A0A087XD20_POEFO Loading...

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087XD20, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 127 aa.

						>A0A087XD20_POEFO|A0A087XD20
MADYREAPLATRPKTLDPNEYFNLSPDYRRAEEERAALRANLKRQYQLQLNNPHRTELIEDPALTRWVYARANPYPHFRPTKKTSLLGVMFGVVPLFALYYIFKTDRDKKEEMIKAGTLNRKFSLSY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.5	Low	86	Confident	244 Å²	244	134 Å²	134	100%	1.202	73%	0.728	S	S	*	*				0	137.3	0	-87.4	168.1	163.8	0	0	107.2
2	A	72.8	Confident	86.4	Confident	104 Å²	104	130.6 Å²	130.6	86%	0.86	70%	0.696	S	S	*	*	P	Polyproline II helix	trans	-80.2	133.6	179.9	0	0	0	0	0	110.1
3	D	86.1	Confident	86.7	Confident	160 Å²	160	124.9 Å²	124.9	86%	0.856	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-68.6	139.4	176.7	-66.1	-37	0	0	0	111.2	R5	D3-R5 PolarHBondContact O-N 3.01Å
4	Y	87.9	Confident	86.8	Confident	90 Å²	90	127.8 Å²	127.8	35%	0.353	68%	0.675	S	S	.	*	P	Polyproline II helix	trans	-71.5	117.5	-179.7	-177.2	-89	0	0	0	111.3	E6 A10 T11 R12 L16	Y4-E6 HydrophobicContact CE1-CB 4.32Å; Y4-A10 PolarHBondContact OH-O 3.31Å; Y4-A10 VanDerWaalsContact OH-O 3.04Å; Y4-T11 PolarHBondContact OH-O 3.15Å; Y4-R12 HydrophobicContact CD1-CB 4.1Å; Y4-R12 HydrophobicContact CD1-CG 3.97Å; Y4-R12 VanDerWaalsContact CE1-CA 3.43Å; Y4-R12 HydrophobicContact CE1-CB 3.85Å; Y4-R12 HydrophobicContact CE1-CG 4.19Å; Y4-L16 HydrophobicContact CG-CD1 4.4Å
5	R	89.8	Confident	87	Confident	229 Å²	229	126 Å²	126	86%	0.864	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-97.8	118.6	173.6	-172.9	176.7	179.6	178.8	0.9	110.4	D3	D3-R5 PolarHBondContact O-N 3.01Å
6	E	92.3	Very high	87.1	Confident	123 Å²	123	124.2 Å²	124.2	58%	0.575	66%	0.661	S	S	*	*	P	Polyproline II helix	trans	-67.6	149.1	174.1	62.6	-172	-175.6	0	0	112.1	Y4	Y4-E6 HydrophobicContact CE1-CB 4.32Å
7	A	93.5	Very high	87.1	Confident	49 Å²	49	120.1 Å²	120.1	41%	0.405	64%	0.639	S	S	.	*	B	Isolated β-bridge	trans	-136.2	160.2	173.4	0	0	0	0	0	110	L9 A10	A7-L9 PolarHBondContact O-N 3.27Å; A7-A10 HydrophobicContact CB-CB 4.08Å; A7-A10 PolarHBondContact N-O 3.37Å; A7-A10 CarbonylContact O-C 3.26Å; A7-A10 VanDerWaalsContact O-C 3.26Å; A7-A10 PolarHBondContact O-N 3.1Å
8	P	92.4	Very high	87.1	Confident	135 Å²	135	116.7 Å²	116.7	88%	0.877	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.6	-28.6	-178.2	-27.7	35.3	0	0	0	114.8
9	L	93.6	Very high	87	Confident	179 Å²	179	114.8 Å²	114.8	94%	0.937	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.3	2.1	177.4	-60.1	176.6	0	0	0	113.3	A7	A7-L9 PolarHBondContact O-N 3.27Å
10	A	92.8	Very high	86.9	Confident	43 Å²	43	112.7 Å²	112.7	36%	0.355	60%	0.601	S	S	.	*	B	Isolated β-bridge	trans	-134.4	83.4	179.6	0	0	0	0	0	109.8	Y4 A7	Y4-A10 PolarHBondContact OH-O 3.31Å; Y4-A10 VanDerWaalsContact OH-O 3.04Å; A7-A10 HydrophobicContact CB-CB 4.08Å; A7-A10 PolarHBondContact N-O 3.37Å; A7-A10 CarbonylContact O-C 3.26Å; A7-A10 VanDerWaalsContact O-C 3.26Å; A7-A10 PolarHBondContact O-N 3.1Å
11	T	91.9	Very high	86.8	Confident	118 Å²	118	113.5 Å²	113.5	72%	0.724	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-69.3	150.4	178.8	59.5	0	0	0	0	111.8	Y4	Y4-T11 PolarHBondContact OH-O 3.15Å
12	R	90.9	Very high	88	Confident	93 Å²	93	110 Å²	110	35%	0.351	58%	0.575	S	S	.	*	P	Polyproline II helix	trans	-64.8	133.2	177.1	-176	178.6	-75.2	161.5	-2.6	110.8	Y4 L16	Y4-R12 HydrophobicContact CD1-CB 4.1Å; Y4-R12 HydrophobicContact CD1-CG 3.97Å; Y4-R12 VanDerWaalsContact CE1-CA 3.43Å; Y4-R12 HydrophobicContact CE1-CB 3.85Å; Y4-R12 HydrophobicContact CE1-CG 4.19Å; R12-L16 WeakPolarHBondContact CD-O 3.25Å; R12-L16 HydrophobicContact CG-CB 3.95Å
13	P	91.1	Very high	88.1	Confident	57 Å²	57	109.4 Å²	109.4	37%	0.37	56%	0.557	S	S	.	*	P	Polyproline II helix	trans	-57.8	142.8	170.3	-24	33.5	0	0	0	111.4	T15 L16 D17	P13-T15 VanDerWaalsContact C-N 3.27Å; P13-T15 PolarHBondContact O-N 3.2Å; P13-L16 HydrophobicContact CB-CD1 4.41Å; P13-L16 HydrophobicContact CG-CD1 4.06Å; P13-L16 PolarHBondContact O-N 3.37Å; P13-D17 PolarHBondContact O-N 2.89Å
14	K	88.2	Confident	87.8	Confident	165 Å²	165	105.6 Å²	105.6	72%	0.717	54%	0.537	S	S	*	.	G	3₁₀ helix	trans	-53.7	-43.3	-178.6	-67.5	-173.7	175.9	-174.7	0	113	L16 D17	K14-L16 PolarHBondContact O-N 3.48Å; K14-L16 VanDerWaalsContact O-N 3.09Å; K14-D17 VanDerWaalsContact O-CB 3.3Å; K14-D17 WeakPolarHBondContact O-CB 3.34Å; K14-D17 PolarHBondContact O-N 3.11Å
15	T	88.7	Confident	87.9	Confident	101 Å²	101	103.8 Å²	103.8	62%	0.62	54%	0.537	S	S	*	.	G	3₁₀ helix	trans	-61.4	-21.5	-179.8	55.5	0	0	0	0	114.4	P13 E20	P13-T15 VanDerWaalsContact C-N 3.27Å; P13-T15 PolarHBondContact O-N 3.2Å; T15-E20 WeakPolarHBondContact CA-OE2 3.32Å; T15-E20 PolarHBondContact N-OE2 3.27Å
16	L	89.1	Confident	88	Confident	97 Å²	97	97.1 Å²	97.1	51%	0.508	52%	0.523	S	S	.	.	G	3₁₀ helix	trans	-97.3	-5.1	177.1	-66.7	172.7	0	0	0	112.2	Y4 R12 P13 K14 P18	Y4-L16 HydrophobicContact CG-CD1 4.4Å; R12-L16 WeakPolarHBondContact CD-O 3.25Å; R12-L16 HydrophobicContact CG-CB 3.95Å; P13-L16 HydrophobicContact CB-CD1 4.41Å; P13-L16 HydrophobicContact CG-CD1 4.06Å; P13-L16 PolarHBondContact O-N 3.37Å; K14-L16 PolarHBondContact O-N 3.48Å; K14-L16 VanDerWaalsContact O-N 3.09Å; L16-P18 VanDerWaalsContact O-CD 3.29Å; L16-P18 WeakPolarHBondContact O-CD 3.36Å
17	D	87.7	Confident	88	Confident	54 Å²	54	95.9 Å²	95.9	29%	0.289	52%	0.521	S	S	.	.			trans	-77.5	114.8	178	-172	4.4	0	0	0	110.3	P13 K14 N19 E20	P13-D17 PolarHBondContact O-N 2.89Å; K14-D17 VanDerWaalsContact O-CB 3.3Å; K14-D17 WeakPolarHBondContact O-CB 3.34Å; K14-D17 PolarHBondContact O-N 3.11Å; D17-N19 PolarHBondContact O-N 3.32Å; D17-N19 VanDerWaalsContact O-N 3.12Å; D17-N19 PolarHBondContact OD1-N 3.05Å; D17-N19 PolarHBondContact OD1-ND2 3.27Å; D17-E20 WeakPolarHBondContact O-CB 3.34Å; D17-E20 PolarHBondContact O-N 2.98Å; D17-E20 VanDerWaalsContact O-N 3.07Å
18	P	86.6	Confident	87.8	Confident	60 Å²	60	97.8 Å²	97.8	39%	0.39	52%	0.518	S	S	.	.	G	3₁₀ helix	trans	-59.8	-25.7	178.8	-22.8	34.9	0	0	0	113.2	L16 E20 Y21 F22	L16-P18 VanDerWaalsContact O-CD 3.29Å; L16-P18 WeakPolarHBondContact O-CD 3.36Å; P18-E20 PolarHBondContact O-N 2.98Å; P18-Y21 PolarHBondContact O-N 3.31Å; P18-F22 HydrophobicContact CB-CD2 4.27Å; P18-F22 PolarHBondContact O-N 2.91Å
19	N	86	Confident	87.7	Confident	81 Å²	81	98.1 Å²	98.1	43%	0.433	50%	0.502	S	S	.	.	G	3₁₀ helix	trans	-66	-22.5	178.7	-67	-32.9	0	0	0	113.2	D17 Y21 N23	D17-N19 PolarHBondContact O-N 3.32Å; D17-N19 VanDerWaalsContact O-N 3.12Å; D17-N19 PolarHBondContact OD1-N 3.05Å; D17-N19 PolarHBondContact OD1-ND2 3.27Å; N19-Y21 VanDerWaalsContact C-N 3.29Å; N19-Y21 PolarHBondContact O-N 3.43Å; N19-N23 PolarHBondContact OD1-ND2 3.33Å
20	E	84.3	Confident	87.7	Confident	71 Å²	71	96.4 Å²	96.4	33%	0.332	48%	0.483	S	S	.	.	G	3₁₀ helix	trans	-68.1	-30.9	179.2	-170.7	168.2	-127.4	0	0	111.7	T15 D17 P18	T15-E20 WeakPolarHBondContact CA-OE2 3.32Å; T15-E20 PolarHBondContact N-OE2 3.27Å; D17-E20 WeakPolarHBondContact O-CB 3.34Å; D17-E20 PolarHBondContact O-N 2.98Å; D17-E20 VanDerWaalsContact O-N 3.07Å; P18-E20 PolarHBondContact O-N 2.98Å
21	Y	84.1	Confident	87.8	Confident	130 Å²	130	95.9 Å²	95.9	51%	0.51	48%	0.479	S	S	.	.	T	Hydrogen-bonded Turn	trans	-115.5	-39.8	-172.9	-56.6	-80.6	0	0	0	114.2	P18 N19	P18-Y21 PolarHBondContact O-N 3.31Å; N19-Y21 VanDerWaalsContact C-N 3.29Å; N19-Y21 PolarHBondContact O-N 3.43Å
22	F	78.9	Confident	87.8	Confident	171 Å²	171	93.6 Å²	93.6	75%	0.75	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.5	-22.8	-165.3	-63	-71.4	0	0	0	114.6	P18	P18-F22 HydrophobicContact CB-CD2 4.27Å; P18-F22 PolarHBondContact O-N 2.91Å
23	N	73.3	Confident	88.1	Confident	92 Å²	92	95.3 Å²	95.3	49%	0.492	47%	0.472	S	S	.	.			trans	-108.4	39.1	-171.7	-65.3	-41.2	0	0	0	113.6	N19 S25	N19-N23 PolarHBondContact OD1-ND2 3.33Å; N23-S25 PolarHBondContact O-N 3.39Å; N23-S25 VanDerWaalsContact O-N 3.07Å
24	L	81.2	Confident	88.4	Confident	80 Å²	80	99.2 Å²	99.2	42%	0.419	49%	0.485	S	S	.	.			trans	-84.5	69.1	-177	-63.6	174.2	0	0	0	113	Y28	L24-Y28 HydrophobicContact CD2-CD1 3.63Å; L24-Y28 HydrophobicContact CD2-CE1 3.54Å
25	S	89.5	Confident	88.8	Confident	52 Å²	52	98.3 Å²	98.3	36%	0.364	48%	0.477	S	S	.	.			trans	-66.7	157.6	171.6	73.2	0	0	0	0	111.7	N23 D27 Y28 R29	N23-S25 PolarHBondContact O-N 3.39Å; N23-S25 VanDerWaalsContact O-N 3.07Å; S25-D27 PolarHBondContact O-N 3Å; S25-Y28 WeakPolarHBondContact O-CB 3.5Å; S25-Y28 PolarHBondContact O-N 3.38Å; S25-Y28 WeakPolarHBondContact OG-CB 3.41Å; S25-Y28 PolarHBondContact OG-N 3.44Å; S25-Y28 VanDerWaalsContact OG-N 3.09Å; S25-R29 PolarHBondContact O-N 2.93Å
26	P	92.6	Very high	89.2	Confident	88 Å²	88	95.8 Å²	95.8	57%	0.571	47%	0.467	S	S	*	.	H	α-helix	trans	-55.8	-35.8	172	-25.1	34.8	0	0	0	112.5	R29 R30	P26-R29 PolarHBondContact O-N 3.49Å; P26-R30 WeakPolarHBondContact O-CG 3.31Å; P26-R30 PolarHBondContact O-N 2.9Å
27	D	91.8	Very high	89.7	Confident	98 Å²	98	93.6 Å²	93.6	52%	0.524	46%	0.462	S	S	.	.	H	α-helix	trans	-66.8	-40.4	178.8	-60	-7.4	0	0	0	111.8	S25 R30 A31	S25-D27 PolarHBondContact O-N 3Å; D27-R30 PolarHBondContact O-N 3.31Å; D27-R30 IonicContact OD1-CZ 3.54Å; D27-R30 IonicContact OD1-NE 3.95Å; D27-R30 IonicContact OD1-NH2 2.62Å; D27-R30 PolarHBondContact OD1-NH2 2.95Å; D27-A31 PolarHBondContact O-N 3.42Å
28	Y	89.8	Confident	90.2	Very high	88 Å²	88	96.2 Å²	96.2	35%	0.345	48%	0.476	S	S	.	.	H	α-helix	trans	-61.4	-44.3	175.4	178.4	-94.7	0	0	0	111.4	L24 S25 R30 A31 E32	L24-Y28 HydrophobicContact CD2-CD1 3.63Å; L24-Y28 HydrophobicContact CD2-CE1 3.54Å; S25-Y28 WeakPolarHBondContact O-CB 3.5Å; S25-Y28 PolarHBondContact O-N 3.38Å; S25-Y28 WeakPolarHBondContact OG-CB 3.41Å; S25-Y28 PolarHBondContact OG-N 3.44Å; S25-Y28 VanDerWaalsContact OG-N 3.09Å; Y28-R30 PolarHBondContact O-N 3.29Å; Y28-A31 PolarHBondContact O-N 2.92Å; Y28-E32 HydrophobicContact CD1-CG 4.39Å; Y28-E32 HydrophobicContact CE1-CG 3.85Å; Y28-E32 HydrophobicContact CE2-CG 4.48Å; Y28-E32 PolarHBondContact O-N 2.81Å
29	R	89.6	Confident	90.7	Very high	142 Å²	142	101.7 Å²	101.7	54%	0.536	49%	0.489	S	S	.	.	H	α-helix	trans	-62.1	-44.4	176.8	-65.4	-174.4	-132.8	164.9	1.7	111.9	S25 P26 A31 E32 E33	S25-R29 PolarHBondContact O-N 2.93Å; P26-R29 PolarHBondContact O-N 3.49Å; R29-A31 VanDerWaalsContact C-N 3.32Å; R29-A31 PolarHBondContact O-N 3.11Å; R29-E32 PolarHBondContact O-N 3.44Å; R29-E33 WeakPolarHBondContact O-CB 3.45Å; R29-E33 WeakPolarHBondContact O-CG 3.48Å; R29-E33 PolarHBondContact O-N 2.89Å
30	R	94.1	Very high	91.3	Very high	143 Å²	143	100.5 Å²	100.5	54%	0.54	49%	0.49	S	S	.	.	H	α-helix	trans	-57.6	-45.1	175.2	-72.1	-171.2	-72.9	160.5	-8.8	111.6	P26 D27 Y28 E32 E33 E34	P26-R30 WeakPolarHBondContact O-CG 3.31Å; P26-R30 PolarHBondContact O-N 2.9Å; D27-R30 PolarHBondContact O-N 3.31Å; D27-R30 IonicContact OD1-CZ 3.54Å; D27-R30 IonicContact OD1-NE 3.95Å; D27-R30 IonicContact OD1-NH2 2.62Å; D27-R30 PolarHBondContact OD1-NH2 2.95Å; Y28-R30 PolarHBondContact O-N 3.29Å; R30-E32 PolarHBondContact O-N 3.49Å; R30-E33 PolarHBondContact O-N 3.5Å; R30-E34 WeakPolarHBondContact O-CB 3.19Å; R30-E34 VanDerWaalsContact O-CG 3.29Å; R30-E34 WeakPolarHBondContact O-CG 3.4Å; R30-E34 PolarHBondContact O-N 2.69Å
31	A	93.7	Very high	91.9	Very high	33 Å²	33	101.7 Å²	101.7	27%	0.273	50%	0.499	S	S	.	.	H	α-helix	trans	-63.7	-38.7	177	0	0	0	0	0	113	D27 Y28 R29 R35	D27-A31 PolarHBondContact O-N 3.42Å; Y28-A31 PolarHBondContact O-N 2.92Å; R29-A31 VanDerWaalsContact C-N 3.32Å; R29-A31 PolarHBondContact O-N 3.11Å; A31-R35 WeakPolarHBondContact O-CB 3.34Å; A31-R35 WeakPolarHBondContact O-CD 3.16Å; A31-R35 WeakPolarHBondContact O-CG 3.33Å; A31-R35 PolarHBondContact O-N 3Å
32	E	92.8	Very high	92.6	Very high	70 Å²	70	100.3 Å²	100.3	33%	0.327	50%	0.5	S	S	.	.	H	α-helix	trans	-68.5	-40.2	175.1	-77.8	-58.9	122.3	0	0	112.4	Y28 R29 R30 R35 A36	Y28-E32 HydrophobicContact CD1-CG 4.39Å; Y28-E32 HydrophobicContact CE1-CG 3.85Å; Y28-E32 HydrophobicContact CE2-CG 4.48Å; Y28-E32 PolarHBondContact O-N 2.81Å; R29-E32 PolarHBondContact O-N 3.44Å; R30-E32 PolarHBondContact O-N 3.49Å; E32-R35 PolarHBondContact O-N 3.5Å; E32-R35 WeakPolarHBondContact OE1-CD 3.3Å; E32-R35 IonicContact OE1-CZ 3Å; E32-R35 IonicContact OE1-NE 2.73Å; E32-R35 IonicContact OE1-NH1 3.67Å; E32-R35 PolarHBondContact OE1-NH1 3.05Å; E32-A36 VanDerWaalsContact O-CB 3.3Å; E32-A36 WeakPolarHBondContact O-CB 3.4Å; E32-A36 PolarHBondContact O-N 3.05Å
33	E	96.3	Very high	93.5	Very high	129 Å²	129	98.3 Å²	98.3	60%	0.603	49%	0.491	S	S	*	.	H	α-helix	trans	-61.1	-45.1	173.4	-74.1	171.4	-167.3	0	0	111.3	R29 R30 A36 A37	R29-E33 WeakPolarHBondContact O-CB 3.45Å; R29-E33 WeakPolarHBondContact O-CG 3.48Å; R29-E33 PolarHBondContact O-N 2.89Å; R30-E33 PolarHBondContact O-N 3.5Å; E33-A36 PolarHBondContact O-N 2.84Å; E33-A37 VanDerWaalsContact O-CB 3.32Å; E33-A37 WeakPolarHBondContact O-CB 3.4Å; E33-A37 PolarHBondContact O-N 2.95Å
34	E	97.7	Very high	94.7	Very high	138 Å²	138	101 Å²	101	65%	0.645	49%	0.494	S	S	*	.	H	α-helix	trans	-61	-44.8	175.5	-74.8	173.5	-170.7	0	0	111.9	R30 A37 L38	R30-E34 WeakPolarHBondContact O-CB 3.19Å; R30-E34 VanDerWaalsContact O-CG 3.29Å; R30-E34 WeakPolarHBondContact O-CG 3.4Å; R30-E34 PolarHBondContact O-N 2.69Å; E34-A37 PolarHBondContact O-N 2.91Å; E34-L38 WeakPolarHBondContact O-CB 3.42Å; E34-L38 PolarHBondContact O-N 3.46Å
35	R	96.9	Very high	95.4	Very high	146 Å²	146	101.8 Å²	101.8	55%	0.551	50%	0.496	S	S	*	.	H	α-helix	trans	-62.5	-42.2	175.4	-73.7	167.3	-178.4	-179.5	0.7	111.8	A31 E32 R39	A31-R35 WeakPolarHBondContact O-CB 3.34Å; A31-R35 WeakPolarHBondContact O-CD 3.16Å; A31-R35 WeakPolarHBondContact O-CG 3.33Å; A31-R35 PolarHBondContact O-N 3Å; E32-R35 PolarHBondContact O-N 3.5Å; E32-R35 WeakPolarHBondContact OE1-CD 3.3Å; E32-R35 IonicContact OE1-CZ 3Å; E32-R35 IonicContact OE1-NE 2.73Å; E32-R35 IonicContact OE1-NH1 3.67Å; E32-R35 PolarHBondContact OE1-NH1 3.05Å; R35-R39 WeakPolarHBondContact O-CB 3.29Å; R35-R39 PolarHBondContact O-N 2.89Å
36	A	97.9	Very high	95.8	Very high	49 Å²	49	105.1 Å²	105.1	41%	0.405	50%	0.501	S	S	.	.	H	α-helix	trans	-66.1	-43.1	178	0	0	0	0	0	111.4	E32 E33 R39 A40	E32-A36 VanDerWaalsContact O-CB 3.3Å; E32-A36 WeakPolarHBondContact O-CB 3.4Å; E32-A36 PolarHBondContact O-N 3.05Å; E33-A36 PolarHBondContact O-N 2.84Å; A36-R39 PolarHBondContact O-N 3.49Å; A36-A40 WeakPolarHBondContact O-CB 3.12Å; A36-A40 PolarHBondContact O-N 3.43Å
37	A	98.3	Very high	96	Very high	50 Å²	50	105 Å²	105	41%	0.413	49%	0.493	S	S	.	.	H	α-helix	trans	-61.8	-45.7	175.9	0	0	0	0	0	111.5	E33 E34 R39 A40 N41	E33-A37 VanDerWaalsContact O-CB 3.32Å; E33-A37 WeakPolarHBondContact O-CB 3.4Å; E33-A37 PolarHBondContact O-N 2.95Å; E34-A37 PolarHBondContact O-N 2.91Å; A37-R39 PolarHBondContact O-N 3.39Å; A37-A40 PolarHBondContact O-N 2.97Å; A37-N41 WeakPolarHBondContact O-CB 3.27Å; A37-N41 VanDerWaalsContact O-CG 3.27Å; A37-N41 PolarHBondContact O-N 2.95Å; A37-N41 PolarHBondContact O-ND2 3.26Å
38	L	98.1	Very high	96.2	Very high	109 Å²	109	105.5 Å²	105.5	57%	0.571	50%	0.495	S	S	*	.	H	α-helix	trans	-61	-45.5	175.5	-177.9	138.9	0	0	0	111.6	E34 A40 N41 L42	E34-L38 WeakPolarHBondContact O-CB 3.42Å; E34-L38 PolarHBondContact O-N 3.46Å; L38-A40 PolarHBondContact O-N 3.28Å; L38-N41 PolarHBondContact O-N 3.25Å; L38-L42 HydrophobicContact CD2-CD1 3.67Å; L38-L42 HydrophobicContact CD2-CG 4.49Å; L38-L42 HydrophobicContact CG-CD1 4.37Å; L38-L42 WeakPolarHBondContact O-CG 3.36Å; L38-L42 PolarHBondContact O-N 3.12Å
39	R	98.1	Very high	96.5	Very high	176 Å²	176	104.6 Å²	104.6	66%	0.664	49%	0.494	S	S	*	.	H	α-helix	trans	-60.9	-43.8	176.4	-174.7	-176.7	-64.9	143	2.7	111.8	R35 A36 A37 L42 K43	R35-R39 WeakPolarHBondContact O-CB 3.29Å; R35-R39 PolarHBondContact O-N 2.89Å; A36-R39 PolarHBondContact O-N 3.49Å; A37-R39 PolarHBondContact O-N 3.39Å; R39-L42 PolarHBondContact O-N 3.29Å; R39-K43 WeakPolarHBondContact O-CB 3.05Å; R39-K43 PolarHBondContact O-N 3.47Å
40	A	98.3	Very high	96.8	Very high	56 Å²	56	102.2 Å²	102.2	46%	0.463	49%	0.491	S	S	.	.	H	α-helix	trans	-63.2	-42.5	178.2	0	0	0	0	0	111.6	A36 A37 L38 K43 R44	A36-A40 WeakPolarHBondContact O-CB 3.12Å; A36-A40 PolarHBondContact O-N 3.43Å; A37-A40 PolarHBondContact O-N 2.97Å; L38-A40 PolarHBondContact O-N 3.28Å; A40-K43 PolarHBondContact O-N 2.89Å; A40-R44 WeakPolarHBondContact O-CB 2.99Å; A40-R44 PolarHBondContact O-N 2.88Å
41	N	98.1	Very high	96.8	Very high	96 Å²	96	101.3 Å²	101.3	51%	0.513	50%	0.497	S	S	.	.	H	α-helix	trans	-62.6	-46.7	177.2	-75.5	-28	0	0	0	112.4	A37 L38 R44 Q45	A37-N41 WeakPolarHBondContact O-CB 3.27Å; A37-N41 VanDerWaalsContact O-CG 3.27Å; A37-N41 PolarHBondContact O-N 2.95Å; A37-N41 PolarHBondContact O-ND2 3.26Å; L38-N41 PolarHBondContact O-N 3.25Å; N41-R44 PolarHBondContact O-N 2.9Å; N41-Q45 PolarHBondContact O-N 3.16Å
42	L	97.8	Very high	96.9	Very high	100 Å²	100	103.3 Å²	103.3	52%	0.524	50%	0.503	S	S	.	.	H	α-helix	trans	-63.1	-42.1	176.5	-69.3	174.7	0	0	0	111.8	L38 R39 R44 Q45 Y46	L38-L42 HydrophobicContact CD2-CD1 3.67Å; L38-L42 HydrophobicContact CD2-CG 4.49Å; L38-L42 HydrophobicContact CG-CD1 4.37Å; L38-L42 WeakPolarHBondContact O-CG 3.36Å; L38-L42 PolarHBondContact O-N 3.12Å; R39-L42 PolarHBondContact O-N 3.29Å; L42-R44 PolarHBondContact O-N 3.41Å; L42-Q45 PolarHBondContact O-N 2.9Å; L42-Y46 PolarHBondContact O-N 2.89Å
43	K	97.9	Very high	97.1	Very high	130 Å²	130	105.5 Å²	105.5	57%	0.565	52%	0.523	S	S	*	.	H	α-helix	trans	-61.1	-45	175.9	-172.7	-178.5	-177.3	-177.3	0	111.4	R39 A40 Y46 Q47	R39-K43 WeakPolarHBondContact O-CB 3.05Å; R39-K43 PolarHBondContact O-N 3.47Å; A40-K43 PolarHBondContact O-N 2.89Å; K43-Y46 PolarHBondContact O-N 2.81Å; K43-Q47 HydrophobicContact CG-CG 4.42Å; K43-Q47 WeakPolarHBondContact O-CB 3.33Å; K43-Q47 VanDerWaalsContact O-CG 3.3Å; K43-Q47 WeakPolarHBondContact O-CG 3.28Å; K43-Q47 PolarHBondContact O-N 3.04Å
44	R	98.1	Very high	97	Very high	148 Å²	148	107.2 Å²	107.2	56%	0.558	53%	0.531	S	S	*	.	H	α-helix	trans	-59.5	-47.5	177	-175.5	-174.5	68.8	86.4	1	111.1	A40 N41 L42 Y46 Q47 L48	A40-R44 WeakPolarHBondContact O-CB 2.99Å; A40-R44 PolarHBondContact O-N 2.88Å; N41-R44 PolarHBondContact O-N 2.9Å; L42-R44 PolarHBondContact O-N 3.41Å; R44-Y46 VanDerWaalsContact C-N 3.35Å; R44-Y46 PolarHBondContact O-N 3.02Å; R44-Q47 PolarHBondContact O-N 3.02Å; R44-L48 HydrophobicContact CG-CD1 4.2Å; R44-L48 VanDerWaalsContact O-CG 3.31Å; R44-L48 WeakPolarHBondContact O-CG 3.44Å; R44-L48 PolarHBondContact O-N 3.28Å
45	Q	96.9	Very high	96.8	Very high	97 Å²	97	104.2 Å²	104.2	45%	0.453	51%	0.514	S	S	.	.	H	α-helix	trans	-56.9	-48.4	177.3	176.9	-177.9	-16.7	0	0	111.4	N41 L42 L48 Q49	N41-Q45 PolarHBondContact O-N 3.16Å; L42-Q45 PolarHBondContact O-N 2.9Å; Q45-L48 PolarHBondContact O-N 2.83Å; Q45-Q49 WeakPolarHBondContact O-CG 3.46Å; Q45-Q49 PolarHBondContact O-N 3.38Å
46	Y	96.7	Very high	96.5	Very high	121 Å²	121	103.9 Å²	103.9	48%	0.475	53%	0.528	S	S	.	.	H	α-helix	trans	-61.9	-46.5	178.6	176.8	-104.5	0	0	0	112.2	L42 K43 R44 L48 Q49 L50 I59	L42-Y46 PolarHBondContact O-N 2.89Å; K43-Y46 PolarHBondContact O-N 2.81Å; R44-Y46 VanDerWaalsContact C-N 3.35Å; R44-Y46 PolarHBondContact O-N 3.02Å; Y46-L48 PolarHBondContact O-N 2.85Å; Y46-Q49 PolarHBondContact O-N 2.88Å; Y46-L50 HydrophobicContact CE1-CD2 3.9Å; Y46-L50 WeakPolarHBondContact O-CB 3.25Å; Y46-L50 PolarHBondContact O-N 2.94Å; Y46-I59 HydrophobicContact CD2-CD1 4.11Å; Y46-I59 HydrophobicContact CD2-CG2 3.96Å; Y46-I59 HydrophobicContact CE2-CB 4.29Å; Y46-I59 HydrophobicContact CE2-CD1 3.49Å; Y46-I59 VanDerWaalsContact CE2-CD1 3.49Å; Y46-I59 HydrophobicContact CE2-CG1 4.46Å; Y46-I59 HydrophobicContact CE2-CG2 3.94Å
47	Q	96.8	Very high	96.3	Very high	85 Å²	85	108.9 Å²	108.9	40%	0.397	54%	0.543	S	S	.	.	H	α-helix	trans	-63.3	-38.6	179.9	-74.2	179.4	-26.7	0	0	112.9	K43 R44 Q49 L50 N51	K43-Q47 HydrophobicContact CG-CG 4.42Å; K43-Q47 WeakPolarHBondContact O-CB 3.33Å; K43-Q47 VanDerWaalsContact O-CG 3.3Å; K43-Q47 WeakPolarHBondContact O-CG 3.28Å; K43-Q47 PolarHBondContact O-N 3.04Å; R44-Q47 PolarHBondContact O-N 3.02Å; Q47-Q49 VanDerWaalsContact C-N 3.29Å; Q47-Q49 PolarHBondContact O-N 3.36Å; Q47-L50 PolarHBondContact O-N 3.46Å; Q47-N51 VanDerWaalsContact O-CB 3.28Å; Q47-N51 WeakPolarHBondContact O-CB 3.43Å; Q47-N51 VanDerWaalsContact O-CG 3.25Å; Q47-N51 PolarHBondContact O-N 3.28Å; Q47-N51 PolarHBondContact O-ND2 2.87Å
48	L	96.5	Very high	96	Very high	109 Å²	109	113.8 Å²	113.8	57%	0.571	56%	0.562	S	S	*	*	H	α-helix	trans	-62.1	-38.5	175.3	-73.8	172.6	0	0	0	112.1	R44 Q45 Y46	R44-L48 HydrophobicContact CG-CD1 4.2Å; R44-L48 VanDerWaalsContact O-CG 3.31Å; R44-L48 WeakPolarHBondContact O-CG 3.44Å; R44-L48 PolarHBondContact O-N 3.28Å; Q45-L48 PolarHBondContact O-N 2.83Å; Y46-L48 PolarHBondContact O-N 2.85Å
49	Q	95.4	Very high	95.8	Very high	70 Å²	70	110.2 Å²	110.2	33%	0.327	54%	0.543	S	S	.	.	H	α-helix	trans	-73.3	-40.2	176.8	-70.4	-174.5	8.6	0	0	112.4	Q45 Y46 Q47 R55	Q45-Q49 WeakPolarHBondContact O-CG 3.46Å; Q45-Q49 PolarHBondContact O-N 3.38Å; Y46-Q49 PolarHBondContact O-N 2.88Å; Q47-Q49 VanDerWaalsContact C-N 3.29Å; Q47-Q49 PolarHBondContact O-N 3.36Å; Q49-R55 WeakPolarHBondContact O-CD 3.45Å
50	L	95.4	Very high	95.6	Very high	92 Å²	92	109.5 Å²	109.5	48%	0.482	55%	0.547	S	S	.	.	H	α-helix	trans	-66.9	-40.2	-180	-178	65.9	0	0	0	112.1	Y46 Q47 N52 I59	Y46-L50 HydrophobicContact CE1-CD2 3.9Å; Y46-L50 WeakPolarHBondContact O-CB 3.25Å; Y46-L50 PolarHBondContact O-N 2.94Å; Q47-L50 PolarHBondContact O-N 3.46Å; L50-N52 VanDerWaalsContact C-N 3.27Å; L50-N52 PolarHBondContact O-N 2.99Å; L50-I59 HydrophobicContact CB-CD1 3.9Å; L50-I59 HydrophobicContact CD1-CD1 3.79Å; L50-I59 HydrophobicContact CG-CD1 4.46Å
51	N	96.1	Very high	95.5	Very high	123 Å²	123	110.7 Å²	110.7	66%	0.658	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.9	5.5	-176.7	-64	-24.7	0	0	0	113.3	Q47 P53	Q47-N51 VanDerWaalsContact O-CB 3.28Å; Q47-N51 WeakPolarHBondContact O-CB 3.43Å; Q47-N51 VanDerWaalsContact O-CG 3.25Å; Q47-N51 PolarHBondContact O-N 3.28Å; Q47-N51 PolarHBondContact O-ND2 2.87Å; N51-P53 VanDerWaalsContact O-CD 3.31Å; N51-P53 WeakPolarHBondContact O-CD 3.43Å
52	N	95.6	Very high	95.4	Very high	75 Å²	75	109.2 Å²	109.2	40%	0.401	54%	0.541	S	S	.	.			trans	-76.5	114	177.2	-179.4	-3	0	0	0	110.2	L50 H54 R55	L50-N52 VanDerWaalsContact C-N 3.27Å; L50-N52 PolarHBondContact O-N 2.99Å; N52-H54 PolarHBondContact O-N 3.49Å; N52-H54 PolarHBondContact OD1-N 3.23Å; N52-R55 HydrophobicContact CB-CB 4.14Å; N52-R55 WeakPolarHBondContact O-CB 3.36Å; N52-R55 PolarHBondContact O-N 3.09Å
53	P	95.4	Very high	95.4	Very high	116 Å²	116	107.1 Å²	107.1	75%	0.753	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.6	-18	-177	29.8	-36.5	0	0	0	113.9	N51 R55	N51-P53 VanDerWaalsContact O-CD 3.31Å; N51-P53 WeakPolarHBondContact O-CD 3.43Å; P53-R55 VanDerWaalsContact C-N 3.34Å
54	H	95.3	Very high	95.3	Very high	165 Å²	165	105.7 Å²	105.7	76%	0.764	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.5	-4	-179.7	-59.7	-58.4	0	0	0	113.3	N52	N52-H54 PolarHBondContact O-N 3.49Å; N52-H54 PolarHBondContact OD1-N 3.23Å
55	R	92.4	Very high	95.3	Very high	76 Å²	76	102.4 Å²	102.4	29%	0.287	53%	0.533	S	S	.	.			trans	-85.1	126.1	-175.9	-178.5	-167.6	169.3	100.1	35.6	110.7	Q49 N52 P53 E57 L58 I59	Q49-R55 WeakPolarHBondContact O-CD 3.45Å; N52-R55 HydrophobicContact CB-CB 4.14Å; N52-R55 WeakPolarHBondContact O-CB 3.36Å; N52-R55 PolarHBondContact O-N 3.09Å; P53-R55 VanDerWaalsContact C-N 3.34Å; R55-E57 VanDerWaalsContact CZ-O 3.3Å; R55-E57 PolarHBondContact NE-O 2.9Å; R55-E57 PolarHBondContact NH2-O 3.41Å; R55-L58 PolarHBondContact NH2-O 3.01Å; R55-I59 VanDerWaalsContact NH1-CG1 3.35Å
56	T	91.3	Very high	95.3	Very high	139 Å²	139	106.4 Å²	106.4	85%	0.853	54%	0.544	S	S	*	.			trans	-111.1	-12	177.4	52.3	0	0	0	0	114
57	E	92.9	Very high	95.3	Very high	153 Å²	153	107.1 Å²	107.1	72%	0.715	55%	0.546	S	S	*	.	S	Bend	trans	-100.3	160.9	-172.7	-63.8	176.5	178.6	0	0	113.3	R55	R55-E57 VanDerWaalsContact CZ-O 3.3Å; R55-E57 PolarHBondContact NE-O 2.9Å; R55-E57 PolarHBondContact NH2-O 3.41Å
58	L	92.2	Very high	95.4	Very high	154 Å²	154	106.3 Å²	106.3	81%	0.806	55%	0.547	S	S	*	.			trans	-66.7	136.7	176.9	179	65.9	0	0	0	112.3	R55 E60	R55-L58 PolarHBondContact NH2-O 3.01Å; L58-E60 PolarHBondContact O-N 3.29Å; L58-E60 VanDerWaalsContact O-N 3.15Å
59	I	94.5	Very high	95.4	Very high	33 Å²	33	108.4 Å²	108.4	17%	0.169	55%	0.548	C	S	.	.			trans	-68.9	110	176.2	-58.8	164.4	0	0	0	109	Y46 L50 R55 D61	Y46-I59 HydrophobicContact CD2-CD1 4.11Å; Y46-I59 HydrophobicContact CD2-CG2 3.96Å; Y46-I59 HydrophobicContact CE2-CB 4.29Å; Y46-I59 HydrophobicContact CE2-CD1 3.49Å; Y46-I59 VanDerWaalsContact CE2-CD1 3.49Å; Y46-I59 HydrophobicContact CE2-CG1 4.46Å; Y46-I59 HydrophobicContact CE2-CG2 3.94Å; L50-I59 HydrophobicContact CB-CD1 3.9Å; L50-I59 HydrophobicContact CD1-CD1 3.79Å; L50-I59 HydrophobicContact CG-CD1 4.46Å; R55-I59 VanDerWaalsContact NH1-CG1 3.35Å; I59-D61 PolarHBondContact O-N 3.02Å
60	E	94.3	Very high	95.5	Very high	162 Å²	162	108.2 Å²	108.2	76%	0.757	56%	0.558	S	S	*	*			trans	-72.7	122.3	172.9	-63.7	-170.6	167.9	0	0	110.4	L58 P62	L58-E60 PolarHBondContact O-N 3.29Å; L58-E60 VanDerWaalsContact O-N 3.15Å; E60-P62 WeakPolarHBondContact O-CD 3.29Å
61	D	95.9	Very high	95.5	Very high	81 Å²	81	111.6 Å²	111.6	43%	0.433	57%	0.565	S	S	.	*			trans	-91.8	112.7	170.3	-178.7	5.1	0	0	0	109.7	I59 A63 L64 T65	I59-D61 PolarHBondContact O-N 3.02Å; D61-A63 PolarHBondContact O-N 3.26Å; D61-A63 VanDerWaalsContact OD1-CB 3.28Å; D61-A63 WeakPolarHBondContact OD1-CB 3.43Å; D61-A63 PolarHBondContact OD1-N 2.74Å; D61-L64 HydrophobicContact CB-CB 3.95Å; D61-L64 PolarHBondContact O-N 3.42Å; D61-T65 PolarHBondContact O-N 3.37Å; D61-T65 PolarHBondContact O-OG1 3.26Å; D61-T65 VanDerWaalsContact O-OG1 3.12Å
62	P	96.4	Very high	95.6	Very high	65 Å²	65	109 Å²	109	42%	0.422	56%	0.56	S	S	.	*	H	α-helix	trans	-63.8	-26.3	176.4	26.6	-34.5	0	0	0	112.4	E60 R66	E60-P62 WeakPolarHBondContact O-CD 3.29Å; P62-R66 WeakPolarHBondContact O-CB 3.32Å; P62-R66 WeakPolarHBondContact O-CD 3.32Å; P62-R66 WeakPolarHBondContact O-CG 3.44Å; P62-R66 PolarHBondContact O-N 3.43Å
63	A	96.8	Very high	95.6	Very high	56 Å²	56	108 Å²	108	46%	0.463	56%	0.555	S	S	.	*	H	α-helix	trans	-68.1	-43.9	175.6	0	0	0	0	0	111.1	D61 R66 W67	D61-A63 PolarHBondContact O-N 3.26Å; D61-A63 VanDerWaalsContact OD1-CB 3.28Å; D61-A63 WeakPolarHBondContact OD1-CB 3.43Å; D61-A63 PolarHBondContact OD1-N 2.74Å; A63-R66 PolarHBondContact O-N 3.46Å; A63-W67 WeakPolarHBondContact O-CB 3.48Å; A63-W67 PolarHBondContact O-N 3.15Å
64	L	96.9	Very high	95.6	Very high	99 Å²	99	106.6 Å²	106.6	52%	0.518	55%	0.545	S	S	.	.	H	α-helix	trans	-61.9	-45.7	174.4	-173.3	144.1	0	0	0	111.3	D61 R66 W67 V68	D61-L64 HydrophobicContact CB-CB 3.95Å; D61-L64 PolarHBondContact O-N 3.42Å; L64-R66 PolarHBondContact O-N 2.98Å; L64-W67 WeakPolarHBondContact O-CB 3.39Å; L64-W67 PolarHBondContact O-N 3.26Å; L64-W67 VanDerWaalsContact O-N 3.15Å; L64-V68 HydrophobicContact CD2-CG2 4.03Å; L64-V68 WeakPolarHBondContact O-CG2 3.3Å; L64-V68 PolarHBondContact O-N 2.92Å
65	T	97.1	Very high	95.6	Very high	80 Å²	80	107.9 Å²	107.9	49%	0.491	55%	0.545	S	S	.	.	H	α-helix	trans	-60.2	-45.7	178.8	-56.6	0	0	0	0	111.5	D61 W67 V68 Y69	D61-T65 PolarHBondContact O-N 3.37Å; D61-T65 PolarHBondContact O-OG1 3.26Å; D61-T65 VanDerWaalsContact O-OG1 3.12Å; T65-W67 VanDerWaalsContact C-N 3.33Å; T65-W67 PolarHBondContact O-N 2.88Å; T65-V68 PolarHBondContact O-N 3.44Å; T65-Y69 WeakPolarHBondContact O-CB 3.39Å; T65-Y69 PolarHBondContact O-N 3.19Å
66	R	97.3	Very high	95.8	Very high	181 Å²	181	108.8 Å²	108.8	68%	0.683	56%	0.561	S	S	*	*	H	α-helix	trans	-63.8	-37.5	175.3	-71.7	169.7	-168.4	159.2	3.5	112.4	P62 A63 L64 Y69 A70	P62-R66 WeakPolarHBondContact O-CB 3.32Å; P62-R66 WeakPolarHBondContact O-CD 3.32Å; P62-R66 WeakPolarHBondContact O-CG 3.44Å; P62-R66 PolarHBondContact O-N 3.43Å; A63-R66 PolarHBondContact O-N 3.46Å; L64-R66 PolarHBondContact O-N 2.98Å; R66-Y69 PolarHBondContact O-N 2.83Å; R66-A70 WeakPolarHBondContact O-CB 3.43Å; R66-A70 PolarHBondContact O-N 3.42Å
67	W	97.5	Very high	96	Very high	136 Å²	136	109.6 Å²	109.6	52%	0.515	55%	0.554	S	S	.	*	H	α-helix	trans	-66.1	-45.9	176.9	174.3	82.7	0	0	0	111.9	A63 L64 T65 Y69 A70 R71	A63-W67 WeakPolarHBondContact O-CB 3.48Å; A63-W67 PolarHBondContact O-N 3.15Å; L64-W67 WeakPolarHBondContact O-CB 3.39Å; L64-W67 PolarHBondContact O-N 3.26Å; L64-W67 VanDerWaalsContact O-N 3.15Å; T65-W67 VanDerWaalsContact C-N 3.33Å; T65-W67 PolarHBondContact O-N 2.88Å; W67-Y69 VanDerWaalsContact C-N 3.32Å; W67-Y69 PolarHBondContact O-N 3.12Å; W67-A70 PolarHBondContact O-N 2.92Å; W67-R71 VanDerWaalsContact CZ3-NH2 3.32Å; W67-R71 WeakPolarHBondContact O-CG 3.39Å; W67-R71 PolarHBondContact O-N 3.34Å; W67-R71 VanDerWaalsContact O-N 3.09Å
68	V	97.8	Very high	96.2	Very high	68 Å²	68	107.6 Å²	107.6	41%	0.412	54%	0.544	S	S	.	.	H	α-helix	trans	-59.4	-47.3	174	174.5	0	0	0	0	109.9	L64 T65 A70 R71 A72	L64-V68 HydrophobicContact CD2-CG2 4.03Å; L64-V68 WeakPolarHBondContact O-CG2 3.3Å; L64-V68 PolarHBondContact O-N 2.92Å; T65-V68 PolarHBondContact O-N 3.44Å; V68-A70 VanDerWaalsContact C-N 3.34Å; V68-A70 PolarHBondContact O-N 3.34Å; V68-R71 PolarHBondContact O-N 3.04Å; V68-A72 WeakPolarHBondContact O-CB 3.46Å; V68-A72 PolarHBondContact O-N 3.23Å
69	Y	97.2	Very high	96.4	Very high	153 Å²	153	109.7 Å²	109.7	60%	0.6	54%	0.541	S	S	*	.	H	α-helix	trans	-58	-44.6	177.6	-178.9	-90.8	0	0	0	112.3	T65 R66 W67 R71 A72 N73	T65-Y69 WeakPolarHBondContact O-CB 3.39Å; T65-Y69 PolarHBondContact O-N 3.19Å; R66-Y69 PolarHBondContact O-N 2.83Å; W67-Y69 VanDerWaalsContact C-N 3.32Å; W67-Y69 PolarHBondContact O-N 3.12Å; Y69-R71 VanDerWaalsContact C-N 3.33Å; Y69-R71 PolarHBondContact O-N 3.28Å; Y69-A72 PolarHBondContact O-N 2.9Å; Y69-N73 WeakPolarHBondContact CD2-ND2 3.3Å; Y69-N73 HydrophobicContact CE1-CB 4.27Å; Y69-N73 WeakPolarHBondContact CE2-ND2 3.47Å; Y69-N73 WeakPolarHBondContact O-CB 3.25Å; Y69-N73 PolarHBondContact O-N 3.41Å; Y69-N73 PolarHBondContact O-ND2 3.46Å
70	A	96.9	Very high	96.3	Very high	66 Å²	66	113.2 Å²	113.2	55%	0.545	57%	0.566	S	S	.	*	H	α-helix	trans	-63.1	-37.5	178.9	0	0	0	0	0	112.4	R66 W67 V68	R66-A70 WeakPolarHBondContact O-CB 3.43Å; R66-A70 PolarHBondContact O-N 3.42Å; W67-A70 PolarHBondContact O-N 2.92Å; V68-A70 VanDerWaalsContact C-N 3.34Å; V68-A70 PolarHBondContact O-N 3.34Å
71	R	96.5	Very high	96.5	Very high	163 Å²	163	108.6 Å²	108.6	62%	0.615	55%	0.549	S	S	*	.	H	α-helix	trans	-73.8	-33.5	175.5	-64.9	-158.3	-53.2	178.9	5.1	113.1	W67 V68 Y69	W67-R71 VanDerWaalsContact CZ3-NH2 3.32Å; W67-R71 WeakPolarHBondContact O-CG 3.39Å; W67-R71 PolarHBondContact O-N 3.34Å; W67-R71 VanDerWaalsContact O-N 3.09Å; V68-R71 PolarHBondContact O-N 3.04Å; Y69-R71 VanDerWaalsContact C-N 3.33Å; Y69-R71 PolarHBondContact O-N 3.28Å
72	A	97.3	Very high	96.5	Very high	67 Å²	67	114.1 Å²	114.1	55%	0.554	57%	0.569	S	S	*	*	H	α-helix	trans	-78.1	-24.4	-179.8	0	0	0	0	0	113.2	V68 Y69 P74	V68-A72 WeakPolarHBondContact O-CB 3.46Å; V68-A72 PolarHBondContact O-N 3.23Å; Y69-A72 PolarHBondContact O-N 2.9Å; A72-P74 WeakPolarHBondContact O-CD 3.29Å
73	N	96.6	Very high	96.5	Very high	55 Å²	55	119 Å²	119	29%	0.294	58%	0.584	S	S	.	*			trans	-115.1	60.1	-175.7	-63.3	-72.2	0	0	0	113.9	Y69	Y69-N73 WeakPolarHBondContact CD2-ND2 3.3Å; Y69-N73 HydrophobicContact CE1-CB 4.27Å; Y69-N73 WeakPolarHBondContact CE2-ND2 3.47Å; Y69-N73 WeakPolarHBondContact O-CB 3.25Å; Y69-N73 PolarHBondContact O-N 3.41Å; Y69-N73 PolarHBondContact O-ND2 3.46Å
74	P	95.3	Very high	96.4	Very high	86 Å²	86	118.6 Å²	118.6	56%	0.558	58%	0.575	S	S	*	*			trans	-76.4	-29.4	177.3	31.3	-34.3	0	0	0	112.8	A72 H77 F78	A72-P74 WeakPolarHBondContact O-CD 3.29Å; P74-H77 PolarHBondContact O-N 2.87Å; P74-F78 PolarHBondContact O-N 2.91Å
75	Y	95.1	Very high	96.4	Very high	192 Å²	192	117 Å²	117	75%	0.753	57%	0.572	S	S	*	*	G	3₁₀ helix	trans	-63.4	-41	-170	-168.1	-103.6	0	0	0	114.9	H77 F78	Y75-H77 PolarHBondContact O-N 3.15Å; Y75-H77 VanDerWaalsContact O-N 3.09Å; Y75-F78 WeakPolarHBondContact O-CB 3.31Å; Y75-F78 PolarHBondContact O-N 3.48Å
76	P	96.7	Very high	96.4	Very high	95 Å²	95	118.9 Å²	118.9	62%	0.617	58%	0.579	S	S	*	*	G	3₁₀ helix	trans	-58.6	-25.8	177.4	-26.3	35.9	0	0	0	114.4
77	H	95.3	Very high	96.4	Very high	156 Å²	156	114.5 Å²	114.5	72%	0.722	57%	0.568	S	S	*	*	G	3₁₀ helix	trans	-100.9	-3.5	-179.5	-58	90.6	0	0	0	112.5	P74 Y75	P74-H77 PolarHBondContact O-N 2.87Å; Y75-H77 PolarHBondContact O-N 3.15Å; Y75-H77 VanDerWaalsContact O-N 3.09Å
78	F	96.2	Very high	96.3	Very high	111 Å²	111	110.1 Å²	110.1	49%	0.487	57%	0.566	S	S	.	*			trans	-71.6	133.3	179.2	176.2	-100.6	0	0	0	110.5	P74 Y75 P80 T84	P74-F78 PolarHBondContact O-N 2.91Å; Y75-F78 WeakPolarHBondContact O-CB 3.31Å; Y75-F78 PolarHBondContact O-N 3.48Å; F78-P80 HydrophobicContact CE1-CB 4.33Å; F78-T84 HydrophobicContact CE2-CG2 4.24Å
79	R	95.8	Very high	96.2	Very high	199 Å²	199	110.7 Å²	110.7	75%	0.751	57%	0.569	S	S	*	*			trans	-125.1	125.3	174.6	-66.9	-177.6	177.2	172.6	-1	109.3	T81 T84	R79-T81 HydrophobicContact CB-CG2 4.28Å; R79-T81 PolarHBondContact O-N 3.44Å; R79-T84 PolarHBondContact O-OG1 3.3Å
80	P	94.2	Very high	96.2	Very high	107 Å²	107	107.5 Å²	107.5	70%	0.695	56%	0.56	S	S	*	*			trans	-70.1	99.2	175	28.7	-32.7	0	0	0	109.4	F78	F78-P80 HydrophobicContact CE1-CB 4.33Å
81	T	96.8	Very high	96.2	Very high	64 Å²	64	111.3 Å²	111.3	39%	0.393	57%	0.565	S	S	.	*			trans	-112.6	163.3	175.8	65.6	0	0	0	0	110.7	R79 K83 T84 S85	R79-T81 HydrophobicContact CB-CG2 4.28Å; R79-T81 PolarHBondContact O-N 3.44Å; T81-K83 PolarHBondContact O-N 3.09Å; T81-T84 PolarHBondContact N-OG1 3.4Å; T81-T84 PolarHBondContact O-N 3.2Å; T81-T84 PolarHBondContact O-OG1 2.94Å; T81-T84 WeakPolarHBondContact OG1-CG2 3.44Å; T81-T84 PolarHBondContact OG1-N 3.43Å; T81-T84 PolarHBondContact OG1-OG1 3.29Å; T81-T84 VanDerWaalsContact OG1-OG1 3.05Å; T81-S85 WeakPolarHBondContact O-CB 3.16Å; T81-S85 PolarHBondContact O-N 3.2Å; T81-S85 PolarHBondContact O-OG 3.38Å; T81-S85 VanDerWaalsContact O-OG 3.11Å
82	K	96.3	Very high	96.2	Very high	198 Å²	198	105.6 Å²	105.6	86%	0.861	56%	0.556	S	S	*	*	H	α-helix	trans	-54.5	-38.6	176.5	-63.1	-175.3	-179	-178.4	0	112.5	L86	K82-L86 VanDerWaalsContact O-CB 3.27Å; K82-L86 WeakPolarHBondContact O-CB 3.28Å; K82-L86 PolarHBondContact O-N 3.49Å
83	K	96.1	Very high	96.2	Very high	168 Å²	168	105.2 Å²	105.2	73%	0.73	55%	0.547	S	S	*	.	H	α-helix	trans	-67.1	-49.2	178.3	-66.5	-175.8	179.6	-177.8	0	111.8	T81 S85 L86 L87	T81-K83 PolarHBondContact O-N 3.09Å; K83-S85 VanDerWaalsContact C-N 3.35Å; K83-S85 PolarHBondContact O-N 2.91Å; K83-L86 PolarHBondContact O-N 3.27Å; K83-L87 VanDerWaalsContact O-CG 3.3Å; K83-L87 WeakPolarHBondContact O-CG 3.41Å; K83-L87 PolarHBondContact O-N 3Å
84	T	96	Very high	96.2	Very high	47 Å²	47	106.4 Å²	106.4	29%	0.288	56%	0.556	S	S	.	*	H	α-helix	trans	-66.1	-39.1	-179.4	53.7	0	0	0	0	111.6	F78 R79 T81 G88	F78-T84 HydrophobicContact CE2-CG2 4.24Å; R79-T84 PolarHBondContact O-OG1 3.3Å; T81-T84 PolarHBondContact N-OG1 3.4Å; T81-T84 PolarHBondContact O-N 3.2Å; T81-T84 PolarHBondContact O-OG1 2.94Å; T81-T84 WeakPolarHBondContact OG1-CG2 3.44Å; T81-T84 PolarHBondContact OG1-N 3.43Å; T81-T84 PolarHBondContact OG1-OG1 3.29Å; T81-T84 VanDerWaalsContact OG1-OG1 3.05Å; T84-G88 PolarHBondContact O-N 2.9Å
85	S	95.7	Very high	96.4	Very high	64 Å²	64	105 Å²	105	45%	0.448	55%	0.547	S	S	.	.	H	α-helix	trans	-66.4	-42.7	176.5	-59.4	0	0	0	0	111.7	T81 K83 G88 V89	T81-S85 WeakPolarHBondContact O-CB 3.16Å; T81-S85 PolarHBondContact O-N 3.2Å; T81-S85 PolarHBondContact O-OG 3.38Å; T81-S85 VanDerWaalsContact O-OG 3.11Å; K83-S85 VanDerWaalsContact C-N 3.35Å; K83-S85 PolarHBondContact O-N 2.91Å; S85-G88 PolarHBondContact O-N 2.96Å; S85-V89 WeakPolarHBondContact O-CG2 3.44Å; S85-V89 PolarHBondContact O-N 3.46Å
86	L	97	Very high	96.5	Very high	120 Å²	120	101.5 Å²	101.5	63%	0.628	54%	0.541	S	S	*	.	H	α-helix	trans	-61.1	-47.3	175.9	-178.7	64.9	0	0	0	111.5	K82 K83 G88 V89 M90	K82-L86 VanDerWaalsContact O-CB 3.27Å; K82-L86 WeakPolarHBondContact O-CB 3.28Å; K82-L86 PolarHBondContact O-N 3.49Å; K83-L86 PolarHBondContact O-N 3.27Å; L86-G88 VanDerWaalsContact C-N 3.32Å; L86-G88 PolarHBondContact O-N 3.33Å; L86-V89 PolarHBondContact O-N 3.31Å; L86-M90 VanDerWaalsContact O-CB 3.25Å; L86-M90 WeakPolarHBondContact O-CB 3.3Å; L86-M90 PolarHBondContact O-N 3.07Å
87	L	97.3	Very high	96.5	Very high	90 Å²	90	103.7 Å²	103.7	47%	0.471	54%	0.541	S	S	.	.	H	α-helix	trans	-62.4	-40.1	176.4	-68.2	170.6	0	0	0	111.5	K83 M90 F91	K83-L87 VanDerWaalsContact O-CG 3.3Å; K83-L87 WeakPolarHBondContact O-CG 3.41Å; K83-L87 PolarHBondContact O-N 3Å; L87-M90 HydrophobicContact CD2-CE 3.85Å; L87-M90 PolarHBondContact O-N 3.12Å; L87-F91 HydrophobicContact CB-CD2 4.39Å; L87-F91 HydrophobicContact CD2-CD2 4.36Å; L87-F91 HydrophobicContact CD2-CE2 3.86Å; L87-F91 WeakPolarHBondContact O-CB 3.33Å; L87-F91 WeakPolarHBondContact O-CD2 3.37Å; L87-F91 PolarHBondContact O-N 3.46Å
88	G	95.5	Very high	96.6	Very high	44 Å²	44	98.4 Å²	98.4	45%	0.454	52%	0.524	S	S	.	.	H	α-helix	trans	-61.1	-44.7	176.3	0	0	0	0	0	112.7	T84 S85 L86 G92	T84-G88 PolarHBondContact O-N 2.9Å; S85-G88 PolarHBondContact O-N 2.96Å; L86-G88 VanDerWaalsContact C-N 3.32Å; L86-G88 PolarHBondContact O-N 3.33Å; G88-G92 VanDerWaalsContact O-CA 3.29Å; G88-G92 WeakPolarHBondContact O-CA 3.35Å; G88-G92 PolarHBondContact O-N 3.45Å
89	V	96.9	Very high	96.7	Very high	80 Å²	80	97.2 Å²	97.2	49%	0.485	52%	0.522	S	S	.	.	H	α-helix	trans	-67.2	-46	175.4	173.3	0	0	0	0	110.8	S85 L86 F91 V93 V94	S85-V89 WeakPolarHBondContact O-CG2 3.44Å; S85-V89 PolarHBondContact O-N 3.46Å; L86-V89 PolarHBondContact O-N 3.31Å; V89-F91 PolarHBondContact O-N 3.19Å; V89-V93 HydrophobicContact CG1-CB 4.19Å; V89-V93 HydrophobicContact CG1-CG2 4.48Å; V89-V93 WeakPolarHBondContact O-CA 3.47Å; V89-V93 VanDerWaalsContact O-CB 3.32Å; V89-V93 WeakPolarHBondContact O-CB 3.36Å; V89-V93 PolarHBondContact O-N 3.02Å; V89-V94 PolarHBondContact O-N 3.35Å; V89-V94 VanDerWaalsContact O-N 3.16Å
90	M	97.5	Very high	96.8	Very high	85 Å²	85	94.9 Å²	94.9	42%	0.419	52%	0.515	S	S	.	.	H	α-helix	trans	-62.3	-40.3	-177.6	-173.1	179.5	75.7	0	0	112.6	L86 L87 V94 P95	L86-M90 VanDerWaalsContact O-CB 3.25Å; L86-M90 WeakPolarHBondContact O-CB 3.3Å; L86-M90 PolarHBondContact O-N 3.07Å; L87-M90 HydrophobicContact CD2-CE 3.85Å; L87-M90 PolarHBondContact O-N 3.12Å; M90-V94 WeakPolarHBondContact O-CB 3.28Å; M90-P95 WeakPolarHBondContact O-CD 3.45Å
91	F	96.8	Very high	97	Very high	147 Å²	147	97.4 Å²	97.4	65%	0.645	51%	0.511	S	S	*	.	H	α-helix	trans	-96.3	-22.5	-178.7	-69	-63.6	0	0	0	114.1	L87 V89 P95	L87-F91 HydrophobicContact CB-CD2 4.39Å; L87-F91 HydrophobicContact CD2-CD2 4.36Å; L87-F91 HydrophobicContact CD2-CE2 3.86Å; L87-F91 WeakPolarHBondContact O-CB 3.33Å; L87-F91 WeakPolarHBondContact O-CD2 3.37Å; L87-F91 PolarHBondContact O-N 3.46Å; V89-F91 PolarHBondContact O-N 3.19Å; F91-P95 WeakPolarHBondContact O-CG 3.11Å
92	G	95.6	Very high	97.1	Very high	42 Å²	42	98.9 Å²	98.9	43%	0.433	52%	0.516	S	S	.	.	H	α-helix	trans	-92.7	-44.6	179.4	0	0	0	0	0	113.5	G88 L96	G88-G92 VanDerWaalsContact O-CA 3.29Å; G88-G92 WeakPolarHBondContact O-CA 3.35Å; G88-G92 PolarHBondContact O-N 3.45Å; G92-L96 WeakPolarHBondContact O-CD1 3.31Å
93	V	97.1	Very high	97.2	Very high	60 Å²	60	95.3 Å²	95.3	36%	0.364	50%	0.501	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.8	-46.7	-169.1	178.9	0	0	0	0	111.6	V89 L96 F97	V89-V93 HydrophobicContact CG1-CB 4.19Å; V89-V93 HydrophobicContact CG1-CG2 4.48Å; V89-V93 WeakPolarHBondContact O-CA 3.47Å; V89-V93 VanDerWaalsContact O-CB 3.32Å; V89-V93 WeakPolarHBondContact O-CB 3.36Å; V89-V93 PolarHBondContact O-N 3.02Å; V93-L96 WeakPolarHBondContact O-CB 3.27Å; V93-L96 PolarHBondContact O-N 2.98Å; V93-L96 VanDerWaalsContact O-N 3.12Å; V93-F97 HydrophobicContact CG1-CD2 3.53Å; V93-F97 HydrophobicContact CG1-CE2 3.42Å; V93-F97 VanDerWaalsContact CG1-CE2 3.42Å; V93-F97 WeakPolarHBondContact O-CD2 3.49Å; V93-F97 PolarHBondContact O-N 3.42Å
94	V	97.6	Very high	97.3	Very high	80 Å²	80	91.5 Å²	91.5	49%	0.485	48%	0.484	S	S	.	.	H	α-helix	trans	-58.2	-43.5	-175.1	178	0	0	0	0	113	V89 M90 L96 F97 A98	V89-V94 PolarHBondContact O-N 3.35Å; V89-V94 VanDerWaalsContact O-N 3.16Å; M90-V94 WeakPolarHBondContact O-CB 3.28Å; V94-L96 VanDerWaalsContact C-N 3.26Å; V94-L96 PolarHBondContact O-N 3.44Å; V94-F97 PolarHBondContact O-N 2.93Å; V94-A98 WeakPolarHBondContact O-CB 3.49Å; V94-A98 PolarHBondContact O-N 3.49Å
95	P	98.1	Very high	97.3	Very high	55 Å²	55	91.2 Å²	91.2	36%	0.357	48%	0.482	S	S	.	.	H	α-helix	trans	-62	-33.8	178.6	-25	36.9	0	0	0	113	M90 F91 A98 L99	M90-P95 WeakPolarHBondContact O-CD 3.45Å; F91-P95 WeakPolarHBondContact O-CG 3.11Å; P95-A98 PolarHBondContact O-N 3Å; P95-L99 WeakPolarHBondContact O-CB 3.4Å; P95-L99 VanDerWaalsContact O-CG 3.27Å; P95-L99 WeakPolarHBondContact O-CG 3.47Å; P95-L99 PolarHBondContact O-N 3.38Å
96	L	97.7	Very high	97.4	Very high	119 Å²	119	92.9 Å²	92.9	62%	0.623	49%	0.486	S	S	*	.	H	α-helix	trans	-65.6	-46.6	177.4	-62.8	175.7	0	0	0	111.2	G92 V93 V94 Y100	G92-L96 WeakPolarHBondContact O-CD1 3.31Å; V93-L96 WeakPolarHBondContact O-CB 3.27Å; V93-L96 PolarHBondContact O-N 2.98Å; V93-L96 VanDerWaalsContact O-N 3.12Å; V94-L96 VanDerWaalsContact C-N 3.26Å; V94-L96 PolarHBondContact O-N 3.44Å; L96-Y100 VanDerWaalsContact O-CB 3.25Å; L96-Y100 WeakPolarHBondContact O-CB 3.41Å; L96-Y100 PolarHBondContact O-N 3.01Å
97	F	97.6	Very high	97.4	Very high	142 Å²	142	94.7 Å²	94.7	62%	0.623	49%	0.485	S	S	*	.	H	α-helix	trans	-67.3	-38	177	-79.9	-80.5	0	0	0	112.4	V93 V94 Y100 Y101	V93-F97 HydrophobicContact CG1-CD2 3.53Å; V93-F97 HydrophobicContact CG1-CE2 3.42Å; V93-F97 VanDerWaalsContact CG1-CE2 3.42Å; V93-F97 WeakPolarHBondContact O-CD2 3.49Å; V93-F97 PolarHBondContact O-N 3.42Å; V94-F97 PolarHBondContact O-N 2.93Å; F97-Y100 PolarHBondContact O-N 2.93Å; F97-Y101 WeakPolarHBondContact O-CB 3.39Å; F97-Y101 PolarHBondContact O-N 2.87Å
98	A	97.8	Very high	97.4	Very high	45 Å²	45	93.3 Å²	93.3	37%	0.372	48%	0.478	S	S	.	.	H	α-helix	trans	-62	-50.7	175.9	0	0	0	0	0	111.2	V94 P95 Y100 Y101 I102	V94-A98 WeakPolarHBondContact O-CB 3.49Å; V94-A98 PolarHBondContact O-N 3.49Å; P95-A98 PolarHBondContact O-N 3Å; A98-Y100 PolarHBondContact O-N 3.31Å; A98-Y101 PolarHBondContact O-N 3.33Å; A98-I102 VanDerWaalsContact O-CG1 3.28Å; A98-I102 WeakPolarHBondContact O-CG1 3.06Å; A98-I102 PolarHBondContact O-N 2.89Å
99	L	97.9	Very high	97.4	Very high	85 Å²	85	97 Å²	97	45%	0.445	48%	0.481	S	S	.	.	H	α-helix	trans	-63.3	-41.6	177.3	-71.8	174.8	0	0	0	111.8	P95 Y101 I102 F103	P95-L99 WeakPolarHBondContact O-CB 3.4Å; P95-L99 VanDerWaalsContact O-CG 3.27Å; P95-L99 WeakPolarHBondContact O-CG 3.47Å; P95-L99 PolarHBondContact O-N 3.38Å; L99-Y101 VanDerWaalsContact C-N 3.34Å; L99-Y101 PolarHBondContact O-N 2.96Å; L99-I102 PolarHBondContact O-N 3.48Å; L99-F103 HydrophobicContact CB-CD2 4.22Å; L99-F103 HydrophobicContact CB-CE2 3.98Å; L99-F103 HydrophobicContact CD2-CE2 4.05Å; L99-F103 HydrophobicContact CD2-CZ 4.13Å; L99-F103 HydrophobicContact CG-CE2 4.48Å; L99-F103 WeakPolarHBondContact O-CB 3.1Å; L99-F103 WeakPolarHBondContact O-CD2 3.38Å; L99-F103 WeakPolarHBondContact O-CG 3.35Å; L99-F103 PolarHBondContact O-N 3.47Å
100	Y	98	Very high	97.3	Very high	151 Å²	151	98.5 Å²	98.5	59%	0.592	48%	0.481	S	S	*	.	H	α-helix	trans	-55.6	-49.7	174.4	171.6	-98.9	0	0	0	111.3	L96 F97 A98 F103 K104	L96-Y100 VanDerWaalsContact O-CB 3.25Å; L96-Y100 WeakPolarHBondContact O-CB 3.41Å; L96-Y100 PolarHBondContact O-N 3.01Å; F97-Y100 PolarHBondContact O-N 2.93Å; A98-Y100 PolarHBondContact O-N 3.31Å; Y100-F103 PolarHBondContact O-N 2.86Å; Y100-K104 WeakPolarHBondContact O-CB 3.18Å; Y100-K104 PolarHBondContact O-N 3.32Å
101	Y	98.1	Very high	97.2	Very high	159 Å²	159	98.5 Å²	98.5	62%	0.624	48%	0.48	S	S	*	.	H	α-helix	trans	-65.2	-43.9	-179.1	-176.2	-98.3	0	0	0	112.4	F97 A98 L99 K104 T105	F97-Y101 WeakPolarHBondContact O-CB 3.39Å; F97-Y101 PolarHBondContact O-N 2.87Å; A98-Y101 PolarHBondContact O-N 3.33Å; L99-Y101 VanDerWaalsContact C-N 3.34Å; L99-Y101 PolarHBondContact O-N 2.96Å; Y101-K104 PolarHBondContact O-N 3.32Å; Y101-T105 HydrophobicContact CD1-CG2 4.28Å; Y101-T105 HydrophobicContact CD2-CG2 4.25Å; Y101-T105 HydrophobicContact CE1-CG2 3.91Å; Y101-T105 HydrophobicContact CE2-CG2 3.88Å; Y101-T105 HydrophobicContact CG-CG2 4.44Å; Y101-T105 WeakPolarHBondContact O-CB 3.3Å; Y101-T105 VanDerWaalsContact O-CG2 3.29Å; Y101-T105 WeakPolarHBondContact O-CG2 3.2Å; Y101-T105 PolarHBondContact O-N 3.02Å; Y101-T105 PolarHBondContact O-OG1 3.23Å
102	I	98.3	Very high	97.2	Very high	96 Å²	96	97.7 Å²	97.7	49%	0.492	48%	0.479	S	S	.	.	H	α-helix	trans	-60.5	-51.1	177.7	-68.2	165.7	0	0	0	110.2	A98 L99 K104 T105 D106	A98-I102 VanDerWaalsContact O-CG1 3.28Å; A98-I102 WeakPolarHBondContact O-CG1 3.06Å; A98-I102 PolarHBondContact O-N 2.89Å; L99-I102 PolarHBondContact O-N 3.48Å; I102-K104 PolarHBondContact O-N 3.49Å; I102-T105 PolarHBondContact O-OG1 3.09Å; I102-T105 VanDerWaalsContact O-OG1 3.05Å; I102-D106 WeakPolarHBondContact O-CB 3.46Å; I102-D106 PolarHBondContact O-N 2.85Å
103	F	98.1	Very high	97.1	Very high	122 Å²	122	99.7 Å²	99.7	54%	0.535	48%	0.477	S	S	.	.	H	α-helix	trans	-69	-36.5	-179	-65	-41	0	0	0	112.6	L99 Y100 R107	L99-F103 HydrophobicContact CB-CD2 4.22Å; L99-F103 HydrophobicContact CB-CE2 3.98Å; L99-F103 HydrophobicContact CD2-CE2 4.05Å; L99-F103 HydrophobicContact CD2-CZ 4.13Å; L99-F103 HydrophobicContact CG-CE2 4.48Å; L99-F103 WeakPolarHBondContact O-CB 3.1Å; L99-F103 WeakPolarHBondContact O-CD2 3.38Å; L99-F103 WeakPolarHBondContact O-CG 3.35Å; L99-F103 PolarHBondContact O-N 3.47Å; Y100-F103 PolarHBondContact O-N 2.86Å; F103-R107 VanDerWaalsContact O-CB 3.3Å; F103-R107 WeakPolarHBondContact O-CB 3.4Å; F103-R107 WeakPolarHBondContact O-CG 3.45Å; F103-R107 PolarHBondContact O-N 2.96Å
104	K	97.9	Very high	96.9	Very high	89 Å²	89	99.6 Å²	99.6	39%	0.387	48%	0.475	S	S	.	.	H	α-helix	trans	-64.8	-47.7	178.4	-178.5	54.6	174	151.8	0	111	Y100 Y101 I102 D106 R107 D108	Y100-K104 WeakPolarHBondContact O-CB 3.18Å; Y100-K104 PolarHBondContact O-N 3.32Å; Y101-K104 PolarHBondContact O-N 3.32Å; I102-K104 PolarHBondContact O-N 3.49Å; K104-D106 PolarHBondContact O-N 2.96Å; K104-R107 PolarHBondContact O-N 2.73Å; K104-D108 WeakPolarHBondContact CD-OD2 3.38Å; K104-D108 WeakPolarHBondContact CE-OD2 3.37Å; K104-D108 VanDerWaalsContact NZ-CG 3.26Å; K104-D108 IonicContact NZ-OD1 3.73Å; K104-D108 PolarHBondContact NZ-OD1 2.92Å; K104-D108 IonicContact NZ-OD2 2.69Å; K104-D108 PolarHBondContact NZ-OD2 3.22Å; K104-D108 WeakPolarHBondContact O-CB 3.37Å; K104-D108 PolarHBondContact O-N 3.05Å
105	T	97.6	Very high	96.7	Very high	40 Å²	40	104 Å²	104	25%	0.245	49%	0.487	C	S	.	.	H	α-helix	trans	-66	-38.2	179.2	54.9	0	0	0	0	112.6	Y101 I102 K109	Y101-T105 HydrophobicContact CD1-CG2 4.28Å; Y101-T105 HydrophobicContact CD2-CG2 4.25Å; Y101-T105 HydrophobicContact CE1-CG2 3.91Å; Y101-T105 HydrophobicContact CE2-CG2 3.88Å; Y101-T105 HydrophobicContact CG-CG2 4.44Å; Y101-T105 WeakPolarHBondContact O-CB 3.3Å; Y101-T105 VanDerWaalsContact O-CG2 3.29Å; Y101-T105 WeakPolarHBondContact O-CG2 3.2Å; Y101-T105 PolarHBondContact O-N 3.02Å; Y101-T105 PolarHBondContact O-OG1 3.23Å; I102-T105 PolarHBondContact O-OG1 3.09Å; I102-T105 VanDerWaalsContact O-OG1 3.05Å; T105-K109 WeakPolarHBondContact O-CB 3.32Å; T105-K109 WeakPolarHBondContact O-CD 3.5Å; T105-K109 WeakPolarHBondContact O-CG 3.4Å; T105-K109 PolarHBondContact O-N 2.86Å; T105-K109 VanDerWaalsContact O-N 3.11Å
106	D	97.3	Very high	96.6	Very high	99 Å²	99	104.7 Å²	104.7	53%	0.529	50%	0.498	S	S	.	.	H	α-helix	trans	-64.4	-46.9	174.5	-176	69.5	0	0	0	112	I102 K104 D108 K109 K110	I102-D106 WeakPolarHBondContact O-CB 3.46Å; I102-D106 PolarHBondContact O-N 2.85Å; K104-D106 PolarHBondContact O-N 2.96Å; D106-D108 PolarHBondContact O-N 3.28Å; D106-K109 PolarHBondContact O-N 3.35Å; D106-K110 WeakPolarHBondContact O-CB 3.46Å; D106-K110 PolarHBondContact O-N 3.28Å
107	R	96.6	Very high	96.3	Very high	159 Å²	159	102.1 Å²	102.1	60%	0.6	50%	0.5	S	S	*	.	H	α-helix	trans	-62.8	-44.6	178.5	-73.2	-179.8	69.8	83.1	8.7	112.2	F103 K104 K110 E111	F103-R107 VanDerWaalsContact O-CB 3.3Å; F103-R107 WeakPolarHBondContact O-CB 3.4Å; F103-R107 WeakPolarHBondContact O-CG 3.45Å; F103-R107 PolarHBondContact O-N 2.96Å; K104-R107 PolarHBondContact O-N 2.73Å; R107-K110 PolarHBondContact O-N 3.19Å; R107-E111 WeakPolarHBondContact O-CB 3.45Å; R107-E111 VanDerWaalsContact O-CG 3.31Å; R107-E111 WeakPolarHBondContact O-CG 3.46Å; R107-E111 PolarHBondContact O-N 2.93Å
108	D	97.4	Very high	96.1	Very high	61 Å²	61	100.3 Å²	100.3	33%	0.326	50%	0.5	S	S	.	.	H	α-helix	trans	-64.6	-44.4	-179.3	-69.5	-17.5	0	0	0	111	K104 D106 K110 E111 E112	K104-D108 WeakPolarHBondContact CD-OD2 3.38Å; K104-D108 WeakPolarHBondContact CE-OD2 3.37Å; K104-D108 VanDerWaalsContact NZ-CG 3.26Å; K104-D108 IonicContact NZ-OD1 3.73Å; K104-D108 PolarHBondContact NZ-OD1 2.92Å; K104-D108 IonicContact NZ-OD2 2.69Å; K104-D108 PolarHBondContact NZ-OD2 3.22Å; K104-D108 WeakPolarHBondContact O-CB 3.37Å; K104-D108 PolarHBondContact O-N 3.05Å; D106-D108 PolarHBondContact O-N 3.28Å; D108-K110 VanDerWaalsContact C-N 3.34Å; D108-K110 PolarHBondContact O-N 3.07Å; D108-E111 PolarHBondContact O-N 3.41Å; D108-E112 WeakPolarHBondContact O-CB 3.47Å; D108-E112 WeakPolarHBondContact O-CG 3.42Å; D108-E112 PolarHBondContact O-N 2.82Å
109	K	96.2	Very high	95.7	Very high	121 Å²	121	100.8 Å²	100.8	53%	0.526	50%	0.497	S	S	.	.	H	α-helix	trans	-59.1	-44.1	173.6	-73.9	173.3	-176.2	178.2	0	112.2	T105 D106 E112 M113	T105-K109 WeakPolarHBondContact O-CB 3.32Å; T105-K109 WeakPolarHBondContact O-CD 3.5Å; T105-K109 WeakPolarHBondContact O-CG 3.4Å; T105-K109 PolarHBondContact O-N 2.86Å; T105-K109 VanDerWaalsContact O-N 3.11Å; D106-K109 PolarHBondContact O-N 3.35Å; K109-E112 PolarHBondContact O-N 3Å; K109-M113 HydrophobicContact CB-CE 4.17Å; K109-M113 VanDerWaalsContact O-CG 3.32Å; K109-M113 WeakPolarHBondContact O-CG 3.47Å; K109-M113 PolarHBondContact O-N 3.11Å
110	K	94.4	Very high	95.2	Very high	112 Å²	112	103.8 Å²	103.8	49%	0.487	51%	0.513	S	S	.	.	H	α-helix	trans	-63.2	-45.2	178.6	-175.8	177.4	178.9	178.4	0	111.4	D106 R107 D108 M113 I114 L119	D106-K110 WeakPolarHBondContact O-CB 3.46Å; D106-K110 PolarHBondContact O-N 3.28Å; R107-K110 PolarHBondContact O-N 3.19Å; D108-K110 VanDerWaalsContact C-N 3.34Å; D108-K110 PolarHBondContact O-N 3.07Å; K110-M113 PolarHBondContact O-N 2.77Å; K110-I114 HydrophobicContact CG-CD1 4.13Å; K110-I114 VanDerWaalsContact O-CG1 3.25Å; K110-I114 WeakPolarHBondContact O-CG1 3.29Å; K110-I114 PolarHBondContact O-N 3.25Å; K110-L119 HydrophobicContact CG-CD2 4.21Å
111	E	95.2	Very high	94.6	Very high	85 Å²	85	103.7 Å²	103.7	40%	0.397	51%	0.511	S	S	.	.	H	α-helix	trans	-62.1	-41.3	176.4	-74.2	-67.6	159.1	0	0	111.9	R107 D108 I114 K115	R107-E111 WeakPolarHBondContact O-CB 3.45Å; R107-E111 VanDerWaalsContact O-CG 3.31Å; R107-E111 WeakPolarHBondContact O-CG 3.46Å; R107-E111 PolarHBondContact O-N 2.93Å; D108-E111 PolarHBondContact O-N 3.41Å; E111-I114 PolarHBondContact O-N 2.87Å; E111-K115 WeakPolarHBondContact O-CG 3.36Å; E111-K115 PolarHBondContact O-N 3.19Å
112	E	96.3	Very high	93.9	Very high	130 Å²	130	104.1 Å²	104.1	61%	0.607	52%	0.517	S	S	*	.	H	α-helix	trans	-61.4	-45.2	174.5	-75	174.9	179.8	0	0	111.9	D108 K109 I114 K115 A116	D108-E112 WeakPolarHBondContact O-CB 3.47Å; D108-E112 WeakPolarHBondContact O-CG 3.42Å; D108-E112 PolarHBondContact O-N 2.82Å; K109-E112 PolarHBondContact O-N 3Å; E112-I114 VanDerWaalsContact C-N 3.32Å; E112-I114 PolarHBondContact O-N 3.46Å; E112-K115 PolarHBondContact O-N 2.98Å; E112-A116 WeakPolarHBondContact O-CB 3.4Å; E112-A116 PolarHBondContact O-N 3.42Å
113	M	94.7	Very high	93.5	Very high	83 Å²	83	107.9 Å²	107.9	41%	0.409	53%	0.53	S	S	.	.	H	α-helix	trans	-65.5	-33.3	176.7	-66.4	-179.3	-143.4	0	0	112.9	K109 K110 G117 T118 L119	K109-M113 HydrophobicContact CB-CE 4.17Å; K109-M113 VanDerWaalsContact O-CG 3.32Å; K109-M113 WeakPolarHBondContact O-CG 3.47Å; K109-M113 PolarHBondContact O-N 3.11Å; K110-M113 PolarHBondContact O-N 2.77Å; M113-G117 PolarHBondContact O-N 2.98Å; M113-T118 PolarHBondContact O-N 2.9Å; M113-T118 PolarHBondContact O-OG1 3.33Å; M113-L119 HydrophobicContact CB-CB 3.88Å; M113-L119 HydrophobicContact CB-CD1 4.34Å; M113-L119 PolarHBondContact O-N 3.18Å; M113-L119 VanDerWaalsContact O-N 3.15Å; M113-L119 HydrophobicContact SD-CD1 4.26Å
114	I	92.3	Very high	92.8	Very high	59 Å²	59	105.1 Å²	105.1	30%	0.303	53%	0.525	S	S	.	.	H	α-helix	trans	-64.9	-48.6	173.6	-69.4	164.4	0	0	0	109.8	K110 E111 E112 A116 G117 L119	K110-I114 HydrophobicContact CG-CD1 4.13Å; K110-I114 VanDerWaalsContact O-CG1 3.25Å; K110-I114 WeakPolarHBondContact O-CG1 3.29Å; K110-I114 PolarHBondContact O-N 3.25Å; E111-I114 PolarHBondContact O-N 2.87Å; E112-I114 VanDerWaalsContact C-N 3.32Å; E112-I114 PolarHBondContact O-N 3.46Å; I114-A116 PolarHBondContact O-N 3.27Å; I114-G117 PolarHBondContact O-N 3.06Å; I114-G117 VanDerWaalsContact O-N 3.11Å; I114-L119 HydrophobicContact CD1-CD2 4.02Å; I114-L119 HydrophobicContact CG1-CB 4.3Å; I114-L119 HydrophobicContact CG1-CD2 3.42Å; I114-L119 VanDerWaalsContact CG1-CD2 3.42Å; I114-L119 HydrophobicContact CG1-CG 4.49Å
115	K	93.5	Very high	92.2	Very high	172 Å²	172	108.6 Å²	108.6	75%	0.748	55%	0.548	S	S	*	.	H	α-helix	trans	-64.8	-38	-179.8	-70.7	174.4	-174.2	178.1	0	112.6	E111 E112 G117	E111-K115 WeakPolarHBondContact O-CG 3.36Å; E111-K115 PolarHBondContact O-N 3.19Å; E112-K115 PolarHBondContact O-N 2.98Å; K115-G117 PolarHBondContact O-N 3.5Å
116	A	95.7	Very high	91.5	Very high	70 Å²	70	111.1 Å²	111.1	58%	0.579	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.9	-9.2	175.9	0	0	0	0	0	113.3	E112 I114 T118	E112-A116 WeakPolarHBondContact O-CB 3.4Å; E112-A116 PolarHBondContact O-N 3.42Å; I114-A116 PolarHBondContact O-N 3.27Å; A116-T118 HydrophobicContact CB-CG2 4.11Å; A116-T118 PolarHBondContact O-N 3.35Å
117	G	91.9	Very high	90.6	Very high	65 Å²	65	120.7 Å²	120.7	67%	0.67	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	69.3	11.2	-176.1	0	0	0	0	0	114.3	M113 I114 K115	M113-G117 PolarHBondContact O-N 2.98Å; I114-G117 PolarHBondContact O-N 3.06Å; I114-G117 VanDerWaalsContact O-N 3.11Å; K115-G117 PolarHBondContact O-N 3.5Å
118	T	93.2	Very high	90.3	Very high	103 Å²	103	118.8 Å²	118.8	63%	0.632	60%	0.597	S	S	*	*			trans	-86	-17.3	-178.5	54.6	0	0	0	0	112.7	M113 A116 N120	M113-T118 PolarHBondContact O-N 2.9Å; M113-T118 PolarHBondContact O-OG1 3.33Å; A116-T118 HydrophobicContact CB-CG2 4.11Å; A116-T118 PolarHBondContact O-N 3.35Å; T118-N120 PolarHBondContact O-N 3.37Å
119	L	89.7	Confident	89.9	Confident	56 Å²	56	121.8 Å²	121.8	29%	0.293	61%	0.612	S	S	.	*	S	Bend	trans	-73.6	118.7	178.5	-168.8	69.6	0	0	0	111.6	K110 M113 I114 R121	K110-L119 HydrophobicContact CG-CD2 4.21Å; M113-L119 HydrophobicContact CB-CB 3.88Å; M113-L119 HydrophobicContact CB-CD1 4.34Å; M113-L119 PolarHBondContact O-N 3.18Å; M113-L119 VanDerWaalsContact O-N 3.15Å; M113-L119 HydrophobicContact SD-CD1 4.26Å; I114-L119 HydrophobicContact CD1-CD2 4.02Å; I114-L119 HydrophobicContact CG1-CB 4.3Å; I114-L119 HydrophobicContact CG1-CD2 3.42Å; I114-L119 VanDerWaalsContact CG1-CD2 3.42Å; I114-L119 HydrophobicContact CG1-CG 4.49Å; L119-R121 PolarHBondContact O-N 3.19Å; L119-R121 VanDerWaalsContact O-N 3.1Å
120	N	86.7	Confident	89.5	Confident	148 Å²	148	121.9 Å²	121.9	79%	0.791	62%	0.617	S	S	*	*			trans	-72.8	103.4	175.2	-174.1	-1	0	0	0	111.4	T118	T118-N120 PolarHBondContact O-N 3.37Å
121	R	85.3	Confident	89.3	Confident	148 Å²	148	122.5 Å²	122.5	56%	0.558	62%	0.624	S	S	*	*			trans	-133.7	39.6	-176.8	-156.7	-177	72.9	179.3	-1.4	113.5	L119 F123	L119-R121 PolarHBondContact O-N 3.19Å; L119-R121 VanDerWaalsContact O-N 3.1Å; R121-F123 PolarHBondContact O-N 3.09Å
122	K	84.1	Confident	88.9	Confident	169 Å²	169	124.8 Å²	124.8	74%	0.735	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.4	-33.7	-170.6	-165.6	175.2	-178.1	178.9	0	115.5
123	F	89.1	Confident	88.4	Confident	175 Å²	175	124.5 Å²	124.5	77%	0.768	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.6	13.6	-174.9	-57.2	-69	0	0	0	114.3	R121 L125	R121-F123 PolarHBondContact O-N 3.09Å; F123-L125 PolarHBondContact O-N 3.27Å
124	S	83.7	Confident	87.9	Confident	63 Å²	63	127.4 Å²	127.4	44%	0.441	66%	0.657	S	S	.	*			trans	-81	84.7	176.4	-161	0	0	0	0	109.8	S126	S124-S126 PolarHBondContact OG-O 2.62Å
125	L	85.6	Confident	87.6	Confident	163 Å²	163	132.7 Å²	132.7	85%	0.853	68%	0.684	S	S	*	*			trans	-91.3	-19.3	178.1	-62.7	169.8	0	0	0	112.3	F123	F123-L125 PolarHBondContact O-N 3.27Å
126	S	83	Confident	87.1	Confident	93 Å²	93	129.4 Å²	129.4	65%	0.65	68%	0.679	S	S	*	*			trans	-109.8	150.7	171.6	58.8	0	0	0	0	111	S124	S124-S126 PolarHBondContact OG-O 2.62Å
127	Y	77.6	Confident	86.3	Confident	300 Å²	300	134.8 Å²	134.8	100%	1.176	69%	0.688	S	S	*	*			trans	-85	0	-179	-29.1	-80.8	0	0	0	112.4

Retrieved 127 of 127 residues in 218.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).