	S	S	*	*	H	α-helix	trans	-64.9	-35	175.4	-156.3	-108	0	0	0	110.2	L23 R29 L30	L23-D27 WeakPolarHBondContact O-CB 3.38Å; L23-D27 PolarHBondContact O-N 3.3Å; D27-R29 PolarHBondContact O-N 2.83Å; D27-R29 VanDerWaalsContact O-N 3.09Å; D27-L30 PolarHBondContact O-N 3.25Å
28	E	46.9	Very low	57.9	Low	188 Å²	188	124.4 Å²	124.4	88%	0.879	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.4	-4	168.3	-150.7	177.8	98	0	0	113.3	C26	C26-E28 VanDerWaalsContact C-N 3.27Å
29	R	43.3	Very low	56.6	Low	225 Å²	225	118 Å²	118	85%	0.849	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126.7	-1.9	-177.8	-131.1	-176.8	172.2	-122.8	-5	114.3	C26 D27	C26-R29 CarbonylContact O-C 3.25Å; C26-R29 VanDerWaalsContact O-C 3.25Å; C26-R29 VanDerWaalsContact O-CA 3.27Å; C26-R29 WeakPolarHBondContact O-CA 3.39Å; C26-R29 WeakPolarHBondContact O-CB 3.13Å; C26-R29 PolarHBondContact O-N 2.87Å; D27-R29 PolarHBondContact O-N 2.83Å; D27-R29 VanDerWaalsContact O-N 3.09Å
30	L	44.2	Very low	55.5	Low	136 Å²	136	117.4 Å²	117.4	71%	0.712	61%	0.605	S	S	*	*			trans	-115	26.3	177	-100.5	174.7	0	0	0	111.6	C26 D27 E32	C26-L30 WeakPolarHBondContact O-CB 3.5Å; C26-L30 PolarHBondContact O-N 3.01Å; D27-L30 PolarHBondContact O-N 3.25Å; L30-E32 PolarHBondContact O-N 2.92Å
31	E	39.3	Very low	54.8	Low	166 Å²	166	116 Å²	116	78%	0.776	59%	0.594	S	S	*	*	S	Bend	trans	-65.5	94.3	139.8	-100.6	-161.1	98.3	0	0	106.8	R33	E31-R33 PolarHBondContact O-N 3.42Å
32	E	44.1	Very low	54.3	Low	176 Å²	176	115.4 Å²	115.4	82%	0.822	59%	0.59	S	S	*	*			trans	-36.5	101.7	159.5	-170	173.6	124.3	0	0	109.7	L30 S34	L30-E32 PolarHBondContact O-N 2.92Å; E32-S34 PolarHBondContact O-N 2.91Å
33	R	46.4	Very low	54.2	Low	214 Å²	214	118.5 Å²	118.5	81%	0.808	60%	0.596	S	S	*	*			trans	-31.7	96.8	160.9	-174.3	-173.7	-171.6	117.1	1	111.4	E31	E31-R33 PolarHBondContact O-N 3.42Å
34	S	42.4	Very low	54.6	Low	60 Å²	60	119.2 Å²	119.2	42%	0.42	60%	0.596	S	S	.	*			trans	-95.6	103.1	144.9	-175.3	0	0	0	0	106.8	E32 E36 Y37	E32-S34 PolarHBondContact O-N 2.91Å; S34-E36 PolarHBondContact O-N 3.19Å; S34-E36 VanDerWaalsContact O-N 3.13Å; S34-Y37 PolarHBondContact O-N 3.41Å
35	P	51	Low	55.2	Low	68 Å²	68	121.6 Å²	121.6	44%	0.442	60%	0.595	S	S	.	*	H	α-helix	trans	-61.8	-19.2	179	27.2	-31.3	0	0	0	111.8	V39	P35-V39 WeakPolarHBondContact O-CB 3.46Å; P35-V39 WeakPolarHBondContact O-CG2 3.26Å; P35-V39 PolarHBondContact O-N 2.94Å
36	E	50.7	Low	56.5	Low	130 Å²	130	124.4 Å²	124.4	61%	0.607	60%	0.597	S	S	*	*	H	α-helix	trans	-69.5	-35.2	171.5	-84.6	116.4	124.9	0	0	113.6	S34 I40	S34-E36 PolarHBondContact O-N 3.19Å; S34-E36 VanDerWaalsContact O-N 3.13Å; E36-I40 WeakPolarHBondContact O-CB 3.34Å; E36-I40 VanDerWaalsContact O-CD1 3.23Å; E36-I40 WeakPolarHBondContact O-CD1 3.05Å; E36-I40 WeakPolarHBondContact O-CG1 3.48Å; E36-I40 PolarHBondContact O-N 3.2Å
37	Y	51.9	Low	58.2	Low	140 Å²	140	127.9 Å²	127.9	55%	0.549	61%	0.606	S	S	.	*	H	α-helix	trans	-73.4	-41.9	-178.3	178.6	-107.7	0	0	0	112.5	S34 V39 I40 K41	S34-Y37 PolarHBondContact O-N 3.41Å; Y37-V39 VanDerWaalsContact C-N 3.33Å; Y37-V39 PolarHBondContact O-N 2.95Å; Y37-I40 PolarHBondContact O-N 3.37Å; Y37-K41 VanDerWaalsContact O-CB 3.26Å; Y37-K41 WeakPolarHBondContact O-CB 3.45Å; Y37-K41 PolarHBondContact O-N 3.32Å
38	D	54.2	Low	60.1	Low	97 Å²	97	126.4 Å²	126.4	52%	0.519	60%	0.598	S	S	.	*	H	α-helix	trans	-65.6	-36.6	174.5	-80.3	-45.4	0	0	0	111.9	T42	D38-T42 WeakPolarHBondContact O-CB 3.48Å; D38-T42 PolarHBondContact O-N 3.45Å; D38-T42 PolarHBondContact O-OG1 3.36Å
39	V	58.7	Low	62.3	Low	75 Å²	75	122 Å²	122	46%	0.455	58%	0.579	S	S	.	*	H	α-helix	trans	-67.8	-44.9	175.7	171.2	0	0	0	0	111	P35 Y37 T42 E43	P35-V39 WeakPolarHBondContact O-CB 3.46Å; P35-V39 WeakPolarHBondContact O-CG2 3.26Å; P35-V39 PolarHBondContact O-N 2.94Å; Y37-V39 VanDerWaalsContact C-N 3.33Å; Y37-V39 PolarHBondContact O-N 2.95Å; V39-T42 WeakPolarHBondContact CA-OG1 3.12Å; V39-T42 PolarHBondContact O-N 3.37Å; V39-T42 PolarHBondContact O-OG1 3.44Å; V39-T42 VanDerWaalsContact O-OG1 3.05Å; V39-E43 WeakPolarHBondContact O-CB 3.38Å; V39-E43 WeakPolarHBondContact O-CG 3.25Å; V39-E43 PolarHBondContact O-N 2.91Å
40	I	60.3	Low	64.6	Low	100 Å²	100	117.1 Å²	117.1	51%	0.513	57%	0.566	S	S	.	*	H	α-helix	trans	-65.1	-41.9	177.7	-67.2	162	0	0	0	111	E36 Y37 E43 E44	E36-I40 WeakPolarHBondContact O-CB 3.34Å; E36-I40 VanDerWaalsContact O-CD1 3.23Å; E36-I40 WeakPolarHBondContact O-CD1 3.05Å; E36-I40 WeakPolarHBondContact O-CG1 3.48Å; E36-I40 PolarHBondContact O-N 3.2Å; Y37-I40 PolarHBondContact O-N 3.37Å; I40-E43 PolarHBondContact O-N 2.94Å; I40-E44 WeakPolarHBondContact O-CB 3.36Å; I40-E44 PolarHBondContact O-N 3.38Å
41	K	64.5	Low	66.8	Low	92 Å²	92	113 Å²	113	40%	0.4	55%	0.552	S	S	.	*	H	α-helix	trans	-64.5	-40.4	176.3	-176.6	-179.9	174.1	-175.2	0	111.9	Y37 E44 E45	Y37-K41 VanDerWaalsContact O-CB 3.26Å; Y37-K41 WeakPolarHBondContact O-CB 3.45Å; Y37-K41 PolarHBondContact O-N 3.32Å; K41-E44 PolarHBondContact O-N 2.89Å; K41-E45 VanDerWaalsContact CE-OE1 3.29Å; K41-E45 WeakPolarHBondContact CE-OE1 3.45Å; K41-E45 WeakPolarHBondContact O-CB 3.45Å; K41-E45 VanDerWaalsContact O-CG 3.26Å; K41-E45 WeakPolarHBondContact O-CG 3.46Å; K41-E45 PolarHBondContact O-N 3.32Å
42	T	70.8	Confident	69.3	Low	80 Å²	80	110.3 Å²	110.3	49%	0.491	54%	0.542	S	S	.	.	H	α-helix	trans	-71.4	-30.5	175.8	39.9	0	0	0	0	112.9	D38 V39 K46	D38-T42 WeakPolarHBondContact O-CB 3.48Å; D38-T42 PolarHBondContact O-N 3.45Å; D38-T42 PolarHBondContact O-OG1 3.36Å; V39-T42 WeakPolarHBondContact CA-OG1 3.12Å; V39-T42 PolarHBondContact O-N 3.37Å; V39-T42 PolarHBondContact O-OG1 3.44Å; V39-T42 VanDerWaalsContact O-OG1 3.05Å; T42-K46 WeakPolarHBondContact O-CB 3.41Å; T42-K46 PolarHBondContact O-N 2.9Å
43	E	74.6	Confident	71.5	Confident	116 Å²	116	107.6 Å²	107.6	54%	0.542	53%	0.529	S	S	.	.	H	α-helix	trans	-66.7	-47.9	170.8	-77.3	-178.7	165	0	0	111.3	V39 I40 K46 E47	V39-E43 WeakPolarHBondContact O-CB 3.38Å; V39-E43 WeakPolarHBondContact O-CG 3.25Å; V39-E43 PolarHBondContact O-N 2.91Å; I40-E43 PolarHBondContact O-N 2.94Å; E43-K46 WeakPolarHBondContact O-CB 3.43Å; E43-K46 PolarHBondContact O-N 3.5Å; E43-E47 WeakPolarHBondContact O-CG 3.33Å; E43-E47 PolarHBondContact O-N 3.34Å
44	E	77.8	Confident	73.5	Confident	117 Å²	117	102.3 Å²	102.3	55%	0.547	51%	0.514	S	S	.	.	H	α-helix	trans	-59.6	-49.5	175.9	-175	-179	170.9	0	0	111.2	I40 K41 K46 E47 L48	I40-E44 WeakPolarHBondContact O-CB 3.36Å; I40-E44 PolarHBondContact O-N 3.38Å; K41-E44 PolarHBondContact O-N 2.89Å; E44-K46 PolarHBondContact O-N 3.31Å; E44-E47 PolarHBondContact O-N 3.05Å; E44-E47 VanDerWaalsContact O-N 3.16Å; E44-L48 HydrophobicContact CG-CD1 3.65Å; E44-L48 WeakPolarHBondContact O-CD1 3.35Å; E44-L48 PolarHBondContact O-N 2.83Å
45	E	78.8	Confident	75.7	Confident	98 Å²	98	103.3 Å²	103.3	46%	0.458	52%	0.518	S	S	.	.	H	α-helix	trans	-58.2	-38.2	176.8	-75.3	177.9	-179	0	0	112.2	K41 L48 I49	K41-E45 VanDerWaalsContact CE-OE1 3.29Å; K41-E45 WeakPolarHBondContact CE-OE1 3.45Å; K41-E45 WeakPolarHBondContact O-CB 3.45Å; K41-E45 VanDerWaalsContact O-CG 3.26Å; K41-E45 WeakPolarHBondContact O-CG 3.46Å; K41-E45 PolarHBondContact O-N 3.32Å; E45-L48 PolarHBondContact O-N 2.92Å; E45-I49 WeakPolarHBondContact O-CD1 3.25Å; E45-I49 WeakPolarHBondContact O-CG1 3.46Å; E45-I49 PolarHBondContact O-N 3.26Å
46	K	85.5	Confident	77.3	Confident	142 Å²	142	105.4 Å²	105.4	62%	0.617	52%	0.524	S	S	*	.	H	α-helix	trans	-67.8	-42.5	177.2	-174.9	-175.7	172.3	-164.5	0	111.8	T42 E43 E44 L48 I49 E50	T42-K46 WeakPolarHBondContact O-CB 3.41Å; T42-K46 PolarHBondContact O-N 2.9Å; E43-K46 WeakPolarHBondContact O-CB 3.43Å; E43-K46 PolarHBondContact O-N 3.5Å; E44-K46 PolarHBondContact O-N 3.31Å; K46-L48 VanDerWaalsContact C-N 3.34Å; K46-I49 PolarHBondContact O-N 3.2Å; K46-E50 WeakPolarHBondContact O-CB 3.34Å; K46-E50 PolarHBondContact O-N 2.87Å
47	E	87.2	Confident	78.9	Confident	139 Å²	139	105.2 Å²	105.2	65%	0.65	52%	0.523	S	S	*	.	H	α-helix	trans	-61.4	-41.9	174.9	-72.8	-175	173.7	0	0	111.6	E43 E44 E50 A51	E43-E47 WeakPolarHBondContact O-CG 3.33Å; E43-E47 PolarHBondContact O-N 3.34Å; E44-E47 PolarHBondContact O-N 3.05Å; E44-E47 VanDerWaalsContact O-N 3.16Å; E47-E50 PolarHBondContact O-N 3.16Å; E47-A51 WeakPolarHBondContact O-CB 3.07Å; E47-A51 PolarHBondContact O-N 3.3Å
48	L	90.6	Very high	80.2	Confident	96 Å²	96	104 Å²	104	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-63.3	-43.5	175.3	-86.1	98	0	0	0	112.1	E44 E45 K46 E50 A51 L52	E44-L48 HydrophobicContact CG-CD1 3.65Å; E44-L48 WeakPolarHBondContact O-CD1 3.35Å; E44-L48 PolarHBondContact O-N 2.83Å; E45-L48 PolarHBondContact O-N 2.92Å; K46-L48 VanDerWaalsContact C-N 3.34Å; L48-E50 VanDerWaalsContact C-N 3.32Å; L48-A51 PolarHBondContact O-N 3.46Å; L48-L52 WeakPolarHBondContact O-CB 3.43Å; L48-L52 WeakPolarHBondContact O-CD1 3.4Å; L48-L52 PolarHBondContact O-N 3.13Å
49	I	91.3	Very high	81.1	Confident	94 Å²	94	103 Å²	103	48%	0.482	52%	0.515	S	S	.	.	H	α-helix	trans	-63.3	-41.3	177.8	-69.4	163.6	0	0	0	110.5	E45 K46 L52 Q53	E45-I49 WeakPolarHBondContact O-CD1 3.25Å; E45-I49 WeakPolarHBondContact O-CG1 3.46Å; E45-I49 PolarHBondContact O-N 3.26Å; K46-I49 PolarHBondContact O-N 3.2Å; I49-L52 WeakPolarHBondContact O-CB 3.49Å; I49-L52 PolarHBondContact O-N 2.94Å; I49-Q53 WeakPolarHBondContact O-CG 3.5Å; I49-Q53 PolarHBondContact O-N 3.05Å
50	E	91.8	Very high	81.6	Confident	123 Å²	123	106.9 Å²	106.9	58%	0.575	53%	0.526	S	S	*	.	H	α-helix	trans	-65.3	-44.1	177.7	-169.3	166.5	-176.2	0	0	111.5	K46 E47 L48 L52 Q53 E54	K46-E50 WeakPolarHBondContact O-CB 3.34Å; K46-E50 PolarHBondContact O-N 2.87Å; E47-E50 PolarHBondContact O-N 3.16Å; L48-E50 VanDerWaalsContact C-N 3.32Å; E50-L52 VanDerWaalsContact C-N 3.33Å; E50-L52 PolarHBondContact O-N 2.92Å; E50-Q53 PolarHBondContact O-N 2.97Å; E50-E54 PolarHBondContact O-N 3Å
51	A	90.8	Very high	81.8	Confident	51 Å²	51	108.6 Å²	108.6	42%	0.421	54%	0.536	S	S	.	.	H	α-helix	trans	-61.1	-40.6	174.3	0	0	0	0	0	112.4	E47 L48 E54 V55	E47-A51 WeakPolarHBondContact O-CB 3.07Å; E47-A51 PolarHBondContact O-N 3.3Å; L48-A51 PolarHBondContact O-N 3.46Å; A51-E54 PolarHBondContact O-N 3.33Å; A51-V55 WeakPolarHBondContact O-CG2 3.38Å; A51-V55 PolarHBondContact O-N 3.04Å; A51-V55 VanDerWaalsContact O-N 3.07Å
52	L	91.6	Very high	81.8	Confident	109 Å²	109	111.8 Å²	111.8	57%	0.571	55%	0.55	S	S	*	.	H	α-helix	trans	-62.6	-43.4	174.4	-88.7	154	0	0	0	111.8	L48 I49 E50 V55 L56	L48-L52 WeakPolarHBondContact O-CB 3.43Å; L48-L52 WeakPolarHBondContact O-CD1 3.4Å; L48-L52 PolarHBondContact O-N 3.13Å; I49-L52 WeakPolarHBondContact O-CB 3.49Å; I49-L52 PolarHBondContact O-N 2.94Å; E50-L52 VanDerWaalsContact C-N 3.33Å; E50-L52 PolarHBondContact O-N 2.92Å; L52-V55 PolarHBondContact O-N 2.94Å; L52-L56 WeakPolarHBondContact O-CB 3.01Å; L52-L56 WeakPolarHBondContact O-CG 3.34Å; L52-L56 PolarHBondContact O-N 3.42Å
53	Q	90	Very high	81.2	Confident	118 Å²	118	116 Å²	116	55%	0.551	56%	0.564	S	S	*	*	H	α-helix	trans	-63.7	-43.6	176.9	-75	178.9	10.4	0	0	111.7	I49 E50 V55 L56 E57	I49-Q53 WeakPolarHBondContact O-CG 3.5Å; I49-Q53 PolarHBondContact O-N 3.05Å; E50-Q53 PolarHBondContact O-N 2.97Å; Q53-V55 VanDerWaalsContact C-N 3.34Å; Q53-V55 PolarHBondContact O-N 2.89Å; Q53-L56 WeakPolarHBondContact O-CB 3.44Å; Q53-L56 PolarHBondContact O-N 2.91Å; Q53-E57 WeakPolarHBondContact O-CG 3.49Å; Q53-E57 PolarHBondContact O-N 3.43Å
54	E	88.7	Confident	80.4	Confident	104 Å²	104	115.7 Å²	115.7	49%	0.486	57%	0.566	S	S	.	*	H	α-helix	trans	-60.2	-43.6	176.7	-168.9	-168.3	164.4	0	0	111.6	E50 A51 E57 K58	E50-E54 PolarHBondContact O-N 3Å; A51-E54 PolarHBondContact O-N 3.33Å; E54-E57 PolarHBondContact O-N 3.3Å; E54-K58 WeakPolarHBondContact O-CB 3.47Å; E54-K58 WeakPolarHBondContact O-CG 3.2Å; E54-K58 PolarHBondContact O-N 3.49Å; E54-K58 WeakPolarHBondContact OE1-CE 3.23Å; E54-K58 IonicContact OE1-NZ 2.61Å; E54-K58 PolarHBondContact OE1-NZ 2.74Å
55	V	89.8	Confident	79.4	Confident	81 Å²	81	112 Å²	112	49%	0.491	55%	0.552	S	S	.	*	H	α-helix	trans	-64.1	-43.1	176.2	172.4	0	0	0	0	111	A51 L52 Q53 E57 K58 L59	A51-V55 WeakPolarHBondContact O-CG2 3.38Å; A51-V55 PolarHBondContact O-N 3.04Å; A51-V55 VanDerWaalsContact O-N 3.07Å; L52-V55 PolarHBondContact O-N 2.94Å; Q53-V55 VanDerWaalsContact C-N 3.34Å; Q53-V55 PolarHBondContact O-N 2.89Å; V55-E57 PolarHBondContact O-N 2.62Å; V55-K58 PolarHBondContact O-N 2.85Å; V55-L59 HydrophobicContact CG1-CD1 3.81Å; V55-L59 HydrophobicContact CG1-CG 4.26Å; V55-L59 WeakPolarHBondContact O-CB 3.46Å; V55-L59 VanDerWaalsContact O-CG 3.25Å; V55-L59 WeakPolarHBondContact O-CG 3.42Å; V55-L59 PolarHBondContact O-N 3.33Å
56	L	83.9	Confident	78.5	Confident	112 Å²	112	110.5 Å²	110.5	59%	0.586	55%	0.552	S	S	*	*	H	α-helix	trans	-61.5	-42.1	176.5	-79	163.4	0	0	0	111.9	L52 Q53 L59 K60	L52-L56 WeakPolarHBondContact O-CB 3.01Å; L52-L56 WeakPolarHBondContact O-CG 3.34Å; L52-L56 PolarHBondContact O-N 3.42Å; Q53-L56 WeakPolarHBondContact O-CB 3.44Å; Q53-L56 PolarHBondContact O-N 2.91Å; L56-L59 PolarHBondContact O-N 2.95Å; L56-K60 VanDerWaalsContact O-CB 3.25Å; L56-K60 WeakPolarHBondContact O-CB 3.18Å; L56-K60 PolarHBondContact O-N 2.94Å
57	E	84.1	Confident	77.1	Confident	125 Å²	125	108.4 Å²	108.4	58%	0.584	56%	0.556	S	S	*	*	H	α-helix	trans	-66.1	-43.6	175.4	-71.4	-148.9	143.8	0	0	112.2	Q53 E54 V55 L59 K60 N61	Q53-E57 WeakPolarHBondContact O-CG 3.49Å; Q53-E57 PolarHBondContact O-N 3.43Å; E54-E57 PolarHBondContact O-N 3.3Å; V55-E57 PolarHBondContact O-N 2.62Å; E57-L59 VanDerWaalsContact C-N 3.3Å; E57-L59 PolarHBondContact O-N 2.83Å; E57-K60 PolarHBondContact O-N 2.84Å; E57-N61 WeakPolarHBondContact O-CB 3.36Å; E57-N61 PolarHBondContact O-N 3.09Å
58	K	79.8	Confident	75.5	Confident	116 Å²	116	110.5 Å²	110.5	50%	0.504	57%	0.565	S	S	.	*	H	α-helix	trans	-62.5	-36.1	175.1	-75.8	-174.1	-176.8	168.9	0	112.3	E54 V55 K62	E54-K58 WeakPolarHBondContact O-CB 3.47Å; E54-K58 WeakPolarHBondContact O-CG 3.2Å; E54-K58 PolarHBondContact O-N 3.49Å; E54-K58 WeakPolarHBondContact OE1-CE 3.23Å; E54-K58 IonicContact OE1-NZ 2.61Å; E54-K58 PolarHBondContact OE1-NZ 2.74Å; V55-K58 PolarHBondContact O-N 2.85Å; K58-K62 WeakPolarHBondContact O-CD 3.26Å; K58-K62 VanDerWaalsContact O-CG 3.26Å; K58-K62 WeakPolarHBondContact O-CG 3.07Å; K58-K62 PolarHBondContact O-N 2.87Å
59	L	73.1	Confident	73.9	Confident	75 Å²	75	112.3 Å²	112.3	39%	0.393	57%	0.569	S	S	.	*	H	α-helix	trans	-74.9	-37	175.7	-72.1	174.7	0	0	0	112.6	V55 L56 E57 K62 Q63 L64	V55-L59 HydrophobicContact CG1-CD1 3.81Å; V55-L59 HydrophobicContact CG1-CG 4.26Å; V55-L59 WeakPolarHBondContact O-CB 3.46Å; V55-L59 VanDerWaalsContact O-CG 3.25Å; V55-L59 WeakPolarHBondContact O-CG 3.42Å; V55-L59 PolarHBondContact O-N 3.33Å; L56-L59 PolarHBondContact O-N 2.95Å; E57-L59 VanDerWaalsContact C-N 3.3Å; E57-L59 PolarHBondContact O-N 2.83Å; L59-K62 CarbonylContact O-C 3.48Å; L59-K62 WeakPolarHBondContact O-CA 3.35Å; L59-K62 PolarHBondContact O-N 2.8Å; L59-K62 VanDerWaalsContact O-N 3.14Å; L59-Q63 PolarHBondContact O-N 3.07Å; L59-L64 HydrophobicContact CB-CD1 4.48Å; L59-L64 HydrophobicContact CD2-CD1 4.14Å
60	K	69.7	Low	72.3	Confident	156 Å²	156	114.7 Å²	114.7	68%	0.678	58%	0.576	S	S	*	*	H	α-helix	trans	-62	-43.3	173.7	176.7	-177.5	164.3	-170.2	0	111.3	L56 E57 K62 Q63	L56-K60 VanDerWaalsContact O-CB 3.25Å; L56-K60 WeakPolarHBondContact O-CB 3.18Å; L56-K60 PolarHBondContact O-N 2.94Å; E57-K60 PolarHBondContact O-N 2.84Å; K60-K62 PolarHBondContact O-N 2.95Å; K60-Q63 WeakPolarHBondContact O-CA 3.37Å; K60-Q63 PolarHBondContact O-N 3.39Å
61	N	62.9	Low	70.7	Confident	137 Å²	137	117.4 Å²	117.4	73%	0.733	59%	0.593	S	S	*	*	H	α-helix	trans	-68.8	-21.1	175.3	-71.8	-19.2	0	0	0	112.8	E57 Q63	E57-N61 WeakPolarHBondContact O-CB 3.36Å; E57-N61 PolarHBondContact O-N 3.09Å; N61-Q63 VanDerWaalsContact C-N 3.29Å
62	K	65.1	Low	69.7	Low	158 Å²	158	118.1 Å²	118.1	69%	0.687	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.6	11.7	170.4	-70.9	172.9	-175.6	-74.5	0	113.3	K58 L59 K60 L64	K58-K62 WeakPolarHBondContact O-CD 3.26Å; K58-K62 VanDerWaalsContact O-CG 3.26Å; K58-K62 WeakPolarHBondContact O-CG 3.07Å; K58-K62 PolarHBondContact O-N 2.87Å; L59-K62 CarbonylContact O-C 3.48Å; L59-K62 WeakPolarHBondContact O-CA 3.35Å; L59-K62 PolarHBondContact O-N 2.8Å; L59-K62 VanDerWaalsContact O-N 3.14Å; K60-K62 PolarHBondContact O-N 2.95Å; K62-L64 PolarHBondContact O-N 3.38Å; K62-L64 VanDerWaalsContact O-N 3.1Å
63	Q	59.5	Low	68.9	Low	169 Å²	169	120.4 Å²	120.4	79%	0.79	61%	0.607	S	S	*	*	T	Hydrogen-bonded Turn	trans	21.7	73	176.9	-164.5	166.6	21.4	0	0	113.5	L59 K60 N61 P65	L59-Q63 PolarHBondContact O-N 3.07Å; K60-Q63 WeakPolarHBondContact O-CA 3.37Å; K60-Q63 PolarHBondContact O-N 3.39Å; N61-Q63 VanDerWaalsContact C-N 3.29Å; Q63-P65 WeakPolarHBondContact O-CD 3.39Å
64	L	57.6	Low	68.7	Low	109 Å²	109	117.4 Å²	117.4	57%	0.571	60%	0.595	S	S	*	*			trans	-59.4	122.9	168.7	-72.4	161.3	0	0	0	107.7	L59 K62 S66	L59-L64 HydrophobicContact CB-CD1 4.48Å; L59-L64 HydrophobicContact CD2-CD1 4.14Å; K62-L64 PolarHBondContact O-N 3.38Å; K62-L64 VanDerWaalsContact O-N 3.1Å; L64-S66 PolarHBondContact O-N 2.91Å
65	P	56.2	Low	68.7	Low	41 Å²	41	115.6 Å²	115.6	27%	0.266	59%	0.592	S	S	.	*			trans	-57.6	138.2	175.7	22.9	-31.1	0	0	0	108.6	Q63 S67 K69 W73	Q63-P65 WeakPolarHBondContact O-CD 3.39Å; P65-S67 PolarHBondContact O-N 2.73Å; P65-K69 HydrophobicContact CB-CB 4.45Å; P65-W73 HydrophobicContact CG-CG 4.17Å
66	S	59.5	Low	68.7	Low	66 Å²	66	116.8 Å²	116.8	46%	0.462	60%	0.601	S	S	.	*			trans	-44.4	134.8	176.6	59.3	0	0	0	0	109.4	L64 E68 K69	L64-S66 PolarHBondContact O-N 2.91Å; S66-E68 PolarHBondContact O-N 2.87Å; S66-K69 PolarHBondContact O-N 3.3Å
67	S	55.7	Low	69	Low	98 Å²	98	112.3 Å²	112.3	69%	0.685	58%	0.579	S	S	*	*	G	3₁₀ helix	trans	-49.3	-28.1	-168.6	42.4	0	0	0	0	114.2	P65 K69 K70	P65-S67 PolarHBondContact O-N 2.73Å; S67-K69 VanDerWaalsContact C-N 3.28Å; S67-K69 PolarHBondContact O-N 3.42Å; S67-K70 PolarHBondContact O-N 3.26Å
68	E	54.8	Low	69.1	Low	182 Å²	182	110.6 Å²	110.6	85%	0.85	58%	0.577	S	S	*	*	G	3₁₀ helix	trans	-65.4	-20	175.5	-65.5	-176.4	118.8	0	0	115.1	S66	S66-E68 PolarHBondContact O-N 2.87Å
69	K	56.3	Low	69.1	Low	134 Å²	134	110 Å²	110	58%	0.583	59%	0.594	S	S	*	*	G	3₁₀ helix	trans	-97.3	3.9	-178.7	-61.7	-174.4	-178.6	178.3	0	114.1	P65 S66 S67 L71	P65-K69 HydrophobicContact CB-CB 4.45Å; S66-K69 PolarHBondContact O-N 3.3Å; S67-K69 VanDerWaalsContact C-N 3.28Å; S67-K69 PolarHBondContact O-N 3.42Å; K69-L71 VanDerWaalsContact C-N 3.32Å; K69-L71 PolarHBondContact O-N 3.48Å
70	K	57.8	Low	69.3	Low	145 Å²	145	109.9 Å²	109.9	63%	0.63	61%	0.611	S	S	*	*			trans	-67	-27.8	-173.3	-83.1	-173.8	174	-175.2	0	114	S67 G72	S67-K70 PolarHBondContact O-N 3.26Å; K70-G72 PolarHBondContact O-N 2.92Å
71	L	57.8	Low	70.1	Confident	179 Å²	179	107.6 Å²	107.6	94%	0.937	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.8	100.1	176.2	-138.4	79.5	0	0	0	109.6	K69	K69-L71 VanDerWaalsContact C-N 3.32Å; K69-L71 PolarHBondContact O-N 3.48Å
72	G	69.8	Low	71.5	Confident	67 Å²	67	106 Å²	106	69%	0.691	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	96.2	21.4	-179.8	0	0	0	0	0	115.1	K70 L74	K70-G72 PolarHBondContact O-N 2.92Å; G72-L74 PolarHBondContact O-N 2.96Å
73	W	76	Confident	72.9	Confident	156 Å²	156	98.5 Å²	98.5	59%	0.591	56%	0.558	S	S	*	*			trans	-63.8	128.4	167	-176.1	83.8	0	0	0	110.1	P65	P65-W73 HydrophobicContact CG-CG 4.17Å
74	L	85.4	Confident	74.6	Confident	56 Å²	56	90.5 Å²	90.5	29%	0.293	52%	0.521	S	S	.	.			trans	-127.1	149.4	176.8	-68.6	173	0	0	0	108.7	G72 K93	G72-L74 PolarHBondContact O-N 2.96Å; L74-K93 HydrophobicContact CD1-CB 3.37Å; L74-K93 HydrophobicContact CD1-CD 4.33Å
75	P	88.4	Confident	76.3	Confident	65 Å²	65	88.2 Å²	88.2	42%	0.422	51%	0.511	S	S	.	.	P	Polyproline II helix	trans	-58.5	152.2	173.5	27.4	-35.5	0	0	0	110.5	C95 G96	P75-C95 CarbonylContact O-C 3.41Å; P75-C95 WeakPolarHBondContact O-CA 3.29Å; P75-C95 WeakPolarHBondContact O-CB 3.34Å; P75-G96 PolarHBondContact O-N 3.38Å
76	P	88.6	Confident	78.1	Confident	107 Å²	107	94 Å²	94	70%	0.695	53%	0.527	S	S	*	.	B	Isolated β-bridge	trans	-64.8	145.8	176.4	28.3	-34.3	0	0	0	111.2	G96	P76-G96 CarbonylContact C-O 3.54Å; P76-G96 VanDerWaalsContact CA-O 3.32Å; P76-G96 WeakPolarHBondContact CA-O 3.26Å
77	C	91.3	Very high	79.8	Confident	17 Å²	17	99.8 Å²	99.8	12%	0.115	55%	0.545	C	S	.	.	P	Polyproline II helix	trans	-72	142.1	175.2	-60.3	0	0	0	0	111.4	C95 G96 C110	C77-C95 WeakPolarHBondContact CA-SG 3.28Å; C77-C95 HydrophobicContact CB-CB 3.92Å; C77-C95 WeakPolarHBondContact CB-SG 3.37Å; C77-C95 WeakPolarHBondContact SG-CB 3.34Å; C77-C95 CovalentContact SG-SG 2.03Å; C77-C95 PolarHBondContact SG-SG 2.99Å; C77-G96 PolarHBondContact N-O 2.82Å; C77-C110 VanDerWaalsContact SG-SG 3.65Å
78	V	84.8	Confident	81.5	Confident	89 Å²	89	98.1 Å²	98.1	54%	0.539	54%	0.542	S	S	.	.	P	Polyproline II helix	trans	-74.1	146.4	165.6	-173.1	0	0	0	0	108.6	G80 E81	V78-G80 PolarHBondContact O-N 2.98Å; V78-E81 HydrophobicContact CB-CB 4.5Å; V78-E81 HydrophobicContact CB-CG 3.89Å; V78-E81 PolarHBondContact O-N 3.46Å; V78-E81 VanDerWaalsContact O-N 3.12Å
79	A	80.8	Confident	83.3	Confident	105 Å²	105	94.1 Å²	94.1	87%	0.868	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	122.4	179.1	0	0	0	0	0	110.7
80	G	77	Confident	85	Confident	72 Å²	72	97.8 Å²	97.8	74%	0.742	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	89.7	-2.3	179.8	0	0	0	0	0	116	V78	V78-G80 PolarHBondContact O-N 2.98Å
81	E	85.8	Confident	86.8	Confident	108 Å²	108	94.2 Å²	94.2	51%	0.505	54%	0.538	S	S	.	.	S	Bend	trans	-82.4	161.3	176	-73.5	-170	165.3	0	0	113.7	V78 C83	V78-E81 HydrophobicContact CB-CB 4.5Å; V78-E81 HydrophobicContact CB-CG 3.89Å; V78-E81 PolarHBondContact O-N 3.46Å; V78-E81 VanDerWaalsContact O-N 3.12Å; E81-C83 PolarHBondContact O-N 2.88Å
82	Q	92.4	Very high	88.4	Confident	104 Å²	104	87.3 Å²	87.3	49%	0.486	51%	0.51	S	S	.	.	B	Isolated β-bridge	trans	-72.9	125.3	173.9	-73.1	-179	-23.1	0	0	111.1	L108	Q82-L108 CarbonylContact C-O 3.57Å; Q82-L108 WeakPolarHBondContact CA-O 3.38Å
83	C	94.6	Very high	89.5	Confident	0 Å²	0	90 Å²	90	0%	0	50%	0.503	C	S	.	.	S	Bend	trans	-85.8	-16.9	179	61.8	0	0	0	0	113.5	E81 K93 L94 C103 L108 Q109	E81-C83 PolarHBondContact O-N 2.88Å; C83-K93 WeakPolarHBondContact O-CA 3.26Å; C83-L94 PolarHBondContact O-N 3.06Å; C83-C103 VanDerWaalsContact C-SG 3.51Å; C83-C103 HydrophobicContact CB-CB 3.72Å; C83-C103 WeakPolarHBondContact CB-SG 3.46Å; C83-C103 WeakPolarHBondContact SG-CA 3.46Å; C83-C103 WeakPolarHBondContact SG-CB 3.43Å; C83-C103 CovalentContact SG-SG 2.02Å; C83-C103 PolarHBondContact SG-SG 3.38Å; C83-L108 PolarHBondContact N-O 2.94Å; C83-L108 VanDerWaalsContact SG-C 3.52Å; C83-L108 PolarHBondContact SG-O 3.12Å; C83-Q109 VanDerWaalsContact SG-CA 3.58Å; C83-Q109 PolarHBondContact SG-O 2.93Å
84	A	95.1	Very high	90.3	Very high	0 Å²	0	86.7 Å²	86.7	0%	0	50%	0.496	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.9	163	178.6	0	0	0	0	0	112	I91 G92 C103 F105 L108	A84-I91 HydrophobicContact CB-CG2 3.96Å; A84-G92 CarbonylContact C-O 3.41Å; A84-G92 WeakPolarHBondContact CA-O 3.27Å; A84-G92 WeakPolarHBondContact CB-O 3.48Å; A84-C103 VanDerWaalsContact CB-SG 3.55Å; A84-F105 HydrophobicContact CB-CD1 3.89Å; A84-F105 HydrophobicContact CB-CE1 3.92Å; A84-L108 HydrophobicContact CB-CD2 4.08Å; A84-L108 WeakPolarHBondContact O-CB 3.35Å
85	V	94.2	Very high	90.6	Very high	61 Å²	61	84.5 Å²	84.5	37%	0.37	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	145.1	174.6	-69.2	0	0	0	0	110.5	I91 G92 L94	V85-I91 WeakPolarHBondContact O-CA 3.43Å; V85-G92 PolarHBondContact N-O 2.94Å; V85-G92 PolarHBondContact O-N 3.31Å; V85-L94 HydrophobicContact CG1-CD1 3.66Å; V85-L94 HydrophobicContact CG1-CD2 4.25Å; V85-L94 HydrophobicContact CG1-CG 4.08Å; V85-L94 HydrophobicContact CG2-CD2 4.05Å; V85-L94 HydrophobicContact CG2-CG 4.45Å
86	R	94.9	Very high	90.7	Very high	162 Å²	162	82.8 Å²	82.8	61%	0.611	48%	0.479	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.7	125.2	177.8	-170.6	171.9	-173.9	142.6	-2.1	110.3	G88 I91	R86-G88 WeakPolarHBondContact CG-O 3.35Å; R86-G88 PolarHBondContact NE-O 2.97Å; R86-I91 HydrophobicContact CG-CG1 4.29Å
87	K	93.8	Very high	90.8	Very high	189 Å²	189	79.1 Å²	79.1	82%	0.822	46%	0.456	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.1	96.2	171.5	-166.1	171.2	-177.6	175	0	108.4	A89 R90	K87-A89 PolarHBondContact O-N 3.45Å; K87-R90 PolarHBondContact N-O 2.99Å; K87-R90 PolarHBondContact O-N 3.01Å
88	G	91.4	Very high	90.7	Very high	62 Å²	62	81.8 Å²	81.8	64%	0.639	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.7	-122.4	-172.4	0	0	0	0	0	112.2	R86	R86-G88 WeakPolarHBondContact CG-O 3.35Å; R86-G88 PolarHBondContact NE-O 2.97Å
89	A	92.1	Very high	90.7	Very high	99 Å²	99	89.6 Å²	89.6	82%	0.818	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.4	-10.6	176.8	0	0	0	0	0	113.9	K87	K87-A89 PolarHBondContact O-N 3.45Å
90	R	93.8	Very high	90.8	Very high	211 Å²	211	88.4 Å²	88.4	80%	0.796	49%	0.491	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.3	144.5	-176.6	-60.5	-173.8	-173.8	-148.9	2.1	111.2	K87	K87-R90 PolarHBondContact N-O 2.99Å; K87-R90 PolarHBondContact O-N 3.01Å
91	I	93.8	Very high	91.4	Very high	69 Å²	69	87.1 Å²	87.1	35%	0.354	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	126.1	177	-55.7	-178.2	0	0	0	108.8	A84 V85 R86 F105	A84-I91 HydrophobicContact CB-CG2 3.96Å; V85-I91 WeakPolarHBondContact O-CA 3.43Å; R86-I91 HydrophobicContact CG-CG1 4.29Å; I91-F105 HydrophobicContact CD1-CB 3.98Å; I91-F105 HydrophobicContact CD1-CD1 4.42Å; I91-F105 HydrophobicContact CD1-CG 4.31Å; I91-F105 HydrophobicContact CG2-CD1 3.43Å; I91-F105 VanDerWaalsContact CG2-CD1 3.43Å; I91-F105 HydrophobicContact CG2-CE1 3.69Å; I91-F105 HydrophobicContact CG2-CG 4.31Å
92	G	92.6	Very high	91.6	Very high	34 Å²	34	88.6 Å²	88.6	35%	0.351	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	134.8	176	0	0	0	0	0	110.7	A84 V85	A84-G92 CarbonylContact C-O 3.41Å; A84-G92 WeakPolarHBondContact CA-O 3.27Å; A84-G92 WeakPolarHBondContact CB-O 3.48Å; V85-G92 PolarHBondContact N-O 2.94Å; V85-G92 PolarHBondContact O-N 3.31Å
93	K	92.8	Very high	91.6	Very high	124 Å²	124	84.6 Å²	84.6	54%	0.539	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	139.8	173.5	-69.4	-177	-178.5	179.9	0	110.3	L74 C83 F105	L74-K93 HydrophobicContact CD1-CB 3.37Å; L74-K93 HydrophobicContact CD1-CD 4.33Å; C83-K93 WeakPolarHBondContact O-CA 3.26Å; K93-F105 HydrophobicContact CG-CE1 4.19Å; K93-F105 HydrophobicContact CG-CZ 4.43Å
94	L	92	Very high	91.6	Very high	87 Å²	87	87.5 Å²	87.5	46%	0.455	48%	0.478	S	S	.	.			trans	-98	-39.9	177.3	-63.6	-177.6	0	0	0	112	C83 V85	C83-L94 PolarHBondContact O-N 3.06Å; V85-L94 HydrophobicContact CG1-CD1 3.66Å; V85-L94 HydrophobicContact CG1-CD2 4.25Å; V85-L94 HydrophobicContact CG1-CG 4.08Å; V85-L94 HydrophobicContact CG2-CD2 4.05Å; V85-L94 HydrophobicContact CG2-CG 4.45Å
95	C	92.6	Very high	91.4	Very high	9 Å²	9	91.9 Å²	91.9	6%	0.061	50%	0.497	C	S	.	.	S	Bend	trans	-146	162.6	-175.3	55.4	0	0	0	0	110.8	P75 C77	P75-C95 CarbonylContact O-C 3.41Å; P75-C95 WeakPolarHBondContact O-CA 3.29Å; P75-C95 WeakPolarHBondContact O-CB 3.34Å; C77-C95 WeakPolarHBondContact CA-SG 3.28Å; C77-C95 HydrophobicContact CB-CB 3.92Å; C77-C95 WeakPolarHBondContact CB-SG 3.37Å; C77-C95 WeakPolarHBondContact SG-CB 3.34Å; C77-C95 CovalentContact SG-SG 2.03Å; C77-C95 PolarHBondContact SG-SG 2.99Å
96	G	90.8	Very high	91.3	Very high	29 Å²	29	94.3 Å²	94.3	30%	0.299	52%	0.517	S	S	.	.	B	Isolated β-bridge	trans	-89.1	123.4	172.9	0	0	0	0	0	111.2	P75 P76 C77	P75-G96 PolarHBondContact O-N 3.38Å; P76-G96 CarbonylContact C-O 3.54Å; P76-G96 VanDerWaalsContact CA-O 3.32Å; P76-G96 WeakPolarHBondContact CA-O 3.26Å; C77-G96 PolarHBondContact N-O 2.82Å
97	C	90.9	Very high	91.2	Very high	31 Å²	31	91 Å²	91	21%	0.209	51%	0.511	C	S	.	.	P	Polyproline II helix	trans	-63	144.7	174.3	-65.5	0	0	0	0	111.3	T101 C103 C110	C97-T101 WeakPolarHBondContact CB-O 3.49Å; C97-T101 WeakPolarHBondContact CB-OG1 3.36Å; C97-C103 PolarHBondContact SG-N 3.41Å; C97-C103 VanDerWaalsContact SG-N 3.43Å; C97-C110 WeakPolarHBondContact CA-SG 3.29Å; C97-C110 HydrophobicContact CB-CB 3.78Å; C97-C110 WeakPolarHBondContact CB-SG 3.32Å; C97-C110 VanDerWaalsContact SG-CA 3.53Å; C97-C110 WeakPolarHBondContact SG-CB 3.34Å; C97-C110 CovalentContact SG-SG 2.04Å; C97-C110 PolarHBondContact SG-SG 3.31Å
98	P	87.7	Confident	91.2	Very high	73 Å²	73	83.4 Å²	83.4	47%	0.474	48%	0.479	S	S	.	.	P	Polyproline II helix	trans	-62.1	161.8	178.2	26.5	-34	0	0	0	111.6	G100 T101	P98-G100 PolarHBondContact O-N 3.13Å; P98-T101 WeakPolarHBondContact CD-OG1 3.31Å; P98-T101 WeakPolarHBondContact CG-OG1 3.34Å; P98-T101 PolarHBondContact O-N 2.75Å; P98-T101 VanDerWaalsContact O-N 3.09Å; P98-T101 PolarHBondContact O-OG1 3.46Å
99	R	84.6	Confident	91.3	Very high	253 Å²	253	84.7 Å²	84.7	96%	0.955	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.1	130.3	-178.6	-71.5	-177.2	173.2	163	-1.8	110.8
100	G	84.7	Confident	91.3	Very high	80 Å²	80	82 Å²	82	83%	0.825	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	92.7	-4.8	179.5	0	0	0	0	0	115.1	P98	P98-G100 PolarHBondContact O-N 3.13Å
101	T	88.6	Confident	91	Very high	45 Å²	45	76.3 Å²	76.3	28%	0.276	44%	0.441	S	S	.	.			trans	-122.8	147.9	174.5	60	0	0	0	0	110.6	C97 P98 A111	C97-T101 WeakPolarHBondContact CB-O 3.49Å; C97-T101 WeakPolarHBondContact CB-OG1 3.36Å; P98-T101 WeakPolarHBondContact CD-OG1 3.31Å; P98-T101 WeakPolarHBondContact CG-OG1 3.34Å; P98-T101 PolarHBondContact O-N 2.75Å; P98-T101 VanDerWaalsContact O-N 3.09Å; P98-T101 PolarHBondContact O-OG1 3.46Å; T101-A111 CarbonylContact C-O 3.4Å; T101-A111 WeakPolarHBondContact CA-O 3.49Å
102	L	91	Very high	90.9	Very high	139 Å²	139	76.7 Å²	76.7	73%	0.728	45%	0.445	S	S	*	.			trans	-117.7	155	172.7	-75.1	103.1	0	0	0	110.4	N104 C110 A111	L102-N104 PolarHBondContact O-N 3.07Å; L102-N104 VanDerWaalsContact O-N 3.16Å; L102-C110 WeakPolarHBondContact O-CA 3.5Å; L102-A111 PolarHBondContact N-O 3.35Å; L102-A111 PolarHBondContact O-N 3.26Å; L102-A111 VanDerWaalsContact O-O 3.13Å
103	C	92.4	Very high	90.8	Very high	19 Å²	19	78.9 Å²	78.9	13%	0.128	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.6	111.4	174.4	-174.6	0	0	0	0	109.5	C83 A84 C97 F105	C83-C103 VanDerWaalsContact C-SG 3.51Å; C83-C103 HydrophobicContact CB-CB 3.72Å; C83-C103 WeakPolarHBondContact CB-SG 3.46Å; C83-C103 WeakPolarHBondContact SG-CA 3.46Å; C83-C103 WeakPolarHBondContact SG-CB 3.43Å; C83-C103 CovalentContact SG-SG 2.02Å; C83-C103 PolarHBondContact SG-SG 3.38Å; A84-C103 VanDerWaalsContact CB-SG 3.55Å; C97-C103 PolarHBondContact SG-N 3.41Å; C97-C103 VanDerWaalsContact SG-N 3.43Å; C103-F105 PolarHBondContact O-N 2.97Å
104	N	93.1	Very high	90.7	Very high	62 Å²	62	76.4 Å²	76.4	33%	0.332	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.5	111.3	174.3	-176.5	-40	0	0	0	109.1	L102 S106 I107 L108 Q109 A111	L102-N104 PolarHBondContact O-N 3.07Å; L102-N104 VanDerWaalsContact O-N 3.16Å; N104-S106 PolarHBondContact O-N 3.5Å; N104-S106 WeakPolarHBondContact OD1-CA 3.41Å; N104-S106 VanDerWaalsContact OD1-CB 3.28Å; N104-S106 WeakPolarHBondContact OD1-CB 3.19Å; N104-S106 PolarHBondContact OD1-N 3.36Å; N104-I107 HydrophobicContact CB-CD1 4.17Å; N104-I107 HydrophobicContact CB-CG1 3.68Å; N104-I107 PolarHBondContact O-N 3.37Å; N104-I107 PolarHBondContact OD1-N 3.2Å; N104-L108 WeakPolarHBondContact O-CA 3.29Å; N104-L108 PolarHBondContact O-N 3.47Å; N104-Q109 WeakPolarHBondContact CB-O 3.45Å; N104-Q109 PolarHBondContact N-O 2.93Å; N104-Q109 PolarHBondContact O-N 3.26Å; N104-A111 HydrophobicContact CB-CB 4.38Å
105	F	92.6	Very high	90.6	Very high	91 Å²	91	75.8 Å²	75.8	40%	0.399	45%	0.445	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.3	-8.4	-176.2	-64.8	-59.8	0	0	0	115	A84 I91 K93 C103 L108	A84-F105 HydrophobicContact CB-CD1 3.89Å; A84-F105 HydrophobicContact CB-CE1 3.92Å; I91-F105 HydrophobicContact CD1-CB 3.98Å; I91-F105 HydrophobicContact CD1-CD1 4.42Å; I91-F105 HydrophobicContact CD1-CG 4.31Å; I91-F105 HydrophobicContact CG2-CD1 3.43Å; I91-F105 VanDerWaalsContact CG2-CD1 3.43Å; I91-F105 HydrophobicContact CG2-CE1 3.69Å; I91-F105 HydrophobicContact CG2-CG 4.31Å; K93-F105 HydrophobicContact CG-CE1 4.19Å; K93-F105 HydrophobicContact CG-CZ 4.43Å; C103-F105 PolarHBondContact O-N 2.97Å; F105-L108 WeakPolarHBondContact O-CD2 3.34Å
106	S	91.7	Very high	90.5	Very high	113 Å²	113	79.9 Å²	79.9	79%	0.79	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.1	-42.7	175	-56	0	0	0	0	111.6	N104	N104-S106 PolarHBondContact O-N 3.5Å; N104-S106 WeakPolarHBondContact OD1-CA 3.41Å; N104-S106 VanDerWaalsContact OD1-CB 3.28Å; N104-S106 WeakPolarHBondContact OD1-CB 3.19Å; N104-S106 PolarHBondContact OD1-N 3.36Å
107	I	92.4	Very high	90.5	Very high	92 Å²	92	83.3 Å²	83.3	47%	0.472	48%	0.48	S	S	.	.	T	Hydrogen-bonded Turn	trans	-100.6	-6	178.1	60.8	169.4	0	0	0	113.2	N104 Q109	N104-I107 HydrophobicContact CB-CD1 4.17Å; N104-I107 HydrophobicContact CB-CG1 3.68Å; N104-I107 PolarHBondContact O-N 3.37Å; N104-I107 PolarHBondContact OD1-N 3.2Å; I107-Q109 HydrophobicContact CD1-CB 4.04Å; I107-Q109 HydrophobicContact CG1-CB 4.13Å; I107-Q109 PolarHBondContact O-N 3.28Å
108	L	93.7	Very high	90.4	Very high	30 Å²	30	87.1 Å²	87.1	16%	0.157	50%	0.499	C	S	.	.	T	Hydrogen-bonded Turn	trans	58.7	25.9	-179	-56.8	177.5	0	0	0	114.1	Q82 C83 A84 N104 F105	Q82-L108 CarbonylContact C-O 3.57Å; Q82-L108 WeakPolarHBondContact CA-O 3.38Å; C83-L108 PolarHBondContact N-O 2.94Å; C83-L108 VanDerWaalsContact SG-C 3.52Å; C83-L108 PolarHBondContact SG-O 3.12Å; A84-L108 HydrophobicContact CB-CD2 4.08Å; A84-L108 WeakPolarHBondContact O-CB 3.35Å; N104-L108 WeakPolarHBondContact O-CA 3.29Å; N104-L108 PolarHBondContact O-N 3.47Å; F105-L108 WeakPolarHBondContact O-CD2 3.34Å
109	Q	92.8	Very high	90.7	Very high	88 Å²	88	88.2 Å²	88.2	41%	0.411	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	158.9	-177.5	-72.1	177.2	-16.2	0	0	111.2	C83 N104 I107	C83-Q109 VanDerWaalsContact SG-CA 3.58Å; C83-Q109 PolarHBondContact SG-O 2.93Å; N104-Q109 WeakPolarHBondContact CB-O 3.45Å; N104-Q109 PolarHBondContact N-O 2.93Å; N104-Q109 PolarHBondContact O-N 3.26Å; I107-Q109 HydrophobicContact CD1-CB 4.04Å; I107-Q109 HydrophobicContact CG1-CB 4.13Å; I107-Q109 PolarHBondContact O-N 3.28Å
110	C	92.3	Very high	91.2	Very high	42 Å²	42	74.4 Å²	74.4	28%	0.284	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	127.2	173.6	-61.4	0	0	0	0	110.2	C77 C97 L102	C77-C110 VanDerWaalsContact SG-SG 3.65Å; C97-C110 WeakPolarHBondContact CA-SG 3.29Å; C97-C110 HydrophobicContact CB-CB 3.78Å; C97-C110 WeakPolarHBondContact CB-SG 3.32Å; C97-C110 VanDerWaalsContact SG-CA 3.53Å; C97-C110 WeakPolarHBondContact SG-CB 3.34Å; C97-C110 CovalentContact SG-SG 2.04Å; C97-C110 PolarHBondContact SG-SG 3.31Å; L102-C110 WeakPolarHBondContact O-CA 3.5Å
111	A	88.6	Confident	91.7	Very high	92 Å²	92	73.9 Å²	73.9	76%	0.76	43%	0.431	S	S	*	.			trans	-138.4	0	176.7	0	0	0	0	0	110.9	T101 L102 N104	T101-A111 CarbonylContact C-O 3.4Å; T101-A111 WeakPolarHBondContact CA-O 3.49Å; L102-A111 PolarHBondContact N-O 3.35Å; L102-A111 PolarHBondContact O-N 3.26Å; L102-A111 VanDerWaalsContact O-O 3.13Å; N104-A111 HydrophobicContact CB-CB 4.38Å

Retrieved 111 of 111 residues in 153.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).