A0A087XD64_POEFO Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A087XD64, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 92 aa.

						>A0A087XD64_POEFO|A0A087XD64
MTSNSNLSNMRRLVEQLKLEASVERIKVSQAAAELQQYCLQNAGKDALLVGVPTGSNPFREPRSCAVFSLCCNAQSFKIMQNHCKSGTQTSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.1	Low	79.3	Confident	227 Å²	227	105.6 Å²	105.6	100%	1.118	57%	0.565	S	S	*	*				0	22.8	0	-69.7	-165.3	139.8	0	0	113.8
2	T	60.8	Low	80.6	Confident	106 Å²	106	112.3 Å²	112.3	65%	0.65	58%	0.576	S	S	*	*			trans	-97.3	-11.2	-175	40.7	0	0	0	0	114.6	S5 N6	T2-S5 PolarHBondContact O-OG 3.45Å; T2-N6 PolarHBondContact O-N 2.77Å; T2-N6 PolarHBondContact O-ND2 3.42Å
3	S	63.9	Low	81.8	Confident	89 Å²	89	110.2 Å²	110.2	62%	0.622	57%	0.566	S	S	*	*	H	α-helix	trans	-71	-39.9	-179	44.4	0	0	0	0	112.8	N6 L7	S3-N6 PolarHBondContact O-N 2.68Å; S3-L7 PolarHBondContact O-N 2.99Å
4	N	71	Confident	82.8	Confident	126 Å²	126	107.6 Å²	107.6	67%	0.674	56%	0.558	S	S	*	*	H	α-helix	trans	-69.7	-32.3	179.9	-85.7	-15.7	0	0	0	113.6	S8	N4-S8 PolarHBondContact O-N 3.24Å; N4-S8 VanDerWaalsContact O-N 3.15Å; N4-S8 PolarHBondContact O-OG 3.03Å
5	S	76.8	Confident	83.8	Confident	55 Å²	55	107.3 Å²	107.3	39%	0.385	55%	0.552	S	S	.	*	H	α-helix	trans	-72.6	-35.9	177	51.4	0	0	0	0	112.4	T2 S8 N9	T2-S5 PolarHBondContact O-OG 3.45Å; S5-S8 PolarHBondContact O-OG 3.47Å; S5-N9 PolarHBondContact O-N 3.38Å; S5-N9 VanDerWaalsContact O-N 3.12Å; S5-N9 PolarHBondContact O-ND2 3.32Å
6	N	86.8	Confident	84.6	Confident	95 Å²	95	106.4 Å²	106.4	51%	0.508	55%	0.545	S	S	.	.	H	α-helix	trans	-67	-40.3	174	-76.4	-58.3	0	0	0	111.7	T2 S3 S8 N9 M10	T2-N6 PolarHBondContact O-N 2.77Å; T2-N6 PolarHBondContact O-ND2 3.42Å; S3-N6 PolarHBondContact O-N 2.68Å; N6-S8 PolarHBondContact O-N 2.91Å; N6-N9 PolarHBondContact O-N 3.31Å; N6-M10 VanDerWaalsContact O-CG 3.3Å; N6-M10 WeakPolarHBondContact O-CG 3.28Å; N6-M10 PolarHBondContact O-N 3.47Å
7	L	89.7	Confident	85.4	Confident	75 Å²	75	105.2 Å²	105.2	39%	0.393	54%	0.54	S	S	.	.	H	α-helix	trans	-65	-39	177.3	-177	61	0	0	0	112.7	S3 R11	S3-L7 PolarHBondContact O-N 2.99Å; L7-R11 WeakPolarHBondContact O-CG 3.4Å; L7-R11 PolarHBondContact O-N 3.41Å; L7-R11 VanDerWaalsContact O-N 3.08Å
8	S	89.8	Confident	86.1	Confident	45 Å²	45	105.8 Å²	105.8	32%	0.315	54%	0.538	S	S	.	.	H	α-helix	trans	-68.3	-38	175.9	60.4	0	0	0	0	112.4	N4 S5 N6 R11 R12	N4-S8 PolarHBondContact O-N 3.24Å; N4-S8 VanDerWaalsContact O-N 3.15Å; N4-S8 PolarHBondContact O-OG 3.03Å; S5-S8 PolarHBondContact O-OG 3.47Å; N6-S8 PolarHBondContact O-N 2.91Å; S8-R11 PolarHBondContact O-N 2.87Å; S8-R12 WeakPolarHBondContact O-CG 3.32Å; S8-R12 PolarHBondContact O-N 3.44Å; S8-R12 VanDerWaalsContact O-N 3.08Å
9	N	92.6	Very high	86.6	Confident	80 Å²	80	106 Å²	106	43%	0.428	54%	0.54	S	S	.	.	H	α-helix	trans	-63.4	-44.1	174.2	-69.6	-18.2	0	0	0	111.9	S5 N6 R11 R12 L13	S5-N9 PolarHBondContact O-N 3.38Å; S5-N9 VanDerWaalsContact O-N 3.12Å; S5-N9 PolarHBondContact O-ND2 3.32Å; N6-N9 PolarHBondContact O-N 3.31Å; N9-R11 VanDerWaalsContact C-N 3.35Å; N9-R11 PolarHBondContact O-N 3.16Å; N9-R12 PolarHBondContact O-N 2.98Å; N9-L13 PolarHBondContact O-N 3.13Å
10	M	92.6	Very high	87.1	Confident	108 Å²	108	105.5 Å²	105.5	53%	0.532	54%	0.535	S	S	.	.	H	α-helix	trans	-63.1	-39.9	177	-70	-63.7	98.1	0	0	112.3	N6 L13 V14	N6-M10 VanDerWaalsContact O-CG 3.3Å; N6-M10 WeakPolarHBondContact O-CG 3.28Å; N6-M10 PolarHBondContact O-N 3.47Å; M10-L13 HydrophobicContact CE-CD2 4.08Å; M10-L13 PolarHBondContact O-N 3.41Å; M10-V14 WeakPolarHBondContact O-CG2 3.49Å; M10-V14 PolarHBondContact O-N 2.99Å
11	R	95	Very high	87.5	Confident	156 Å²	156	103.9 Å²	103.9	59%	0.589	54%	0.538	S	S	*	.	H	α-helix	trans	-60.9	-45.4	174	-74.2	173.8	178.8	140.1	-1.6	111.9	L7 S8 N9 L13 V14 E15	L7-R11 WeakPolarHBondContact O-CG 3.4Å; L7-R11 PolarHBondContact O-N 3.41Å; L7-R11 VanDerWaalsContact O-N 3.08Å; S8-R11 PolarHBondContact O-N 2.87Å; N9-R11 VanDerWaalsContact C-N 3.35Å; N9-R11 PolarHBondContact O-N 3.16Å; R11-L13 VanDerWaalsContact C-N 3.32Å; R11-L13 PolarHBondContact O-N 3.1Å; R11-V14 PolarHBondContact O-N 3.35Å; R11-E15 WeakPolarHBondContact O-CG 3.48Å; R11-E15 PolarHBondContact O-N 3.36Å
12	R	95.1	Very high	89.6	Confident	185 Å²	185	97.2 Å²	97.2	70%	0.698	51%	0.513	S	S	*	.	H	α-helix	trans	-60.3	-42.4	176.1	-72.1	176.6	-180	-176.6	-0.6	112	S8 N9 E15 Q16	S8-R12 WeakPolarHBondContact O-CG 3.32Å; S8-R12 PolarHBondContact O-N 3.44Å; S8-R12 VanDerWaalsContact O-N 3.08Å; N9-R12 PolarHBondContact O-N 2.98Å; R12-E15 PolarHBondContact O-N 3Å; R12-Q16 PolarHBondContact O-N 3.45Å
13	L	96.1	Very high	91.3	Very high	86 Å²	86	96.4 Å²	96.4	45%	0.45	51%	0.508	S	S	.	.	H	α-helix	trans	-62.7	-43.6	177.1	-179.2	61.7	0	0	0	111.7	N9 M10 R11 E15 Q16 L17	N9-L13 PolarHBondContact O-N 3.13Å; M10-L13 HydrophobicContact CE-CD2 4.08Å; M10-L13 PolarHBondContact O-N 3.41Å; R11-L13 VanDerWaalsContact C-N 3.32Å; R11-L13 PolarHBondContact O-N 3.1Å; L13-E15 PolarHBondContact O-N 3.2Å; L13-Q16 WeakPolarHBondContact O-CB 3.23Å; L13-Q16 PolarHBondContact O-N 3.36Å; L13-L17 HydrophobicContact CD1-CD1 4.28Å; L13-L17 HydrophobicContact CD1-CG 4.25Å; L13-L17 HydrophobicContact CG-CD1 4.02Å; L13-L17 HydrophobicContact CG-CG 4.42Å; L13-L17 WeakPolarHBondContact O-CB 3.49Å; L13-L17 VanDerWaalsContact O-CG 3.28Å; L13-L17 WeakPolarHBondContact O-CG 3.38Å; L13-L17 PolarHBondContact O-N 3.12Å
14	V	96.8	Very high	92.8	Very high	74 Å²	74	101.2 Å²	101.2	45%	0.448	52%	0.521	S	S	.	.	H	α-helix	trans	-62.3	-43.4	177	168.5	0	0	0	0	111.3	M10 R11 Q16 L17 K18	M10-V14 WeakPolarHBondContact O-CG2 3.49Å; M10-V14 PolarHBondContact O-N 2.99Å; R11-V14 PolarHBondContact O-N 3.35Å; V14-Q16 VanDerWaalsContact C-N 3.34Å; V14-Q16 PolarHBondContact O-N 3.36Å; V14-L17 PolarHBondContact O-N 3.5Å; V14-K18 HydrophobicContact CG1-CD 4.4Å; V14-K18 WeakPolarHBondContact O-CG 3.45Å; V14-K18 PolarHBondContact O-N 3.49Å
15	E	96.8	Very high	94	Very high	102 Å²	102	104.8 Å²	104.8	48%	0.477	53%	0.525	S	S	.	.	H	α-helix	trans	-62.8	-41	175.9	-66.5	-51.2	138.6	0	0	111.9	R11 R12 L13 K18 L19	R11-E15 WeakPolarHBondContact O-CG 3.48Å; R11-E15 PolarHBondContact O-N 3.36Å; R12-E15 PolarHBondContact O-N 3Å; L13-E15 PolarHBondContact O-N 3.2Å; E15-K18 PolarHBondContact O-N 2.93Å; E15-K18 IonicContact OE1-NZ 2.77Å; E15-K18 PolarHBondContact OE1-NZ 2.9Å; E15-K18 IonicContact OE2-NZ 3.6Å; E15-L19 WeakPolarHBondContact O-CG 3.45Å; E15-L19 PolarHBondContact O-N 3.39Å
16	Q	97.4	Very high	95	Very high	93 Å²	93	106.9 Å²	106.9	44%	0.435	53%	0.531	S	S	.	.	H	α-helix	trans	-60.8	-47.5	174.4	-179.7	61.8	23	0	0	112	R12 L13 V14 K18 L19 E20	R12-Q16 PolarHBondContact O-N 3.45Å; L13-Q16 WeakPolarHBondContact O-CB 3.23Å; L13-Q16 PolarHBondContact O-N 3.36Å; V14-Q16 VanDerWaalsContact C-N 3.34Å; V14-Q16 PolarHBondContact O-N 3.36Å; Q16-K18 VanDerWaalsContact C-N 3.29Å; Q16-K18 PolarHBondContact O-N 3.13Å; Q16-L19 WeakPolarHBondContact O-CB 3.45Å; Q16-L19 PolarHBondContact O-N 2.94Å; Q16-L19 VanDerWaalsContact O-N 3.13Å; Q16-E20 WeakPolarHBondContact CG-OE1 3.4Å; Q16-E20 PolarHBondContact NE2-OE1 3.41Å; Q16-E20 PolarHBondContact O-N 3.41Å
17	L	97.6	Very high	95.5	Very high	87 Å²	87	109.9 Å²	109.9	46%	0.455	54%	0.539	S	S	.	.	H	α-helix	trans	-64.3	-33.8	-179.9	-70.3	172	0	0	0	112.3	L13 V14 E20 A21	L13-L17 HydrophobicContact CD1-CD1 4.28Å; L13-L17 HydrophobicContact CD1-CG 4.25Å; L13-L17 HydrophobicContact CG-CD1 4.02Å; L13-L17 HydrophobicContact CG-CG 4.42Å; L13-L17 WeakPolarHBondContact O-CB 3.49Å; L13-L17 VanDerWaalsContact O-CG 3.28Å; L13-L17 WeakPolarHBondContact O-CG 3.38Å; L13-L17 PolarHBondContact O-N 3.12Å; V14-L17 PolarHBondContact O-N 3.5Å; L17-E20 PolarHBondContact O-N 2.89Å; L17-A21 VanDerWaalsContact O-CB 3.23Å; L17-A21 WeakPolarHBondContact O-CB 3.31Å; L17-A21 PolarHBondContact O-N 2.97Å
18	K	97.4	Very high	95.9	Very high	115 Å²	115	112.3 Å²	112.3	50%	0.5	56%	0.557	S	S	.	*	H	α-helix	trans	-62.3	-43.3	172.9	-74	171.2	-176.7	171.2	0	111.5	V14 E15 Q16 A21 S22	V14-K18 HydrophobicContact CG1-CD 4.4Å; V14-K18 WeakPolarHBondContact O-CG 3.45Å; V14-K18 PolarHBondContact O-N 3.49Å; E15-K18 PolarHBondContact O-N 2.93Å; E15-K18 IonicContact OE1-NZ 2.77Å; E15-K18 PolarHBondContact OE1-NZ 2.9Å; E15-K18 IonicContact OE2-NZ 3.6Å; Q16-K18 VanDerWaalsContact C-N 3.29Å; Q16-K18 PolarHBondContact O-N 3.13Å; K18-A21 PolarHBondContact O-N 3.31Å; K18-S22 PolarHBondContact O-N 3.26Å; K18-S22 VanDerWaalsContact O-N 3.1Å; K18-S22 PolarHBondContact O-OG 2.96Å
19	L	97.2	Very high	96.3	Very high	110 Å²	110	114.3 Å²	114.3	58%	0.576	57%	0.571	S	S	*	*	H	α-helix	trans	-63.5	-46.1	176.7	-65.1	172.8	0	0	0	111	E15 Q16 A21 S22	E15-L19 WeakPolarHBondContact O-CG 3.45Å; E15-L19 PolarHBondContact O-N 3.39Å; Q16-L19 WeakPolarHBondContact O-CB 3.45Å; Q16-L19 PolarHBondContact O-N 2.94Å; Q16-L19 VanDerWaalsContact O-N 3.13Å; L19-A21 VanDerWaalsContact C-N 3.32Å; L19-A21 PolarHBondContact O-N 2.81Å; L19-S22 PolarHBondContact O-N 3.48Å; L19-S22 VanDerWaalsContact O-N 3.16Å; L19-S22 PolarHBondContact O-OG 3.28Å
20	E	96	Very high	96.5	Very high	96 Å²	96	114.9 Å²	114.9	45%	0.449	57%	0.571	S	S	.	*	H	α-helix	trans	-64.7	-35.7	178	-70.9	175.7	-165	0	0	112.7	Q16 L17 S22 V23	Q16-E20 WeakPolarHBondContact CG-OE1 3.4Å; Q16-E20 PolarHBondContact NE2-OE1 3.41Å; Q16-E20 PolarHBondContact O-N 3.41Å; L17-E20 PolarHBondContact O-N 2.89Å; E20-S22 VanDerWaalsContact C-N 3.29Å; E20-S22 PolarHBondContact O-N 3.32Å; E20-V23 WeakPolarHBondContact O-CB 3.35Å; E20-V23 WeakPolarHBondContact O-CG2 3.49Å; E20-V23 PolarHBondContact O-N 2.98Å
21	A	95.7	Very high	96.7	Very high	71 Å²	71	111.2 Å²	111.2	59%	0.587	56%	0.558	S	S	*	*	H	α-helix	trans	-67.7	-30.1	175.5	0	0	0	0	0	112.6	L17 K18 L19 V23	L17-A21 VanDerWaalsContact O-CB 3.23Å; L17-A21 WeakPolarHBondContact O-CB 3.31Å; L17-A21 PolarHBondContact O-N 2.97Å; K18-A21 PolarHBondContact O-N 3.31Å; L19-A21 VanDerWaalsContact C-N 3.32Å; L19-A21 PolarHBondContact O-N 2.81Å; A21-V23 VanDerWaalsContact C-N 3.27Å; A21-V23 PolarHBondContact O-N 2.89Å
22	S	96.2	Very high	96.9	Very high	87 Å²	87	106.3 Å²	106.3	61%	0.608	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.2	-3.3	176.3	65.5	0	0	0	0	114.9	K18 L19 E20 E24	K18-S22 PolarHBondContact O-N 3.26Å; K18-S22 VanDerWaalsContact O-N 3.1Å; K18-S22 PolarHBondContact O-OG 2.96Å; L19-S22 PolarHBondContact O-N 3.48Å; L19-S22 VanDerWaalsContact O-N 3.16Å; L19-S22 PolarHBondContact O-OG 3.28Å; E20-S22 VanDerWaalsContact C-N 3.29Å; E20-S22 PolarHBondContact O-N 3.32Å; S22-E24 PolarHBondContact O-N 3.3Å
23	V	96.6	Very high	97	Very high	90 Å²	90	99.9 Å²	99.9	55%	0.545	54%	0.537	S	S	.	.	S	Bend	trans	-69.8	121.5	177	179.1	0	0	0	0	110	E20 A21 R25	E20-V23 WeakPolarHBondContact O-CB 3.35Å; E20-V23 WeakPolarHBondContact O-CG2 3.49Å; E20-V23 PolarHBondContact O-N 2.98Å; A21-V23 VanDerWaalsContact C-N 3.27Å; A21-V23 PolarHBondContact O-N 2.89Å; V23-R25 PolarHBondContact O-N 2.96Å
24	E	96.5	Very high	97	Very high	190 Å²	190	100.4 Å²	100.4	89%	0.888	54%	0.537	S	S	*	.	P	Polyproline II helix	trans	-66.6	125.8	173.6	-66.2	-164.6	156.7	0	0	110.6	S22	S22-E24 PolarHBondContact O-N 3.3Å
25	R	96.3	Very high	97.1	Very high	201 Å²	201	102.4 Å²	102.4	76%	0.758	55%	0.545	S	S	*	.	P	Polyproline II helix	trans	-102.4	137.2	179	-59.8	-173.2	-166.6	86	4.8	110.3	V23	V23-R25 PolarHBondContact O-N 2.96Å
26	I	96.9	Very high	97	Very high	98 Å²	98	103.8 Å²	103.8	50%	0.503	55%	0.551	S	S	.	*	P	Polyproline II helix	trans	-85.9	161.3	168.2	62.7	172.7	0	0	0	110.9	A31	I26-A31 HydrophobicContact CD1-CB 3.79Å; I26-A31 HydrophobicContact CG1-CB 4.27Å
27	K	97.8	Very high	97	Very high	158 Å²	158	104.8 Å²	104.8	69%	0.687	56%	0.556	S	S	*	*	P	Polyproline II helix	trans	-65.9	138.8	176	-68.5	-178.4	-178.8	175.1	0	110.1	S29 Q30 A31	K27-S29 PolarHBondContact O-N 3.46Å; K27-Q30 HydrophobicContact CB-CB 4.29Å; K27-Q30 WeakPolarHBondContact O-CB 3.31Å; K27-Q30 PolarHBondContact O-N 3.41Å; K27-A31 PolarHBondContact O-N 2.96Å
28	V	97.6	Very high	97	Very high	126 Å²	126	107.7 Å²	107.7	76%	0.764	56%	0.562	S	S	*	*	H	α-helix	trans	-57.8	-37.5	177	179.1	0	0	0	0	111.5	Q30 A31 A32	V28-Q30 VanDerWaalsContact C-N 3.31Å; V28-Q30 PolarHBondContact O-N 3.08Å; V28-A31 PolarHBondContact O-N 3.25Å; V28-A32 VanDerWaalsContact O-CB 3.31Å; V28-A32 WeakPolarHBondContact O-CB 3.28Å; V28-A32 PolarHBondContact O-N 3.08Å
29	S	97.8	Very high	96.9	Very high	87 Å²	87	106 Å²	106	61%	0.608	56%	0.564	S	S	*	*	H	α-helix	trans	-62.4	-37.3	176	55	0	0	0	0	113	K27 A33	K27-S29 PolarHBondContact O-N 3.46Å; S29-A33 WeakPolarHBondContact O-CB 3.45Å; S29-A33 PolarHBondContact O-N 3.5Å; S29-A33 VanDerWaalsContact O-N 3.13Å
30	Q	97.4	Very high	96.8	Very high	92 Å²	92	106.7 Å²	106.7	43%	0.43	57%	0.567	S	S	.	*	H	α-helix	trans	-69.3	-49.6	176.1	178	-179.8	-9.6	0	0	110.6	K27 V28 A32 A33 E34	K27-Q30 HydrophobicContact CB-CB 4.29Å; K27-Q30 WeakPolarHBondContact O-CB 3.31Å; K27-Q30 PolarHBondContact O-N 3.41Å; V28-Q30 VanDerWaalsContact C-N 3.31Å; V28-Q30 PolarHBondContact O-N 3.08Å; Q30-A32 VanDerWaalsContact C-N 3.27Å; Q30-A32 PolarHBondContact O-N 2.98Å; Q30-A33 PolarHBondContact O-N 3.15Å; Q30-A33 VanDerWaalsContact O-N 3.12Å; Q30-E34 VanDerWaalsContact CG-OE1 3.28Å; Q30-E34 WeakPolarHBondContact CG-OE1 3.3Å; Q30-E34 PolarHBondContact NE2-OE1 3.47Å; Q30-E34 WeakPolarHBondContact O-CG 3.49Å; Q30-E34 PolarHBondContact O-N 3.39Å
31	A	97.6	Very high	96.7	Very high	31 Å²	31	107.9 Å²	107.9	26%	0.256	57%	0.573	S	S	.	*	H	α-helix	trans	-57.1	-42	177.4	0	0	0	0	0	111.9	I26 K27 V28 E34 L35	I26-A31 HydrophobicContact CD1-CB 3.79Å; I26-A31 HydrophobicContact CG1-CB 4.27Å; K27-A31 PolarHBondContact O-N 2.96Å; V28-A31 PolarHBondContact O-N 3.25Å; A31-E34 PolarHBondContact O-N 3.05Å; A31-L35 WeakPolarHBondContact O-CB 3.47Å; A31-L35 VanDerWaalsContact O-CG 3.28Å; A31-L35 WeakPolarHBondContact O-CG 3.47Å; A31-L35 PolarHBondContact O-N 3.41Å
32	A	97.8	Very high	96.5	Very high	54 Å²	54	106.8 Å²	106.8	45%	0.446	56%	0.557	S	S	.	*	H	α-helix	trans	-64.4	-40.2	177.5	0	0	0	0	0	112.5	V28 Q30 L35 Q36	V28-A32 VanDerWaalsContact O-CB 3.31Å; V28-A32 WeakPolarHBondContact O-CB 3.28Å; V28-A32 PolarHBondContact O-N 3.08Å; Q30-A32 VanDerWaalsContact C-N 3.27Å; Q30-A32 PolarHBondContact O-N 2.98Å; A32-L35 PolarHBondContact O-N 3.36Å; A32-Q36 WeakPolarHBondContact O-CB 3.49Å; A32-Q36 PolarHBondContact O-N 3.12Å
33	A	97.5	Very high	96.2	Very high	50 Å²	50	103.9 Å²	103.9	41%	0.413	54%	0.539	S	S	.	.	H	α-helix	trans	-65.3	-43.4	176.4	0	0	0	0	0	111.7	S29 Q30 Q36 Q37	S29-A33 WeakPolarHBondContact O-CB 3.45Å; S29-A33 PolarHBondContact O-N 3.5Å; S29-A33 VanDerWaalsContact O-N 3.13Å; Q30-A33 PolarHBondContact O-N 3.15Å; Q30-A33 VanDerWaalsContact O-N 3.12Å; A33-Q36 PolarHBondContact O-N 3.2Å; A33-Q37 VanDerWaalsContact O-CB 3.31Å; A33-Q37 WeakPolarHBondContact O-CB 3.44Å; A33-Q37 PolarHBondContact O-N 3.48Å
34	E	96.9	Very high	95.6	Very high	97 Å²	97	102.6 Å²	102.6	45%	0.453	54%	0.543	S	S	.	.	H	α-helix	trans	-61.9	-43.9	176.7	-71	172.9	-163.4	0	0	111.5	Q30 A31 Q37 Y38	Q30-E34 VanDerWaalsContact CG-OE1 3.28Å; Q30-E34 WeakPolarHBondContact CG-OE1 3.3Å; Q30-E34 PolarHBondContact NE2-OE1 3.47Å; Q30-E34 WeakPolarHBondContact O-CG 3.49Å; Q30-E34 PolarHBondContact O-N 3.39Å; A31-E34 PolarHBondContact O-N 3.05Å; E34-Q37 PolarHBondContact O-N 3.44Å; E34-Y38 WeakPolarHBondContact O-CB 3.28Å; E34-Y38 PolarHBondContact O-N 3.38Å
35	L	97.6	Very high	95.1	Very high	116 Å²	116	101.8 Å²	101.8	61%	0.607	54%	0.537	S	S	*	.	H	α-helix	trans	-62.4	-45.7	174.9	-72	173.3	0	0	0	112	A31 A32 Q37 Y38 C39	A31-L35 WeakPolarHBondContact O-CB 3.47Å; A31-L35 VanDerWaalsContact O-CG 3.28Å; A31-L35 WeakPolarHBondContact O-CG 3.47Å; A31-L35 PolarHBondContact O-N 3.41Å; A32-L35 PolarHBondContact O-N 3.36Å; L35-Q37 VanDerWaalsContact C-N 3.34Å; L35-Q37 PolarHBondContact O-N 2.94Å; L35-Y38 PolarHBondContact O-N 3.23Å; L35-C39 PolarHBondContact O-N 3.31Å; L35-C39 PolarHBondContact O-SG 3.48Å; L35-C39 VanDerWaalsContact O-SG 3.33Å
36	Q	95.8	Very high	94.8	Very high	131 Å²	131	95.7 Å²	95.7	61%	0.612	52%	0.52	S	S	*	.	H	α-helix	trans	-60.1	-46.8	177.4	-179.5	-178.9	57.1	0	0	111	A32 A33 Y38 C39 L40	A32-Q36 WeakPolarHBondContact O-CB 3.49Å; A32-Q36 PolarHBondContact O-N 3.12Å; A33-Q36 PolarHBondContact O-N 3.2Å; Q36-Y38 VanDerWaalsContact C-N 3.32Å; Q36-Y38 PolarHBondContact O-N 2.98Å; Q36-C39 PolarHBondContact O-N 3.47Å; Q36-L40 HydrophobicContact CG-CD1 4.06Å; Q36-L40 HydrophobicContact CG-CG 4.45Å; Q36-L40 WeakPolarHBondContact O-CG 3.29Å; Q36-L40 PolarHBondContact O-N 2.83Å
37	Q	97.3	Very high	94.2	Very high	113 Å²	113	93.1 Å²	93.1	53%	0.528	51%	0.513	S	S	.	.	H	α-helix	trans	-60.8	-42.3	178.9	177.6	174.8	-4.7	0	0	111.3	A33 E34 L35 L40 Q41	A33-Q37 VanDerWaalsContact O-CB 3.31Å; A33-Q37 WeakPolarHBondContact O-CB 3.44Å; A33-Q37 PolarHBondContact O-N 3.48Å; E34-Q37 PolarHBondContact O-N 3.44Å; L35-Q37 VanDerWaalsContact C-N 3.34Å; L35-Q37 PolarHBondContact O-N 2.94Å; Q37-L40 PolarHBondContact O-N 3.15Å; Q37-Q41 VanDerWaalsContact NE2-NE2 3.17Å; Q37-Q41 VanDerWaalsContact O-CG 3.29Å; Q37-Q41 WeakPolarHBondContact O-CG 3.36Å; Q37-Q41 PolarHBondContact O-N 2.81Å
38	Y	96.9	Very high	93.6	Very high	149 Å²	149	93.4 Å²	93.4	58%	0.584	52%	0.521	S	S	*	.	H	α-helix	trans	-60.6	-46.5	174.9	178.8	-93.8	0	0	0	111.9	E34 L35 Q36 L40 Q41 N42	E34-Y38 WeakPolarHBondContact O-CB 3.28Å; E34-Y38 PolarHBondContact O-N 3.38Å; L35-Y38 PolarHBondContact O-N 3.23Å; Q36-Y38 VanDerWaalsContact C-N 3.32Å; Q36-Y38 PolarHBondContact O-N 2.98Å; Y38-L40 PolarHBondContact O-N 3.25Å; Y38-Q41 PolarHBondContact O-N 3.45Å; Y38-N42 WeakPolarHBondContact CD2-ND2 3.32Å; Y38-N42 VanDerWaalsContact CE2-ND2 3.32Å; Y38-N42 WeakPolarHBondContact CE2-ND2 3.47Å; Y38-N42 PolarHBondContact O-N 3.44Å; Y38-N42 VanDerWaalsContact O-N 3.15Å; Y38-N42 PolarHBondContact O-ND2 3.25Å
39	C	96	Very high	93	Very high	79 Å²	79	93.1 Å²	93.1	53%	0.534	51%	0.514	S	S	.	.	H	α-helix	trans	-61	-45.2	177.9	-69.6	0	0	0	0	111.6	L35 Q36 Q41 N42 A43	L35-C39 PolarHBondContact O-N 3.31Å; L35-C39 PolarHBondContact O-SG 3.48Å; L35-C39 VanDerWaalsContact O-SG 3.33Å; Q36-C39 PolarHBondContact O-N 3.47Å; C39-Q41 PolarHBondContact O-N 2.96Å; C39-N42 PolarHBondContact O-N 3.33Å; C39-A43 WeakPolarHBondContact O-CA 3.29Å; C39-A43 VanDerWaalsContact O-CB 3.29Å; C39-A43 WeakPolarHBondContact O-CB 3.46Å; C39-A43 PolarHBondContact O-N 3.26Å
40	L	93.7	Very high	92.3	Very high	125 Å²	125	93.6 Å²	93.6	65%	0.654	51%	0.513	S	S	*	.	H	α-helix	trans	-63.7	-39.1	179.6	-69.7	173.2	0	0	0	112.7	Q36 Q37 Y38 N42	Q36-L40 HydrophobicContact CG-CD1 4.06Å; Q36-L40 HydrophobicContact CG-CG 4.45Å; Q36-L40 WeakPolarHBondContact O-CG 3.29Å; Q36-L40 PolarHBondContact O-N 2.83Å; Q37-L40 PolarHBondContact O-N 3.15Å; Y38-L40 PolarHBondContact O-N 3.25Å; L40-N42 VanDerWaalsContact C-N 3.31Å; L40-N42 PolarHBondContact O-N 2.9Å
41	Q	94.4	Very high	91.3	Very high	121 Å²	121	91.1 Å²	91.1	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-67.5	-31.8	177.6	-72.6	175.4	29.2	0	0	112.9	Q37 Y38 C39	Q37-Q41 VanDerWaalsContact NE2-NE2 3.17Å; Q37-Q41 VanDerWaalsContact O-CG 3.29Å; Q37-Q41 WeakPolarHBondContact O-CG 3.36Å; Q37-Q41 PolarHBondContact O-N 2.81Å; Y38-Q41 PolarHBondContact O-N 3.45Å; C39-Q41 PolarHBondContact O-N 2.96Å
42	N	92.3	Very high	90.3	Very high	48 Å²	48	92.7 Å²	92.7	26%	0.257	52%	0.519	S	S	.	.	H	α-helix	trans	-100.8	-10.8	-176	-66.4	-73.4	0	0	0	113.7	Y38 C39 L40 G44 K45 D46	Y38-N42 WeakPolarHBondContact CD2-ND2 3.32Å; Y38-N42 VanDerWaalsContact CE2-ND2 3.32Å; Y38-N42 WeakPolarHBondContact CE2-ND2 3.47Å; Y38-N42 PolarHBondContact O-N 3.44Å; Y38-N42 VanDerWaalsContact O-N 3.15Å; Y38-N42 PolarHBondContact O-ND2 3.25Å; C39-N42 PolarHBondContact O-N 3.33Å; L40-N42 VanDerWaalsContact C-N 3.31Å; L40-N42 PolarHBondContact O-N 2.9Å; N42-G44 PolarHBondContact O-N 3.04Å; N42-G44 VanDerWaalsContact O-N 3.17Å; N42-K45 PolarHBondContact O-N 3.17Å; N42-D46 PolarHBondContact O-N 2.79Å
43	A	88.9	Confident	89	Confident	26 Å²	26	94.4 Å²	94.4	22%	0.215	53%	0.526	C	S	.	.	G	3₁₀ helix	trans	-50.8	-42.2	179.3	0	0	0	0	0	112.5	C39 K45 D46 L49 V50	C39-A43 WeakPolarHBondContact O-CA 3.29Å; C39-A43 VanDerWaalsContact O-CB 3.29Å; C39-A43 WeakPolarHBondContact O-CB 3.46Å; C39-A43 PolarHBondContact O-N 3.26Å; A43-K45 PolarHBondContact O-N 2.92Å; A43-D46 PolarHBondContact O-N 2.95Å; A43-L49 HydrophobicContact CB-CD2 3.63Å; A43-V50 VanDerWaalsContact O-CG2 3.29Å; A43-V50 WeakPolarHBondContact O-CG2 3.1Å
44	G	85.3	Confident	87.4	Confident	63 Å²	63	96.8 Å²	96.8	65%	0.649	54%	0.535	S	S	*	.	G	3₁₀ helix	trans	-66.5	-21	179.4	0	0	0	0	0	115	N42	N42-G44 PolarHBondContact O-N 3.04Å; N42-G44 VanDerWaalsContact O-N 3.17Å
45	K	86.3	Confident	85.9	Confident	172 Å²	172	96.2 Å²	96.2	75%	0.748	56%	0.555	S	S	*	*	G	3₁₀ helix	trans	-95.7	-12.2	179.5	-60.8	175.2	-174.2	167.5	0	112.2	N42 A43 A47	N42-K45 PolarHBondContact O-N 3.17Å; A43-K45 PolarHBondContact O-N 2.92Å; K45-A47 PolarHBondContact O-N 3.19Å
46	D	88.8	Confident	84.6	Confident	74 Å²	74	93.9 Å²	93.9	40%	0.396	55%	0.549	S	S	.	.			trans	-78.7	104	178.3	-171.2	-14.8	0	0	0	109.6	N42 A43 L48 L49 V50	N42-D46 PolarHBondContact O-N 2.79Å; A43-D46 PolarHBondContact O-N 2.95Å; D46-L48 PolarHBondContact O-N 3.24Å; D46-L48 WeakPolarHBondContact OD1-CB 3.29Å; D46-L48 PolarHBondContact OD1-N 3.21Å; D46-L49 HydrophobicContact CB-CB 3.91Å; D46-L49 PolarHBondContact O-N 3.27Å; D46-V50 PolarHBondContact O-N 2.9Å
47	A	84	Confident	83.5	Confident	44 Å²	44	90.4 Å²	90.4	36%	0.364	53%	0.534	S	S	.	.	H	α-helix	trans	-60	-22.8	178.1	0	0	0	0	0	113.3	K45 G51 V52	K45-A47 PolarHBondContact O-N 3.19Å; A47-G51 CarbonylContact O-C 3.3Å; A47-G51 VanDerWaalsContact O-C 3.3Å; A47-G51 WeakPolarHBondContact O-CA 3.33Å; A47-G51 PolarHBondContact O-N 3.47Å; A47-G51 VanDerWaalsContact O-N 3.08Å; A47-V52 HydrophobicContact CB-CG1 4.01Å; A47-V52 HydrophobicContact CB-CG2 4.24Å; A47-V52 PolarHBondContact O-N 3.08Å
48	L	85.3	Confident	82.5	Confident	164 Å²	164	90.4 Å²	90.4	86%	0.859	54%	0.544	S	S	*	.	H	α-helix	trans	-80.5	-28.8	176.2	-57.6	-179.1	0	0	0	111.9	D46	D46-L48 PolarHBondContact O-N 3.24Å; D46-L48 WeakPolarHBondContact OD1-CB 3.29Å; D46-L48 PolarHBondContact OD1-N 3.21Å
49	L	85.3	Confident	81.5	Confident	119 Å²	119	92.1 Å²	92.1	62%	0.623	56%	0.555	S	S	*	*	H	α-helix	trans	-87.2	-43.4	-179.1	-168.4	64.6	0	0	0	112.3	A43 D46	A43-L49 HydrophobicContact CB-CD2 3.63Å; D46-L49 HydrophobicContact CB-CB 3.91Å; D46-L49 PolarHBondContact O-N 3.27Å
50	V	83.6	Confident	80.1	Confident	97 Å²	97	94.1 Å²	94.1	59%	0.588	55%	0.551	S	S	*	*	H	α-helix	trans	-89	-19.5	-179.3	-178.4	0	0	0	0	112.1	A43 D46	A43-V50 VanDerWaalsContact O-CG2 3.29Å; A43-V50 WeakPolarHBondContact O-CG2 3.1Å; D46-V50 PolarHBondContact O-N 2.9Å
51	G	75.6	Confident	78.6	Confident	41 Å²	41	96 Å²	96	42%	0.423	56%	0.557	S	S	.	*			trans	81.2	146.3	-168.9	0	0	0	0	0	111.6	A47	A47-G51 CarbonylContact O-C 3.3Å; A47-G51 VanDerWaalsContact O-C 3.3Å; A47-G51 WeakPolarHBondContact O-CA 3.33Å; A47-G51 PolarHBondContact O-N 3.47Å; A47-G51 VanDerWaalsContact O-N 3.08Å
52	V	77.7	Confident	77.1	Confident	63 Å²	63	95.9 Å²	95.9	38%	0.382	57%	0.566	S	S	.	*			trans	-89.6	130.5	174.9	-121.7	0	0	0	0	109.5	A47 S56 N57	A47-V52 HydrophobicContact CB-CG1 4.01Å; A47-V52 HydrophobicContact CB-CG2 4.24Å; A47-V52 PolarHBondContact O-N 3.08Å; V52-S56 WeakPolarHBondContact CG1-OG 3.44Å; V52-N57 HydrophobicContact CB-CB 4.25Å; V52-N57 HydrophobicContact CG2-CB 4.24Å
53	P	69.8	Low	75.2	Confident	91 Å²	91	104 Å²	104	59%	0.591	59%	0.593	S	S	*	*			trans	-51.4	145.2	169.7	-25.1	31.6	0	0	0	111.5	G55 S56	P53-G55 PolarHBondContact O-N 3.31Å; P53-S56 WeakPolarHBondContact CD-OG 3.42Å; P53-S56 PolarHBondContact O-N 2.87Å; P53-S56 PolarHBondContact O-OG 2.97Å
54	T	64.5	Low	73.6	Confident	100 Å²	100	107.9 Å²	107.9	61%	0.613	62%	0.619	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.5	-18.7	-168.8	-37.5	0	0	0	0	114.6	R60	T54-R60 VanDerWaalsContact CG2-CZ 3.48Å; T54-R60 WeakPolarHBondContact O-CD 3.26Å
55	G	64.2	Low	71.6	Confident	84 Å²	84	108.4 Å²	108.4	87%	0.866	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.3	-6	178.7	0	0	0	0	0	116.3	P53	P53-G55 PolarHBondContact O-N 3.31Å
56	S	69.8	Low	69.8	Low	68 Å²	68	104.4 Å²	104.4	48%	0.476	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	-110.5	1.3	-177.1	71	0	0	0	0	114	V52 P53 P58	V52-S56 WeakPolarHBondContact CG1-OG 3.44Å; P53-S56 WeakPolarHBondContact CD-OG 3.42Å; P53-S56 PolarHBondContact O-N 2.87Å; P53-S56 PolarHBondContact O-OG 2.97Å; S56-P58 VanDerWaalsContact O-CD 3.26Å; S56-P58 WeakPolarHBondContact O-CD 3.43Å
57	N	74.1	Confident	68	Low	57 Å²	57	106 Å²	106	31%	0.305	62%	0.623	S	S	.	*			trans	-80.9	111.5	175.8	-179.9	0.9	0	0	0	110.3	V52 F59 R60	V52-N57 HydrophobicContact CB-CB 4.25Å; V52-N57 HydrophobicContact CG2-CB 4.24Å; N57-F59 PolarHBondContact O-N 2.99Å; N57-F59 PolarHBondContact OD1-N 3.26Å; N57-R60 HydrophobicContact CB-CB 4.14Å; N57-R60 WeakPolarHBondContact O-CB 3.46Å; N57-R60 PolarHBondContact O-N 3.19Å
58	P	75.8	Confident	66	Low	113 Å²	113	109.8 Å²	109.8	73%	0.734	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.3	-16.4	-178.1	29.2	-35.4	0	0	0	113.9	S56	S56-P58 VanDerWaalsContact O-CD 3.26Å; S56-P58 WeakPolarHBondContact O-CD 3.43Å
59	F	75.8	Confident	64.1	Low	185 Å²	185	106.3 Å²	106.3	81%	0.811	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	-2.3	177.4	-59.9	-75.4	0	0	0	113.2	N57 E61	N57-F59 PolarHBondContact O-N 2.99Å; N57-F59 PolarHBondContact OD1-N 3.26Å; F59-E61 PolarHBondContact O-N 3.45Å
60	R	66.3	Low	62.3	Low	122 Å²	122	107.6 Å²	107.6	46%	0.46	63%	0.627	S	S	.	*	S	Bend	trans	-80.4	121.5	177.1	-156.5	176.2	-163	-102.4	1.4	108.2	T54 N57	T54-R60 VanDerWaalsContact CG2-CZ 3.48Å; T54-R60 WeakPolarHBondContact O-CD 3.26Å; N57-R60 HydrophobicContact CB-CB 4.14Å; N57-R60 WeakPolarHBondContact O-CB 3.46Å; N57-R60 PolarHBondContact O-N 3.19Å
61	E	63.1	Low	60.4	Low	165 Å²	165	107 Å²	107	77%	0.771	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-48.8	130.6	171.2	-75.5	159.3	168.3	0	0	108.9	F59 R63	F59-E61 PolarHBondContact O-N 3.45Å; E61-R63 PolarHBondContact O-N 3Å
62	P	62.2	Low	58.8	Low	117 Å²	117	108 Å²	108	76%	0.76	63%	0.626	S	S	*	*	P	Polyproline II helix	trans	-52.8	121.9	170.1	-9.5	18.3	0	0	0	105.2	S64	P62-S64 VanDerWaalsContact C-N 3.3Å; P62-S64 PolarHBondContact O-N 3.47Å
63	R	53.9	Low	57.5	Low	219 Å²	219	112 Å²	112	83%	0.826	65%	0.646	S	S	*	*			trans	-48.5	104.5	179.6	-78.7	-119.8	-81.5	177.9	-5.2	106.7	E61 C65	E61-R63 PolarHBondContact O-N 3Å; R63-C65 PolarHBondContact O-N 2.79Å
64	S	53.8	Low	56.7	Low	108 Å²	108	110.7 Å²	110.7	76%	0.755	64%	0.642	S	S	*	*	S	Bend	trans	-65.5	95.9	178.8	41.8	0	0	0	0	105	P62	P62-S64 VanDerWaalsContact C-N 3.3Å; P62-S64 PolarHBondContact O-N 3.47Å
65	C	43.9	Very low	56	Low	73 Å²	73	114.6 Å²	114.6	49%	0.493	65%	0.654	S	S	.	*			trans	166	81.4	145.3	-88.2	0	0	0	0	111.1	R63 V67 F68	R63-C65 PolarHBondContact O-N 2.79Å; C65-V67 PolarHBondContact O-N 2.68Å; C65-F68 HydrophobicContact CB-CB 3.46Å; C65-F68 VanDerWaalsContact CB-CB 3.46Å
66	A	49.1	Very low	55.3	Low	88 Å²	88	115.2 Å²	115.2	73%	0.727	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.6	-15.2	144.4	0	0	0	0	0	111.1
67	V	50.6	Low	54.2	Low	108 Å²	108	119.1 Å²	119.1	66%	0.655	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	-29.3	-177.6	-172.4	0	0	0	0	113.1	C65 L70 C71	C65-V67 PolarHBondContact O-N 2.68Å; V67-L70 PolarHBondContact O-N 3.28Å; V67-C71 PolarHBondContact O-N 3.44Å
68	F	42.6	Very low	53.1	Low	123 Å²	123	125.1 Å²	125.1	54%	0.539	68%	0.677	S	S	.	*	H	α-helix	trans	-75.3	-25.1	178.8	-158.4	-97.1	0	0	0	113.1	C65 L70 C72	C65-F68 HydrophobicContact CB-CB 3.46Å; C65-F68 VanDerWaalsContact CB-CB 3.46Å; F68-L70 VanDerWaalsContact C-N 3.26Å; F68-L70 PolarHBondContact O-N 2.97Å; F68-C72 HydrophobicContact CD1-CB 3.92Å; F68-C72 HydrophobicContact CE1-CB 3.76Å; F68-C72 VanDerWaalsContact CE1-SG 3.58Å; F68-C72 HydrophobicContact CZ-CB 4.31Å; F68-C72 WeakPolarHBondContact O-CB 3.06Å; F68-C72 PolarHBondContact O-N 3.24Å
69	S	44.1	Very low	52.1	Low	91 Å²	91	126 Å²	126	64%	0.636	67%	0.674	S	S	*	*	H	α-helix	trans	-71	-23.3	171.8	-167.8	0	0	0	0	112.8
70	L	49	Very low	50.8	Low	146 Å²	146	124.7 Å²	124.7	76%	0.764	67%	0.672	S	S	*	*	H	α-helix	trans	-91.2	-32.7	176.6	-76.7	162.1	0	0	0	112.2	V67 F68	V67-L70 PolarHBondContact O-N 3.28Å; F68-L70 VanDerWaalsContact C-N 3.26Å; F68-L70 PolarHBondContact O-N 2.97Å
71	C	43.6	Very low	49.9	Very low	86 Å²	86	124.3 Å²	124.3	58%	0.581	68%	0.676	S	S	*	*	H	α-helix	trans	-83.5	-23.7	177.2	-132.4	0	0	0	0	113.4	V67 N73 A74	V67-C71 PolarHBondContact O-N 3.44Å; C71-N73 PolarHBondContact O-N 3.34Å; C71-A74 PolarHBondContact O-N 2.95Å
72	C	41.3	Very low	49.1	Very low	60 Å²	60	122.4 Å²	122.4	41%	0.405	67%	0.671	S	S	.	*	T	Hydrogen-bonded Turn	trans	-82.4	3.3	178.4	-147.8	0	0	0	0	113.9	F68	F68-C72 HydrophobicContact CD1-CB 3.92Å; F68-C72 HydrophobicContact CE1-CB 3.76Å; F68-C72 VanDerWaalsContact CE1-SG 3.58Å; F68-C72 HydrophobicContact CZ-CB 4.31Å; F68-C72 WeakPolarHBondContact O-CB 3.06Å; F68-C72 PolarHBondContact O-N 3.24Å
73	N	50.4	Low	48.4	Very low	148 Å²	148	124.2 Å²	124.2	79%	0.791	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.4	-1.1	164.9	-103.1	-47.1	0	0	0	113.5	C71	C71-N73 PolarHBondContact O-N 3.34Å
74	A	53.5	Low	47.9	Very low	63 Å²	63	119.2 Å²	119.2	52%	0.521	67%	0.666	S	S	.	*	S	Bend	trans	-136.2	103.6	174	0	0	0	0	0	111.6	C71	C71-A74 PolarHBondContact O-N 2.95Å
75	Q	49.1	Very low	47.4	Very low	182 Å²	182	121.9 Å²	121.9	85%	0.85	66%	0.664	S	S	*	*	S	Bend	trans	86.8	-8.5	146.4	-131.7	68	16.5	0	0	123.6
76	S	49.9	Very low	47.7	Very low	98 Å²	98	122.9 Å²	122.9	69%	0.685	67%	0.672	S	S	*	*			trans	-109.7	1.8	-170.6	-119.4	0	0	0	0	119.2	K78	S76-K78 PolarHBondContact O-N 3.49Å
77	F	45.4	Very low	47.6	Very low	150 Å²	150	121.5 Å²	121.5	66%	0.658	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.1	-7.8	-179.2	-128.8	-93.4	0	0	0	115.2
78	K	52.9	Low	47.1	Very low	182 Å²	182	122.8 Å²	122.8	79%	0.791	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.9	-13	-179.5	-95.9	168.2	178.7	169.4	0	114.8	S76	S76-K78 PolarHBondContact O-N 3.49Å
79	I	54.3	Low	47.1	Very low	131 Å²	131	125.1 Å²	125.1	67%	0.672	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.2	-28.2	-175.4	-64.8	175.8	0	0	0	112.5
80	M	47.2	Very low	47.2	Very low	158 Å²	158	126.9 Å²	126.9	78%	0.778	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	-8.6	-179.4	-89.5	-76.5	-78.8	0	0	115.5
81	Q	48.7	Very low	46.8	Very low	115 Å²	115	125.6 Å²	125.6	54%	0.537	70%	0.698	S	S	.	*	T	Hydrogen-bonded Turn	trans	-89.4	-24.5	173.3	-87	-120.9	22.2	0	0	113.5
82	N	46.6	Very low	46.5	Very low	125 Å²	125	131.1 Å²	131.1	67%	0.668	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-17.9	-178.4	-81.9	-21.1	0	0	0	113.9
83	H	45.9	Very low	46.8	Very low	155 Å²	155	134.7 Å²	134.7	72%	0.718	75%	0.754	S	S	*	*	S	Bend	trans	-89.3	-11.4	179.6	-133.1	-71.5	0	0	0	114.2
84	C	43.5	Very low	46.6	Very low	113 Å²	113	134 Å²	134	76%	0.764	75%	0.752	S	S	*	*	S	Bend	trans	-97	-10.1	179.3	-157.2	0	0	0	0	113.1
85	K	44.7	Very low	46.2	Very low	165 Å²	165	137.9 Å²	137.9	72%	0.717	77%	0.765	S	S	*	*	S	Bend	trans	-96.6	-12.2	175.9	-76	-173.4	178.3	-178.3	0	114.9
86	S	49.6	Very low	46.1	Very low	94 Å²	94	135.4 Å²	135.4	66%	0.657	76%	0.76	S	S	*	*	S	Bend	trans	-96.8	8.6	-178.2	50.5	0	0	0	0	114.5
87	G	46.2	Very low	45.8	Very low	59 Å²	59	137.7 Å²	137.7	61%	0.608	77%	0.765	S	S	*	*			trans	-108.2	0.8	-172.6	0	0	0	0	0	117.1	Q89	G87-Q89 PolarHBondContact O-N 3.48Å
88	T	41.6	Very low	45.8	Very low	135 Å²	135	136.9 Å²	136.9	83%	0.828	77%	0.772	S	S	*	*	S	Bend	trans	-94.4	97.6	169.7	30.6	0	0	0	0	109.2
89	Q	42.5	Very low	45.3	Very low	172 Å²	172	133.6 Å²	133.6	80%	0.804	77%	0.77	S	S	*	*			trans	-58.2	145.2	-177.2	-69.7	177.9	5.1	0	0	113.3	G87	G87-Q89 PolarHBondContact O-N 3.48Å
90	T	44.5	Very low	44.7	Very low	127 Å²	127	133.8 Å²	133.8	78%	0.779	78%	0.778	S	S	*	*			trans	-7.5	120.4	133.8	51.6	0	0	0	0	115.3
91	S	42.5	Very low	44.4	Very low	120 Å²	120	131.8 Å²	131.8	84%	0.839	78%	0.778	S	S	*	*			trans	-150.3	88.1	151.7	-90.2	0	0	0	0	109.4
92	S	37.1	Very low	44.1	Very low	202 Å²	202	133.4 Å²	133.4	100%	1.413	80%	0.8	S	S	*	*			trans	-175.3	0	136.6	-73.6	0	0	0	0	108.5

Retrieved 92 of 92 residues in 113.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).