A0A087XDH8_POEFO Loading...

Family with sequence similarity 162 member A

AlphaFold DB , UniProt , Accession A0A087XDH8, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 142 aa.

						>A0A087XDH8_POEFO|A0A087XDH8
MNFVRSRLSVGSLLGQRVRGMCNKLPEVKTESSSAAPAQEPRPSFRPPGYKPSNMDKKMLVWTGRFKSAEQIPETLSYETIDSARNKIRVKVAYMMMVLTLGACVLMVIMGKKAAGRNESLTAYNLEKKAKWREEIEKEKAQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.3	Very low	47.2	Very low	229 Å²	229	156.7 Å²	156.7	100%	1.128	83%	0.833	S	S	*	*				0	114.8	0	-70.2	125.6	82.3	0	0	109.2
2	N	39.8	Very low	47.6	Very low	156 Å²	156	153.3 Å²	153.3	83%	0.834	83%	0.83	S	S	*	*			trans	46.1	84.1	157.8	-55	-43.8	0	0	0	120.2	V4	N2-V4 PolarHBondContact O-N 2.86Å
3	F	43.8	Very low	47.4	Very low	213 Å²	213	154.6 Å²	154.6	93%	0.934	84%	0.835	S	S	*	*			trans	-80.8	100.6	151.7	-90.7	-90.3	0	0	0	108.9	R5	F3-R5 PolarHBondContact O-N 3.39Å
4	V	51.6	Low	47.8	Very low	126 Å²	126	156.6 Å²	156.6	76%	0.764	84%	0.844	S	S	*	*			trans	-69.3	100.1	170.5	177.3	0	0	0	0	108.1	N2 S6	N2-V4 PolarHBondContact O-N 2.86Å; V4-S6 VanDerWaalsContact C-N 3.35Å; V4-S6 PolarHBondContact O-N 2.98Å
5	R	48.7	Very low	47.8	Very low	211 Å²	211	151.5 Å²	151.5	80%	0.796	84%	0.843	S	S	*	*			trans	-68.2	89.5	169.5	-171.5	178.1	-172.2	170.2	2.6	108.2	F3 R7	F3-R5 PolarHBondContact O-N 3.39Å; R5-R7 PolarHBondContact O-N 2.73Å
6	S	45.3	Very low	47.9	Very low	110 Å²	110	154.9 Å²	154.9	77%	0.769	85%	0.85	S	S	*	*			trans	-61.2	104.8	173.1	-66.1	0	0	0	0	109.6	V4 L8	V4-S6 VanDerWaalsContact C-N 3.35Å; V4-S6 PolarHBondContact O-N 2.98Å; S6-L8 PolarHBondContact O-N 2.88Å
7	R	52	Low	47.8	Very low	209 Å²	209	160 Å²	160	79%	0.789	85%	0.854	S	S	*	*			trans	-60.5	124.7	169.7	-76.7	-85.6	-167.6	-147	1.8	108.5	R5 S9	R5-R7 PolarHBondContact O-N 2.73Å; R7-S9 PolarHBondContact O-N 3.1Å
8	L	44.6	Very low	47.8	Very low	153 Å²	153	159.2 Å²	159.2	80%	0.801	86%	0.855	S	S	*	*			trans	-39.3	116.2	162.8	-73.2	123.2	0	0	0	111.4	S6 V10	S6-L8 PolarHBondContact O-N 2.88Å; L8-V10 VanDerWaalsContact C-N 3.29Å; L8-V10 HydrophobicContact CB-CB 4.5Å; L8-V10 HydrophobicContact CB-CG2 4.42Å; L8-V10 HydrophobicContact CD2-CB 4.17Å; L8-V10 HydrophobicContact CD2-CG2 3.67Å; L8-V10 PolarHBondContact O-N 2.7Å
9	S	51.1	Low	48.1	Very low	122 Å²	122	163.6 Å²	163.6	85%	0.853	86%	0.859	S	S	*	*			trans	-93.2	74.3	151.4	-171	0	0	0	0	107.2	R7	R7-S9 PolarHBondContact O-N 3.1Å
10	V	51.1	Low	47.9	Very low	122 Å²	122	159 Å²	159	74%	0.739	85%	0.852	S	S	*	*			trans	-116.6	90.8	168.2	173.4	0	0	0	0	104.9	L8	L8-V10 VanDerWaalsContact C-N 3.29Å; L8-V10 HydrophobicContact CB-CB 4.5Å; L8-V10 HydrophobicContact CB-CG2 4.42Å; L8-V10 HydrophobicContact CD2-CB 4.17Å; L8-V10 HydrophobicContact CD2-CG2 3.67Å; L8-V10 PolarHBondContact O-N 2.7Å
11	G	49.9	Very low	47.8	Very low	73 Å²	73	159.9 Å²	159.9	75%	0.753	85%	0.854	S	S	*	*			trans	162.2	69.2	178.3	0	0	0	0	0	114.8
12	S	52.3	Low	48.2	Very low	115 Å²	115	154.9 Å²	154.9	80%	0.804	84%	0.84	S	S	*	*	S	Bend	trans	-155.1	17.4	157.8	71.6	0	0	0	0	116.2
13	L	45.4	Very low	48.7	Very low	171 Å²	171	154.9 Å²	154.9	90%	0.895	84%	0.839	S	S	*	*	S	Bend	trans	-118.4	23.3	178.4	-87.6	165	0	0	0	114.6
14	L	51.7	Low	48.2	Very low	182 Å²	182	154.3 Å²	154.3	95%	0.953	84%	0.837	S	S	*	*	S	Bend	trans	-138.4	85.2	171.8	-75.3	168.2	0	0	0	109.2
15	G	47.8	Very low	47.7	Very low	80 Å²	80	156 Å²	156	83%	0.825	84%	0.84	S	S	*	*			trans	166.2	55.2	175.4	0	0	0	0	0	117.6
16	Q	49.4	Very low	47.6	Very low	206 Å²	206	151 Å²	151	96%	0.963	84%	0.835	S	S	*	*			trans	-135	76.7	156.5	-138.8	175.7	20.4	0	0	110.2
17	R	46.8	Very low	47	Very low	242 Å²	242	154 Å²	154	91%	0.913	84%	0.838	S	S	*	*			trans	-141.6	87.5	165.4	-165.4	179.8	-156.2	168.2	6.1	108.5
18	V	47.4	Very low	46.1	Very low	146 Å²	146	150.9 Å²	150.9	89%	0.885	84%	0.841	S	S	*	*			trans	-123.7	118.6	163.4	174.6	0	0	0	0	108.1
19	R	54.7	Low	45.7	Very low	243 Å²	243	150.8 Å²	150.8	92%	0.917	83%	0.834	S	S	*	*			trans	-63.9	146.2	170.3	-80.8	167	151.3	179.3	-7.7	110.8
20	G	44.2	Very low	44.6	Very low	71 Å²	71	151.7 Å²	151.7	73%	0.732	84%	0.835	S	S	*	*			trans	-179.6	139.6	150.3	0	0	0	0	0	108.9
21	M	44.8	Very low	43.8	Very low	178 Å²	178	152.9 Å²	152.9	88%	0.877	83%	0.832	S	S	*	*			cis	-158	145.2	-2.2	-97.7	154	58.9	0	0	106.1
22	C	49.8	Very low	43	Very low	124 Å²	124	154.5 Å²	154.5	84%	0.838	83%	0.832	S	S	*	*			trans	-69.2	135.7	169.3	-163.4	0	0	0	0	109.4
23	N	49.7	Very low	42.1	Very low	155 Å²	155	154.7 Å²	154.7	83%	0.829	83%	0.833	S	S	*	*			trans	-115.4	130.8	158.5	-89.4	-40.7	0	0	0	109.5
24	K	34.8	Very low	41.5	Very low	202 Å²	202	151.8 Å²	151.8	88%	0.878	83%	0.827	S	S	*	*			trans	-36.9	130.6	-177.2	-95.2	160.8	165.8	-92.5	0	118.4
25	L	40	Very low	40.7	Very low	160 Å²	160	147 Å²	147	84%	0.838	81%	0.814	S	S	*	*			trans	-26.5	177.9	132.6	-73.5	163.7	0	0	0	117
26	P	46.9	Very low	40.6	Very low	107 Å²	107	148.1 Å²	148.1	70%	0.695	82%	0.815	S	S	*	*			cis	-138.7	169.3	-19	31	-10.2	0	0	0	114.1
27	E	32.4	Very low	40.2	Very low	174 Å²	174	143.7 Å²	143.7	81%	0.813	81%	0.805	S	S	*	*			trans	162.8	108.2	132.1	-100.9	-165.5	98.3	0	0	110.4
28	V	33.9	Very low	40.1	Very low	142 Å²	142	136.6 Å²	136.6	86%	0.861	80%	0.798	S	S	*	*				-143.5	105	126	177.6	0	0	0	0	106.5
29	K	35.1	Very low	40	Very low	152 Å²	152	139.2 Å²	139.2	66%	0.661	80%	0.8	S	S	*	*			trans	-15.6	118.7	162.1	-163.9	168.8	-173.9	170.5	0	115.7	E31	K29-E31 WeakPolarHBondContact CE-OE2 3.32Å; K29-E31 IonicContact NZ-OE2 2.88Å
30	T	28.3	Very low	39.4	Very low	140 Å²	140	135.6 Å²	135.6	86%	0.859	79%	0.794	S	S	*	*			trans	-133.9	81.4	144.4	-30.8	0	0	0	0	107.4	S32	T30-S32 PolarHBondContact O-N 3.44Å
31	E	35.5	Very low	39.8	Very low	147 Å²	147	137.5 Å²	137.5	69%	0.687	79%	0.794	S	S	*	*			trans	-69.7	113.3	156.1	-74.2	179.8	116.3	0	0	107.2	K29	K29-E31 WeakPolarHBondContact CE-OE2 3.32Å; K29-E31 IonicContact NZ-OE2 2.88Å
32	S	31.7	Very low	40.1	Very low	108 Å²	108	140 Å²	140	76%	0.755	79%	0.793	S	S	*	*				167	122.1	116	54.5	0	0	0	0	111.1	T30	T30-S32 PolarHBondContact O-N 3.44Å
33	S	34.1	Very low	40.1	Very low	118 Å²	118	140.3 Å²	140.3	83%	0.825	79%	0.793	S	S	*	*			trans	62.9	115.4	136.8	-132.6	0	0	0	0	120.6
34	S	32.9	Very low	40.4	Very low	110 Å²	110	136.6 Å²	136.6	77%	0.769	78%	0.78	S	S	*	*				94.2	130.2	126.7	-155.9	0	0	0	0	118.7
35	A	35.2	Very low	41.3	Very low	81 Å²	81	136.1 Å²	136.1	67%	0.669	78%	0.778	S	S	*	*			trans	66.4	116	154.1	0	0	0	0	0	117.8	P37	A35-P37 WeakPolarHBondContact O-CD 3.01Å
36	A	44.9	Very low	42.1	Very low	104 Å²	104	138.2 Å²	138.2	86%	0.86	78%	0.775	S	S	*	*			trans	-55.9	137	153.4	0	0	0	0	0	109.7
37	P	41.6	Very low	42.6	Very low	114 Å²	114	136.3 Å²	136.3	74%	0.74	76%	0.762	S	S	*	*				-136.3	151.7	123.3	30.8	-15.4	0	0	0	112.6	A35	A35-P37 WeakPolarHBondContact O-CD 3.01Å
38	A	45.1	Very low	43.8	Very low	93 Å²	93	133.7 Å²	133.7	77%	0.769	76%	0.76	S	S	*	*			trans	35.3	109.2	149.9	0	0	0	0	0	117.9	E40	A38-E40 PolarHBondContact O-N 3.34Å
39	Q	45.5	Very low	44.8	Very low	200 Å²	200	128.9 Å²	128.9	94%	0.935	74%	0.739	S	S	*	*			trans	-60.5	99.4	165.4	-69.6	-173.4	-11.1	0	0	110.2
40	E	40.7	Very low	46	Very low	167 Å²	167	125.8 Å²	125.8	78%	0.78	72%	0.724	S	S	*	*			trans	-48.8	130.7	162.2	-84	-89.7	143	0	0	109.9	A38 R42	A38-E40 PolarHBondContact O-N 3.34Å; E40-R42 PolarHBondContact O-N 2.95Å
41	P	53.1	Low	47.5	Very low	112 Å²	112	124.8 Å²	124.8	73%	0.727	71%	0.708	S	S	*	*			trans	-62.9	110.5	173.8	25.9	-30.3	0	0	0	107.7
42	R	51.8	Low	48.8	Very low	230 Å²	230	118.2 Å²	118.2	87%	0.868	68%	0.678	S	S	*	*			trans	-47.5	132	175.5	-67.3	-166.9	176.7	170.9	0.4	108.6	E40 S44	E40-R42 PolarHBondContact O-N 2.95Å; R42-S44 VanDerWaalsContact C-N 3.3Å; R42-S44 PolarHBondContact O-N 3.31Å
43	P	48.5	Very low	50.5	Low	130 Å²	130	115.9 Å²	115.9	84%	0.844	66%	0.662	S	S	*	*			trans	-61.8	99.5	-179.3	24.2	-31.8	0	0	0	107.5	F45	P43-F45 VanDerWaalsContact C-N 3.3Å; P43-F45 PolarHBondContact O-N 3.07Å
44	S	57.3	Low	52.2	Low	77 Å²	77	115.6 Å²	115.6	54%	0.538	65%	0.651	S	S	.	*			trans	-64.5	99.3	172.5	60.3	0	0	0	0	105	R42 R46	R42-S44 VanDerWaalsContact C-N 3.3Å; R42-S44 PolarHBondContact O-N 3.31Å; S44-R46 PolarHBondContact O-N 2.96Å
45	F	52.9	Low	53.7	Low	193 Å²	193	115.8 Å²	115.8	85%	0.846	64%	0.641	S	S	*	*			trans	-62	85.6	165.3	-170.3	-97.7	0	0	0	105.7	P43 P47	P43-F45 VanDerWaalsContact C-N 3.3Å; P43-F45 PolarHBondContact O-N 3.07Å; F45-P47 WeakPolarHBondContact O-CD 3.44Å
46	R	57	Low	55.3	Low	204 Å²	204	112.5 Å²	112.5	77%	0.77	61%	0.612	S	S	*	*			trans	-74.8	106.6	-172	-151.8	177	-73.9	149.1	-5.1	103.8	S44	S44-R46 PolarHBondContact O-N 2.96Å
47	P	57.1	Low	56.6	Low	66 Å²	66	110.4 Å²	110.4	43%	0.429	58%	0.584	S	S	.	*	P	Polyproline II helix	trans	-56.1	140	179.5	-19.3	32.5	0	0	0	107.7	F45 G49 Y78	F45-P47 WeakPolarHBondContact O-CD 3.44Å; P47-G49 PolarHBondContact O-N 3.18Å; P47-G49 VanDerWaalsContact O-N 3.11Å; P47-Y78 HydrophobicContact CB-CD2 4.37Å; P47-Y78 HydrophobicContact CB-CE2 4.37Å; P47-Y78 HydrophobicContact CG-CD2 4.47Å
48	P	56.9	Low	58.2	Low	119 Å²	119	111.6 Å²	111.6	77%	0.773	58%	0.577	S	S	*	*	S	Bend	trans	-50	125.4	-178.1	18.6	-29.7	0	0	0	108.6	Y50	P48-Y50 PolarHBondContact O-N 3.05Å; P48-Y50 VanDerWaalsContact O-N 3.11Å
49	G	56.4	Low	59.3	Low	41 Å²	41	109.9 Å²	109.9	42%	0.423	55%	0.554	S	S	.	*	P	Polyproline II helix	trans	-46.3	118.2	-165	0	0	0	0	0	112	P47 K51	P47-G49 PolarHBondContact O-N 3.18Å; P47-G49 VanDerWaalsContact O-N 3.11Å; G49-K51 PolarHBondContact O-N 3.11Å; G49-K51 VanDerWaalsContact O-N 3.12Å
50	Y	60	Low	60.6	Low	88 Å²	88	100.5 Å²	100.5	35%	0.345	51%	0.51	S	S	.	.	B	Isolated β-bridge	trans	-66.2	112.4	175.4	-177.2	-101.8	0	0	0	108	P48 P52 Y78 I81	P48-Y50 PolarHBondContact O-N 3.05Å; P48-Y50 VanDerWaalsContact O-N 3.11Å; Y50-P52 WeakPolarHBondContact O-CD 3.4Å; Y50-P52 VanDerWaalsContact O-N 3.14Å; Y50-Y78 HydrophobicContact CG-CE2 4.35Å; Y50-I81 HydrophobicContact CD1-CD1 3.71Å; Y50-I81 HydrophobicContact CE1-CD1 4.21Å
51	K	60.3	Low	62.2	Low	118 Å²	118	95.2 Å²	95.2	51%	0.513	49%	0.489	S	S	.	.			trans	-63.3	110.6	170.6	-74	-90.6	-174.5	172.3	0	106.9	G49 S53 E74	G49-K51 PolarHBondContact O-N 3.11Å; G49-K51 VanDerWaalsContact O-N 3.12Å; K51-S53 PolarHBondContact O-N 3.32Å; K51-E74 HydrophobicContact CD-CB 4.37Å; K51-E74 IonicContact NZ-OE1 3.58Å; K51-E74 PolarHBondContact NZ-OE1 3.48Å; K51-E74 IonicContact NZ-OE2 3.34Å; K51-E74 PolarHBondContact NZ-OE2 3.41Å
52	P	62.2	Low	63.1	Low	10 Å²	10	98.1 Å²	98.1	7%	0.065	49%	0.486	C	S	.	.			trans	-62.6	124.6	-176.9	22.6	-29.5	0	0	0	109.6	Y50 D56 K57 I72 E74 L76	Y50-P52 WeakPolarHBondContact O-CD 3.4Å; Y50-P52 VanDerWaalsContact O-N 3.14Å; P52-D56 HydrophobicContact CB-CB 4.23Å; P52-K57 HydrophobicContact CB-CG 4.32Å; P52-K57 HydrophobicContact CG-CG 4.46Å; P52-K57 WeakPolarHBondContact O-CE 3.47Å; P52-I72 HydrophobicContact CG-CG2 4.15Å; P52-E74 WeakPolarHBondContact CD-O 3.25Å; P52-L76 HydrophobicContact CB-CD1 4.27Å; P52-L76 HydrophobicContact CG-CD1 4.14Å; P52-L76 HydrophobicContact CG-CG 4.26Å
53	S	68.1	Low	64	Low	58 Å²	58	88.4 Å²	88.4	41%	0.406	45%	0.452	S	S	.	.			trans	-60.5	156.5	175.6	178.4	0	0	0	0	110.2	K51 M55 D56 K57	K51-S53 PolarHBondContact O-N 3.32Å; S53-M55 PolarHBondContact O-N 2.94Å; S53-D56 PolarHBondContact N-OD2 3.33Å; S53-D56 PolarHBondContact O-N 3.11Å; S53-K57 PolarHBondContact O-N 2.99Å
54	N	68.6	Low	64.9	Low	113 Å²	113	85.2 Å²	85.2	60%	0.604	44%	0.443	S	S	*	.	H	α-helix	trans	-54.2	-28	177.4	-72.4	-52.4	0	0	0	112.7	K58	N54-K58 WeakPolarHBondContact O-CG 3.49Å; N54-K58 PolarHBondContact O-N 3.19Å
55	M	64.3	Low	65.3	Low	114 Å²	114	87.1 Å²	87.1	56%	0.562	44%	0.438	S	S	*	.	H	α-helix	trans	-71.2	-43	173.6	-68.3	-63.3	100.5	0	0	112.8	S53 K57 K58 M59	S53-M55 PolarHBondContact O-N 2.94Å; M55-K57 VanDerWaalsContact C-N 3.32Å; M55-K57 PolarHBondContact O-N 3.12Å; M55-K58 HydrophobicContact CE-CD 3.75Å; M55-K58 PolarHBondContact O-N 2.66Å; M55-M59 WeakPolarHBondContact O-CB 3.36Å; M55-M59 PolarHBondContact O-N 2.9Å
56	D	69.6	Low	65.7	Low	12 Å²	12	80.3 Å²	80.3	6%	0.064	41%	0.409	C	S	.	.	H	α-helix	trans	-66.1	-38.9	177.9	-60.9	-49.7	0	0	0	110.4	P52 S53 K58 M59 L60 R85	P52-D56 HydrophobicContact CB-CB 4.23Å; S53-D56 PolarHBondContact N-OD2 3.33Å; S53-D56 PolarHBondContact O-N 3.11Å; D56-K58 VanDerWaalsContact C-N 3.32Å; D56-K58 PolarHBondContact O-N 2.88Å; D56-M59 CarbonylContact O-C 3.58Å; D56-M59 WeakPolarHBondContact O-CA 3.37Å; D56-M59 WeakPolarHBondContact O-CB 3.44Å; D56-M59 PolarHBondContact O-N 3.27Å; D56-M59 VanDerWaalsContact O-N 3.08Å; D56-L60 WeakPolarHBondContact O-CB 3.11Å; D56-L60 VanDerWaalsContact O-CD1 3.29Å; D56-L60 WeakPolarHBondContact O-CD1 3.11Å; D56-L60 PolarHBondContact O-N 3.45Å; D56-R85 IonicContact OD1-NH2 2.66Å; D56-R85 PolarHBondContact OD1-NH2 3.43Å
57	K	72.2	Confident	65.7	Low	59 Å²	59	79.9 Å²	79.9	26%	0.257	41%	0.412	S	S	.	.	H	α-helix	trans	-56.6	-44.5	173.2	-67	-177.2	-176	-178.6	0	111.9	P52 S53 M55 L60 V61 I72	P52-K57 HydrophobicContact CB-CG 4.32Å; P52-K57 HydrophobicContact CG-CG 4.46Å; P52-K57 WeakPolarHBondContact O-CE 3.47Å; S53-K57 PolarHBondContact O-N 2.99Å; M55-K57 VanDerWaalsContact C-N 3.32Å; M55-K57 PolarHBondContact O-N 3.12Å; K57-L60 PolarHBondContact O-N 3.13Å; K57-V61 WeakPolarHBondContact O-CG2 3.31Å; K57-V61 PolarHBondContact O-N 2.98Å; K57-I72 HydrophobicContact CB-CD1 3.88Å; K57-I72 HydrophobicContact CG-CD1 3.96Å
58	K	74.3	Confident	65.6	Low	139 Å²	139	79.6 Å²	79.6	60%	0.604	41%	0.412	S	S	*	.	H	α-helix	trans	-63.9	-41.1	174.7	-69.3	176	-173.7	-172.8	0	111.6	N54 M55 D56 L60 V61 W62	N54-K58 WeakPolarHBondContact O-CG 3.49Å; N54-K58 PolarHBondContact O-N 3.19Å; M55-K58 HydrophobicContact CE-CD 3.75Å; M55-K58 PolarHBondContact O-N 2.66Å; D56-K58 VanDerWaalsContact C-N 3.32Å; D56-K58 PolarHBondContact O-N 2.88Å; K58-L60 VanDerWaalsContact C-N 3.34Å; K58-L60 PolarHBondContact O-N 3.2Å; K58-V61 PolarHBondContact O-N 3.07Å; K58-W62 VanDerWaalsContact O-CB 3.25Å; K58-W62 WeakPolarHBondContact O-CB 3.44Å; K58-W62 PolarHBondContact O-N 3.47Å
59	M	69.1	Low	65.5	Low	58 Å²	58	76.4 Å²	76.4	29%	0.286	40%	0.395	S	S	.	.	H	α-helix	trans	-62	-41.1	177.3	-160.6	170.7	-146.6	0	0	111.8	M55 D56 W62 T63 R85 I88	M55-M59 WeakPolarHBondContact O-CB 3.36Å; M55-M59 PolarHBondContact O-N 2.9Å; D56-M59 CarbonylContact O-C 3.58Å; D56-M59 WeakPolarHBondContact O-CA 3.37Å; D56-M59 WeakPolarHBondContact O-CB 3.44Å; D56-M59 PolarHBondContact O-N 3.27Å; D56-M59 VanDerWaalsContact O-N 3.08Å; M59-W62 PolarHBondContact O-N 3.28Å; M59-T63 WeakPolarHBondContact O-CG2 3.44Å; M59-T63 PolarHBondContact O-N 3.27Å; M59-T63 PolarHBondContact O-OG1 3.2Å; M59-R85 HydrophobicContact CE-CG 4.12Å; M59-R85 HydrophobicContact SD-CG 3.97Å; M59-I88 HydrophobicContact CB-CD1 4.31Å; M59-I88 HydrophobicContact CE-CB 4.47Å; M59-I88 HydrophobicContact CE-CD1 3.3Å; M59-I88 HydrophobicContact CE-CG1 4.45Å; M59-I88 HydrophobicContact CE-CG2 4.26Å; M59-I88 HydrophobicContact CG-CD1 2.99Å; M59-I88 HydrophobicContact CG-CG1 4.5Å; M59-I88 HydrophobicContact SD-CD1 3.77Å
60	L	71.6	Confident	65.5	Low	3 Å²	3	83.2 Å²	83.2	2%	0.016	42%	0.416	C	S	.	.	H	α-helix	trans	-66.3	-44.1	176.8	-84.6	142.9	0	0	0	112.7	D56 K57 K58 W62 T63 R65 F66 I72 L76 A84	D56-L60 WeakPolarHBondContact O-CB 3.11Å; D56-L60 VanDerWaalsContact O-CD1 3.29Å; D56-L60 WeakPolarHBondContact O-CD1 3.11Å; D56-L60 PolarHBondContact O-N 3.45Å; K57-L60 PolarHBondContact O-N 3.13Å; K58-L60 VanDerWaalsContact C-N 3.34Å; K58-L60 PolarHBondContact O-N 3.2Å; L60-W62 VanDerWaalsContact C-N 3.32Å; L60-T63 PolarHBondContact O-N 3.18Å; L60-T63 PolarHBondContact O-OG1 3.26Å; L60-R65 PolarHBondContact O-N 3.38Å; L60-F66 HydrophobicContact CB-CD2 4.34Å; L60-F66 HydrophobicContact CD2-CD2 3.81Å; L60-F66 HydrophobicContact CD2-CE2 3.74Å; L60-I72 HydrophobicContact CB-CD1 4.18Å; L60-L76 HydrophobicContact CD1-CD1 3.29Å; L60-L76 HydrophobicContact CD2-CD1 4.05Å; L60-L76 HydrophobicContact CG-CD1 4.34Å; L60-A84 HydrophobicContact CD2-CB 4.49Å
61	V	75.3	Confident	65.4	Low	56 Å²	56	85 Å²	85	34%	0.339	43%	0.428	S	S	.	.	H	α-helix	trans	-63.2	-41.2	172.8	174.3	0	0	0	0	110.5	K57 K58 T63 G64 A69	K57-V61 WeakPolarHBondContact O-CG2 3.31Å; K57-V61 PolarHBondContact O-N 2.98Å; K58-V61 PolarHBondContact O-N 3.07Å; V61-T63 VanDerWaalsContact C-N 3.32Å; V61-T63 PolarHBondContact O-N 2.98Å; V61-G64 WeakPolarHBondContact O-CA 3.45Å; V61-G64 PolarHBondContact O-N 2.82Å; V61-A69 HydrophobicContact CG2-CB 4.39Å
62	W	72.5	Confident	65.4	Low	173 Å²	173	80 Å²	80	66%	0.655	41%	0.407	S	S	*	.	H	α-helix	trans	-67.3	-31.1	-178.9	-163	49.5	0	0	0	113.6	K58 M59 L60 G64 I88 V92	K58-W62 VanDerWaalsContact O-CB 3.25Å; K58-W62 WeakPolarHBondContact O-CB 3.44Å; K58-W62 PolarHBondContact O-N 3.47Å; M59-W62 PolarHBondContact O-N 3.28Å; L60-W62 VanDerWaalsContact C-N 3.32Å; W62-G64 PolarHBondContact O-N 3.45Å; W62-I88 HydrophobicContact CE3-CD1 4.22Å; W62-I88 HydrophobicContact CE3-CG1 4.42Å; W62-I88 HydrophobicContact CE3-CG2 4.46Å; W62-I88 HydrophobicContact CZ3-CG2 3.89Å; W62-V92 HydrophobicContact CH2-CG2 4.33Å
63	T	70.7	Confident	65.2	Low	26 Å²	26	83 Å²	83	16%	0.16	43%	0.426	C	S	.	.	T	Hydrogen-bonded Turn	trans	-72.9	-7.3	170.6	57.8	0	0	0	0	114.2	M59 L60 V61 R65 A84 I88	M59-T63 WeakPolarHBondContact O-CG2 3.44Å; M59-T63 PolarHBondContact O-N 3.27Å; M59-T63 PolarHBondContact O-OG1 3.2Å; L60-T63 PolarHBondContact O-N 3.18Å; L60-T63 PolarHBondContact O-OG1 3.26Å; V61-T63 VanDerWaalsContact C-N 3.32Å; V61-T63 PolarHBondContact O-N 2.98Å; T63-R65 VanDerWaalsContact C-N 3.27Å; T63-R65 PolarHBondContact O-N 3.43Å; T63-A84 HydrophobicContact CG2-CB 4.33Å; T63-I88 HydrophobicContact CG2-CD1 3.51Å; T63-I88 HydrophobicContact CG2-CG1 3.23Å
64	G	67.3	Low	64.6	Low	63 Å²	63	86.2 Å²	86.2	65%	0.649	44%	0.435	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.3	18	-177.8	0	0	0	0	0	113.6	V61 W62	V61-G64 WeakPolarHBondContact O-CA 3.45Å; V61-G64 PolarHBondContact O-N 2.82Å; W62-G64 PolarHBondContact O-N 3.45Å
65	R	64.8	Low	63.8	Low	116 Å²	116	85.3 Å²	85.3	44%	0.438	43%	0.433	S	S	.	.	S	Bend	trans	-82	-24.2	-179.6	-136.7	-161.6	-179.6	133.8	2.1	113.4	L60 T63	L60-R65 PolarHBondContact O-N 3.38Å; T63-R65 VanDerWaalsContact C-N 3.27Å; T63-R65 PolarHBondContact O-N 3.43Å
66	F	61.8	Low	63.7	Low	51 Å²	51	80.3 Å²	80.3	22%	0.224	41%	0.408	C	S	.	.			trans	-136.3	138.3	175.7	-66.7	-82.1	0	0	0	109.7	L60 I72 L76	L60-F66 HydrophobicContact CB-CD2 4.34Å; L60-F66 HydrophobicContact CD2-CD2 3.81Å; L60-F66 HydrophobicContact CD2-CE2 3.74Å; F66-I72 HydrophobicContact CB-CG1 4.02Å; F66-I72 HydrophobicContact CD1-CG1 4.46Å; F66-I72 HydrophobicContact CD2-CG1 4.17Å; F66-I72 HydrophobicContact CG-CG1 3.96Å; F66-L76 HydrophobicContact CE2-CD2 4.5Å; F66-L76 HydrophobicContact CZ-CD2 4.36Å
67	K	56.5	Low	63.2	Low	194 Å²	194	82.7 Å²	82.7	84%	0.843	43%	0.426	S	S	*	.	S	Bend	trans	-80.7	-20.9	-172	-148.4	162.9	-175.7	-178.8	0	113
68	S	54.2	Low	62.8	Low	61 Å²	61	86.1 Å²	86.1	43%	0.427	44%	0.439	S	S	.	.	S	Bend	trans	-144.1	148.9	175	-60.3	0	0	0	0	111.3	E70 Q71	S68-E70 PolarHBondContact O-N 3Å; S68-Q71 PolarHBondContact O-N 3.34Å; S68-Q71 VanDerWaalsContact O-N 3.1Å
69	A	56.6	Low	62.5	Low	51 Å²	51	87.1 Å²	87.1	42%	0.421	45%	0.445	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63	-18.8	175	0	0	0	0	0	113.3	V61	V61-A69 HydrophobicContact CG2-CB 4.39Å
70	E	54.8	Low	62.6	Low	185 Å²	185	85.8 Å²	85.8	86%	0.864	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.8	-21.1	177	-66.2	175.3	176.7	0	0	113.1	S68 I72	S68-E70 PolarHBondContact O-N 3Å; E70-I72 PolarHBondContact O-N 3.11Å
71	Q	58.4	Low	62.6	Low	126 Å²	126	86.3 Å²	86.3	59%	0.589	44%	0.443	S	S	*	.	S	Bend	trans	-85.5	6.5	-179.4	-150.4	167.6	28.9	0	0	112.7	S68 P73	S68-Q71 PolarHBondContact O-N 3.34Å; S68-Q71 VanDerWaalsContact O-N 3.1Å; Q71-P73 WeakPolarHBondContact O-CD 3.38Å
72	I	60.4	Low	62.7	Low	13 Å²	13	88.9 Å²	88.9	7%	0.067	46%	0.455	C	S	.	.	S	Bend	trans	-90.3	113.8	-177.7	-61.6	173.8	0	0	0	107.9	P52 K57 L60 F66 E70 E74 L76	P52-I72 HydrophobicContact CG-CG2 4.15Å; K57-I72 HydrophobicContact CB-CD1 3.88Å; K57-I72 HydrophobicContact CG-CD1 3.96Å; L60-I72 HydrophobicContact CB-CD1 4.18Å; F66-I72 HydrophobicContact CB-CG1 4.02Å; F66-I72 HydrophobicContact CD1-CG1 4.46Å; F66-I72 HydrophobicContact CD2-CG1 4.17Å; F66-I72 HydrophobicContact CG-CG1 3.96Å; E70-I72 PolarHBondContact O-N 3.11Å; I72-E74 PolarHBondContact O-N 2.89Å; I72-L76 HydrophobicContact CG2-CD1 3.51Å; I72-L76 HydrophobicContact CG2-CD2 4.18Å; I72-L76 HydrophobicContact CG2-CG 3.79Å
73	P	58.8	Low	62.8	Low	72 Å²	72	83 Å²	83	47%	0.468	44%	0.441	S	S	.	.			trans	-58.6	138.7	175.5	22.5	-30.2	0	0	0	109.9	Q71 T75 L76	Q71-P73 WeakPolarHBondContact O-CD 3.38Å; P73-T75 PolarHBondContact O-N 3.47Å; P73-L76 HydrophobicContact CG-CD2 3.94Å
74	E	54.7	Low	63.1	Low	126 Å²	126	82 Å²	82	59%	0.589	44%	0.435	S	S	*	.	S	Bend	trans	-59.5	-16.2	-173.8	-76.3	-157.8	117.3	0	0	114.5	K51 P52 I72	K51-E74 HydrophobicContact CD-CB 4.37Å; K51-E74 IonicContact NZ-OE1 3.58Å; K51-E74 PolarHBondContact NZ-OE1 3.48Å; K51-E74 IonicContact NZ-OE2 3.34Å; K51-E74 PolarHBondContact NZ-OE2 3.41Å; P52-E74 WeakPolarHBondContact CD-O 3.25Å; I72-E74 PolarHBondContact O-N 2.89Å
75	T	51.8	Low	63.7	Low	94 Å²	94	84.1 Å²	84.1	58%	0.577	42%	0.423	S	S	*	.			trans	-117.5	84.8	175.9	48.2	0	0	0	0	110.2	P73	P73-T75 PolarHBondContact O-N 3.47Å
76	L	62.1	Low	64.7	Low	8 Å²	8	83 Å²	83	4%	0.042	43%	0.426	C	S	.	.	B	Isolated β-bridge	trans	-80.9	130.2	168.8	-73.2	-176.5	0	0	0	110	P52 L60 F66 I72 P73	P52-L76 HydrophobicContact CB-CD1 4.27Å; P52-L76 HydrophobicContact CG-CD1 4.14Å; P52-L76 HydrophobicContact CG-CG 4.26Å; L60-L76 HydrophobicContact CD1-CD1 3.29Å; L60-L76 HydrophobicContact CD2-CD1 4.05Å; L60-L76 HydrophobicContact CG-CD1 4.34Å; F66-L76 HydrophobicContact CE2-CD2 4.5Å; F66-L76 HydrophobicContact CZ-CD2 4.36Å; I72-L76 HydrophobicContact CG2-CD1 3.51Å; I72-L76 HydrophobicContact CG2-CD2 4.18Å; I72-L76 HydrophobicContact CG2-CG 3.79Å; P73-L76 HydrophobicContact CG-CD2 3.94Å
77	S	60.6	Low	65.7	Low	63 Å²	63	86 Å²	86	44%	0.441	44%	0.439	S	S	.	.			trans	-66.6	141.2	172.5	63	0	0	0	0	110.3	E79 T80	S77-E79 PolarHBondContact O-N 2.83Å; S77-T80 WeakPolarHBondContact O-CB 3.45Å; S77-T80 PolarHBondContact O-N 2.94Å; S77-T80 PolarHBondContact OG-OG1 3.05Å; S77-T80 VanDerWaalsContact OG-OG1 3.11Å
78	Y	63.5	Low	67.2	Low	131 Å²	131	77.6 Å²	77.6	51%	0.514	40%	0.403	S	S	.	.	H	α-helix	trans	-49.3	-34.1	178.8	-95.5	-88.8	0	0	0	113.4	P47 Y50 T80 I81 D82	P47-Y78 HydrophobicContact CB-CD2 4.37Å; P47-Y78 HydrophobicContact CB-CE2 4.37Å; P47-Y78 HydrophobicContact CG-CD2 4.47Å; Y50-Y78 HydrophobicContact CG-CE2 4.35Å; Y78-T80 VanDerWaalsContact C-N 3.27Å; Y78-T80 PolarHBondContact O-N 3.38Å; Y78-I81 PolarHBondContact O-N 3.38Å; Y78-D82 PolarHBondContact O-N 3.3Å
79	E	67.1	Low	68.8	Low	159 Å²	159	83 Å²	83	74%	0.743	41%	0.414	S	S	*	.	H	α-helix	trans	-63	-31.7	179.5	-59.2	-151.1	144.9	0	0	113.8	S77 S83	S77-E79 PolarHBondContact O-N 2.83Å; E79-S83 WeakPolarHBondContact O-CB 3.29Å; E79-S83 PolarHBondContact O-N 3.08Å; E79-S83 PolarHBondContact O-OG 3.48Å
80	T	70.8	Confident	70.4	Confident	30 Å²	30	83.7 Å²	83.7	18%	0.184	41%	0.412	C	S	.	.	H	α-helix	trans	-73.2	-35.1	-179.1	-49	0	0	0	0	111	S77 Y78 A84	S77-T80 WeakPolarHBondContact O-CB 3.45Å; S77-T80 PolarHBondContact O-N 2.94Å; S77-T80 PolarHBondContact OG-OG1 3.05Å; S77-T80 VanDerWaalsContact OG-OG1 3.11Å; Y78-T80 VanDerWaalsContact C-N 3.27Å; Y78-T80 PolarHBondContact O-N 3.38Å; T80-A84 WeakPolarHBondContact O-CB 3.47Å; T80-A84 PolarHBondContact O-N 3.24Å
81	I	73.1	Confident	72	Confident	14 Å²	14	80.7 Å²	80.7	7%	0.072	40%	0.397	C	S	.	.	H	α-helix	trans	-71	-44.1	179.5	-61.3	175	0	0	0	110.3	Y50 Y78 A84 R85	Y50-I81 HydrophobicContact CD1-CD1 3.71Å; Y50-I81 HydrophobicContact CE1-CD1 4.21Å; Y78-I81 PolarHBondContact O-N 3.38Å; I81-A84 WeakPolarHBondContact O-CB 3.32Å; I81-A84 PolarHBondContact O-N 3.42Å; I81-R85 PolarHBondContact O-N 2.99Å
82	D	75.9	Confident	73.6	Confident	110 Å²	110	77.5 Å²	77.5	59%	0.588	39%	0.386	S	S	*	.	H	α-helix	trans	-63	-45.4	178	-172.4	67.1	0	0	0	111.6	Y78 A84 R85 N86	Y78-D82 PolarHBondContact O-N 3.3Å; D82-A84 VanDerWaalsContact C-N 3.26Å; D82-A84 PolarHBondContact O-N 3.2Å; D82-R85 PolarHBondContact O-N 3.25Å; D82-R85 VanDerWaalsContact O-N 3.13Å; D82-N86 PolarHBondContact O-N 3.01Å
83	S	75.4	Confident	75.2	Confident	51 Å²	51	79.3 Å²	79.3	36%	0.357	40%	0.402	S	S	.	.	H	α-helix	trans	-56.9	-39.1	173.2	-66.9	0	0	0	0	112.7	E79 K87	E79-S83 WeakPolarHBondContact O-CB 3.29Å; E79-S83 PolarHBondContact O-N 3.08Å; E79-S83 PolarHBondContact O-OG 3.48Å; S83-K87 WeakPolarHBondContact O-CG 3.45Å; S83-K87 PolarHBondContact O-N 3.46Å
84	A	77.3	Confident	76.9	Confident	4 Å²	4	83.7 Å²	83.7	3%	0.033	41%	0.411	C	S	.	.	H	α-helix	trans	-67	-43.8	177.3	0	0	0	0	0	111.4	L60 T63 T80 I81 D82 N86 K87 I88	L60-A84 HydrophobicContact CD2-CB 4.49Å; T63-A84 HydrophobicContact CG2-CB 4.33Å; T80-A84 WeakPolarHBondContact O-CB 3.47Å; T80-A84 PolarHBondContact O-N 3.24Å; I81-A84 WeakPolarHBondContact O-CB 3.32Å; I81-A84 PolarHBondContact O-N 3.42Å; D82-A84 VanDerWaalsContact C-N 3.26Å; D82-A84 PolarHBondContact O-N 3.2Å; A84-N86 PolarHBondContact O-N 3.03Å; A84-K87 PolarHBondContact O-N 3.28Å; A84-I88 WeakPolarHBondContact O-CG1 3.15Å; A84-I88 PolarHBondContact O-N 3.33Å; A84-I88 VanDerWaalsContact O-N 3.07Å
85	R	79.4	Confident	78.8	Confident	108 Å²	108	83 Å²	83	41%	0.408	41%	0.409	S	S	.	.	H	α-helix	trans	-63.3	-40.7	177.8	-73.5	-173.5	174.7	159	4.3	112.5	D56 M59 I81 D82 K87 I88 R89	D56-R85 IonicContact OD1-NH2 2.66Å; D56-R85 PolarHBondContact OD1-NH2 3.43Å; M59-R85 HydrophobicContact CE-CG 4.12Å; M59-R85 HydrophobicContact SD-CG 3.97Å; I81-R85 PolarHBondContact O-N 2.99Å; D82-R85 PolarHBondContact O-N 3.25Å; D82-R85 VanDerWaalsContact O-N 3.13Å; R85-K87 VanDerWaalsContact C-N 3.33Å; R85-K87 PolarHBondContact O-N 3.5Å; R85-I88 PolarHBondContact O-N 3.48Å; R85-R89 WeakPolarHBondContact O-CG 3.29Å; R85-R89 PolarHBondContact O-N 2.89Å; R85-R89 VanDerWaalsContact O-N 3.07Å
86	N	84.9	Confident	80.9	Confident	92 Å²	92	83.6 Å²	83.6	49%	0.492	41%	0.406	S	S	.	.	H	α-helix	trans	-60.3	-44.4	175.9	-173.4	43.6	0	0	0	111.7	D82 A84 I88 R89 V90	D82-N86 PolarHBondContact O-N 3.01Å; A84-N86 PolarHBondContact O-N 3.03Å; N86-I88 VanDerWaalsContact C-N 3.3Å; N86-I88 PolarHBondContact O-N 2.96Å; N86-R89 PolarHBondContact O-N 3.44Å; N86-V90 WeakPolarHBondContact O-CG2 3.33Å; N86-V90 PolarHBondContact O-N 3.36Å; N86-V90 VanDerWaalsContact O-N 3.15Å
87	K	84.4	Confident	82.5	Confident	115 Å²	115	89 Å²	89	50%	0.5	43%	0.433	S	S	.	.	H	α-helix	trans	-62.4	-35.4	176.2	-71.7	-176.5	178.4	-172	0	112.9	S83 A84 R85 V90 K91	S83-K87 WeakPolarHBondContact O-CG 3.45Å; S83-K87 PolarHBondContact O-N 3.46Å; A84-K87 PolarHBondContact O-N 3.28Å; R85-K87 VanDerWaalsContact C-N 3.33Å; R85-K87 PolarHBondContact O-N 3.5Å; K87-V90 PolarHBondContact O-N 3.24Å; K87-K91 VanDerWaalsContact O-CB 3.31Å; K87-K91 WeakPolarHBondContact O-CB 3.27Å; K87-K91 PolarHBondContact O-N 3.15Å
88	I	86.5	Confident	84.3	Confident	16 Å²	16	90.8 Å²	90.8	8%	0.082	44%	0.441	C	S	.	.	H	α-helix	trans	-65.1	-46.5	175.8	-70.3	173.4	0	0	0	111	M59 W62 T63 A84 R85 N86 V90 K91 V92	M59-I88 HydrophobicContact CB-CD1 4.31Å; M59-I88 HydrophobicContact CE-CB 4.47Å; M59-I88 HydrophobicContact CE-CD1 3.3Å; M59-I88 HydrophobicContact CE-CG1 4.45Å; M59-I88 HydrophobicContact CE-CG2 4.26Å; M59-I88 HydrophobicContact CG-CD1 2.99Å; M59-I88 HydrophobicContact CG-CG1 4.5Å; M59-I88 HydrophobicContact SD-CD1 3.77Å; W62-I88 HydrophobicContact CE3-CD1 4.22Å; W62-I88 HydrophobicContact CE3-CG1 4.42Å; W62-I88 HydrophobicContact CE3-CG2 4.46Å; W62-I88 HydrophobicContact CZ3-CG2 3.89Å; T63-I88 HydrophobicContact CG2-CD1 3.51Å; T63-I88 HydrophobicContact CG2-CG1 3.23Å; A84-I88 WeakPolarHBondContact O-CG1 3.15Å; A84-I88 PolarHBondContact O-N 3.33Å; A84-I88 VanDerWaalsContact O-N 3.07Å; R85-I88 PolarHBondContact O-N 3.48Å; N86-I88 VanDerWaalsContact C-N 3.3Å; N86-I88 PolarHBondContact O-N 2.96Å; I88-V90 VanDerWaalsContact C-N 3.26Å; I88-V90 PolarHBondContact O-N 3.01Å; I88-K91 PolarHBondContact O-N 3.07Å; I88-K91 VanDerWaalsContact O-N 3.17Å; I88-V92 HydrophobicContact CG2-CG2 4Å; I88-V92 WeakPolarHBondContact O-CB 3.4Å; I88-V92 VanDerWaalsContact O-CG2 3.27Å; I88-V92 WeakPolarHBondContact O-CG2 3.42Å; I88-V92 PolarHBondContact O-N 3.34Å
89	R	88.3	Confident	85.9	Confident	176 Å²	176	89.4 Å²	89.4	66%	0.664	44%	0.442	S	S	*	.	H	α-helix	trans	-55.9	-46.5	178.4	-68.6	174.7	-176.8	175.4	1.3	110.8	R85 N86 A93	R85-R89 WeakPolarHBondContact O-CG 3.29Å; R85-R89 PolarHBondContact O-N 2.89Å; R85-R89 VanDerWaalsContact O-N 3.07Å; N86-R89 PolarHBondContact O-N 3.44Å; R89-A93 VanDerWaalsContact O-CB 3.29Å; R89-A93 WeakPolarHBondContact O-CB 3.41Å; R89-A93 PolarHBondContact O-N 3.25Å
90	V	90.1	Very high	87.3	Confident	64 Å²	64	85.3 Å²	85.3	39%	0.388	43%	0.428	S	S	.	.	H	α-helix	trans	-63.5	-45.6	177.8	175.2	0	0	0	0	111.4	N86 K87 I88 V92 A93 Y94	N86-V90 WeakPolarHBondContact O-CG2 3.33Å; N86-V90 PolarHBondContact O-N 3.36Å; N86-V90 VanDerWaalsContact O-N 3.15Å; K87-V90 PolarHBondContact O-N 3.24Å; I88-V90 VanDerWaalsContact C-N 3.26Å; I88-V90 PolarHBondContact O-N 3.01Å; V90-V92 PolarHBondContact O-N 2.82Å; V90-A93 PolarHBondContact O-N 3.17Å; V90-Y94 HydrophobicContact CG1-CD2 3.64Å; V90-Y94 HydrophobicContact CG1-CE2 3.24Å; V90-Y94 WeakPolarHBondContact O-CD2 3.46Å; V90-Y94 PolarHBondContact O-N 3.43Å
91	K	88.5	Confident	88.5	Confident	123 Å²	123	89.6 Å²	89.6	54%	0.535	45%	0.449	S	S	.	.	H	α-helix	trans	-64.6	-41.9	179.8	-164.6	167.2	-174.9	172.5	0	112.3	K87 I88 Y94 M95	K87-K91 VanDerWaalsContact O-CB 3.31Å; K87-K91 WeakPolarHBondContact O-CB 3.27Å; K87-K91 PolarHBondContact O-N 3.15Å; I88-K91 PolarHBondContact O-N 3.07Å; I88-K91 VanDerWaalsContact O-N 3.17Å; K91-Y94 PolarHBondContact O-N 3.36Å; K91-M95 WeakPolarHBondContact O-CG 3.47Å; K91-M95 PolarHBondContact O-N 3.44Å
92	V	92.2	Very high	89.7	Confident	59 Å²	59	90.5 Å²	90.5	36%	0.358	46%	0.462	S	S	.	.	H	α-helix	trans	-64.9	-43.5	174.7	173.6	0	0	0	0	110.4	W62 I88 V90 Y94 M95 M96	W62-V92 HydrophobicContact CH2-CG2 4.33Å; I88-V92 HydrophobicContact CG2-CG2 4Å; I88-V92 WeakPolarHBondContact O-CB 3.4Å; I88-V92 VanDerWaalsContact O-CG2 3.27Å; I88-V92 WeakPolarHBondContact O-CG2 3.42Å; I88-V92 PolarHBondContact O-N 3.34Å; V90-V92 PolarHBondContact O-N 2.82Å; V92-Y94 PolarHBondContact O-N 2.9Å; V92-M95 PolarHBondContact O-N 2.92Å; V92-M96 HydrophobicContact CG1-CG 4.37Å; V92-M96 WeakPolarHBondContact O-CG 3.41Å; V92-M96 PolarHBondContact O-N 3.08Å
93	A	93.8	Very high	90.6	Very high	50 Å²	50	88 Å²	88	41%	0.413	46%	0.457	S	S	.	.	H	α-helix	trans	-59.7	-44.5	177.1	0	0	0	0	0	111.8	R89 V90 M96 M97	R89-A93 VanDerWaalsContact O-CB 3.29Å; R89-A93 WeakPolarHBondContact O-CB 3.41Å; R89-A93 PolarHBondContact O-N 3.25Å; V90-A93 PolarHBondContact O-N 3.17Å; A93-M96 PolarHBondContact O-N 2.92Å; A93-M97 VanDerWaalsContact O-CG 3.29Å; A93-M97 WeakPolarHBondContact O-CG 3.5Å; A93-M97 PolarHBondContact O-N 2.96Å
94	Y	95.2	Very high	91.6	Very high	164 Å²	164	89.3 Å²	89.3	64%	0.643	47%	0.465	S	S	*	.	H	α-helix	trans	-64.2	-42.2	175.4	-75	-57.9	0	0	0	112.7	V90 K91 V92 M96 M97 V98	V90-Y94 HydrophobicContact CG1-CD2 3.64Å; V90-Y94 HydrophobicContact CG1-CE2 3.24Å; V90-Y94 WeakPolarHBondContact O-CD2 3.46Å; V90-Y94 PolarHBondContact O-N 3.43Å; K91-Y94 PolarHBondContact O-N 3.36Å; V92-Y94 PolarHBondContact O-N 2.9Å; Y94-M96 VanDerWaalsContact C-N 3.31Å; Y94-M96 PolarHBondContact O-N 3.08Å; Y94-M97 PolarHBondContact O-N 3.32Å; Y94-V98 WeakPolarHBondContact O-CG2 3.26Å; Y94-V98 PolarHBondContact O-N 3.12Å
95	M	95.1	Very high	92.5	Very high	113 Å²	113	93.3 Å²	93.3	56%	0.557	49%	0.489	S	S	*	.	H	α-helix	trans	-59.6	-43.3	174.8	-72.9	-62.4	-65.2	0	0	111.4	K91 V92 V98 L99	K91-M95 WeakPolarHBondContact O-CG 3.47Å; K91-M95 PolarHBondContact O-N 3.44Å; V92-M95 PolarHBondContact O-N 2.92Å; M95-V98 PolarHBondContact O-N 3.36Å; M95-L99 WeakPolarHBondContact O-CB 3.48Å; M95-L99 WeakPolarHBondContact O-CD1 3.43Å; M95-L99 VanDerWaalsContact O-CG 3.27Å; M95-L99 WeakPolarHBondContact O-CG 3.36Å; M95-L99 PolarHBondContact O-N 3.49Å
96	M	94.9	Very high	93.2	Very high	105 Å²	105	93.4 Å²	93.4	52%	0.517	50%	0.496	S	S	.	.	H	α-helix	trans	-61.5	-43.4	176.3	-72.6	-64.9	123.4	0	0	112.1	V92 A93 Y94 V98 L99 T100	V92-M96 HydrophobicContact CG1-CG 4.37Å; V92-M96 WeakPolarHBondContact O-CG 3.41Å; V92-M96 PolarHBondContact O-N 3.08Å; A93-M96 PolarHBondContact O-N 2.92Å; Y94-M96 VanDerWaalsContact C-N 3.31Å; Y94-M96 PolarHBondContact O-N 3.08Å; M96-V98 PolarHBondContact O-N 3.3Å; M96-L99 HydrophobicContact CE-CD1 3.84Å; M96-L99 PolarHBondContact O-N 3.49Å; M96-T100 WeakPolarHBondContact O-CG2 3.36Å; M96-T100 PolarHBondContact O-N 3.35Å; M96-T100 PolarHBondContact O-OG1 3.05Å; M96-T100 VanDerWaalsContact O-OG1 3.08Å
97	M	96.3	Very high	93.6	Very high	122 Å²	122	96 Å²	96	60%	0.601	51%	0.507	S	S	*	.	H	α-helix	trans	-63.1	-41	177.5	-69.4	-66.5	170	0	0	112.3	A93 Y94 T100 L101	A93-M97 VanDerWaalsContact O-CG 3.29Å; A93-M97 WeakPolarHBondContact O-CG 3.5Å; A93-M97 PolarHBondContact O-N 2.96Å; Y94-M97 PolarHBondContact O-N 3.32Å; M97-T100 WeakPolarHBondContact CA-OG1 3.38Å; M97-T100 PolarHBondContact O-OG1 2.94Å; M97-L101 VanDerWaalsContact O-CG 3.26Å; M97-L101 WeakPolarHBondContact O-CG 3.27Å; M97-L101 PolarHBondContact O-N 3.22Å; M97-L101 VanDerWaalsContact O-N 3.12Å
98	V	97.8	Very high	94	Very high	101 Å²	101	94.9 Å²	94.9	61%	0.612	51%	0.51	S	S	*	.	H	α-helix	trans	-68.2	-42.2	177.4	174	0	0	0	0	110.9	Y94 M95 M96 T100 L101 G102	Y94-V98 WeakPolarHBondContact O-CG2 3.26Å; Y94-V98 PolarHBondContact O-N 3.12Å; M95-V98 PolarHBondContact O-N 3.36Å; M96-V98 PolarHBondContact O-N 3.3Å; V98-T100 PolarHBondContact O-N 2.94Å; V98-L101 PolarHBondContact O-N 3.2Å; V98-G102 PolarHBondContact O-N 3.41Å
99	L	96.6	Very high	94.2	Very high	101 Å²	101	99 Å²	99	53%	0.529	53%	0.531	S	S	.	.	H	α-helix	trans	-60.7	-44	177.1	-78.7	159.5	0	0	0	112	M95 M96 G102 A103	M95-L99 WeakPolarHBondContact O-CB 3.48Å; M95-L99 WeakPolarHBondContact O-CD1 3.43Å; M95-L99 VanDerWaalsContact O-CG 3.27Å; M95-L99 WeakPolarHBondContact O-CG 3.36Å; M95-L99 PolarHBondContact O-N 3.49Å; M96-L99 HydrophobicContact CE-CD1 3.84Å; M96-L99 PolarHBondContact O-N 3.49Å; L99-G102 PolarHBondContact O-N 3.5Å; L99-A103 WeakPolarHBondContact O-CB 3.29Å; L99-A103 PolarHBondContact O-N 2.88Å
100	T	96.1	Very high	94.1	Very high	74 Å²	74	97 Å²	97	45%	0.454	53%	0.531	S	S	.	.	H	α-helix	trans	-66.8	-44.1	179.2	50.9	0	0	0	0	111.6	M96 M97 V98 G102 A103 C104	M96-T100 WeakPolarHBondContact O-CG2 3.36Å; M96-T100 PolarHBondContact O-N 3.35Å; M96-T100 PolarHBondContact O-OG1 3.05Å; M96-T100 VanDerWaalsContact O-OG1 3.08Å; M97-T100 WeakPolarHBondContact CA-OG1 3.38Å; M97-T100 PolarHBondContact O-OG1 2.94Å; V98-T100 PolarHBondContact O-N 2.94Å; T100-G102 VanDerWaalsContact C-N 3.31Å; T100-G102 PolarHBondContact O-N 3.2Å; T100-A103 PolarHBondContact O-N 2.88Å; T100-C104 PolarHBondContact O-N 3.29Å; T100-C104 PolarHBondContact O-SG 3.25Å
101	L	97.1	Very high	94	Very high	120 Å²	120	95.7 Å²	95.7	63%	0.628	53%	0.531	S	S	*	.	H	α-helix	trans	-60.4	-42.4	174.4	-69.1	174.5	0	0	0	111.6	M97 V98 C104 V105	M97-L101 VanDerWaalsContact O-CG 3.26Å; M97-L101 WeakPolarHBondContact O-CG 3.27Å; M97-L101 PolarHBondContact O-N 3.22Å; M97-L101 VanDerWaalsContact O-N 3.12Å; V98-L101 PolarHBondContact O-N 3.2Å; L101-C104 WeakPolarHBondContact O-CB 3.35Å; L101-C104 PolarHBondContact O-N 3.38Å; L101-V105 WeakPolarHBondContact O-CG2 3.38Å; L101-V105 PolarHBondContact O-N 3.05Å; L101-V105 VanDerWaalsContact O-N 3.08Å
102	G	97.4	Very high	93.8	Very high	33 Å²	33	97.3 Å²	97.3	34%	0.34	54%	0.538	S	S	.	.	H	α-helix	trans	-60.5	-45.7	174.4	0	0	0	0	0	112.5	V98 L99 T100 C104 V105 L106	V98-G102 PolarHBondContact O-N 3.41Å; L99-G102 PolarHBondContact O-N 3.5Å; T100-G102 VanDerWaalsContact C-N 3.31Å; T100-G102 PolarHBondContact O-N 3.2Å; G102-C104 VanDerWaalsContact C-N 3.32Å; G102-C104 PolarHBondContact O-N 3.42Å; G102-V105 PolarHBondContact O-N 3.23Å; G102-L106 WeakPolarHBondContact O-CG 3.48Å; G102-L106 PolarHBondContact O-N 3.41Å
103	A	96.1	Very high	93.2	Very high	58 Å²	58	101 Å²	101	48%	0.479	55%	0.549	S	S	.	.	H	α-helix	trans	-60.5	-41.1	176.8	0	0	0	0	0	112	L99 T100 V105 L106 M107	L99-A103 WeakPolarHBondContact O-CB 3.29Å; L99-A103 PolarHBondContact O-N 2.88Å; T100-A103 PolarHBondContact O-N 2.88Å; A103-V105 PolarHBondContact O-N 2.94Å; A103-L106 PolarHBondContact O-N 2.97Å; A103-M107 WeakPolarHBondContact O-CB 3.4Å; A103-M107 PolarHBondContact O-N 3.2Å
104	C	94.9	Very high	92.4	Very high	78 Å²	78	101.2 Å²	101.2	53%	0.527	55%	0.55	S	S	.	*	H	α-helix	trans	-60.5	-45.6	174.7	-67.2	0	0	0	0	111.9	T100 L101 G102 M107 V108	T100-C104 PolarHBondContact O-N 3.29Å; T100-C104 PolarHBondContact O-SG 3.25Å; L101-C104 WeakPolarHBondContact O-CB 3.35Å; L101-C104 PolarHBondContact O-N 3.38Å; G102-C104 VanDerWaalsContact C-N 3.32Å; G102-C104 PolarHBondContact O-N 3.42Å; C104-M107 PolarHBondContact O-N 2.95Å; C104-V108 WeakPolarHBondContact O-CG2 3.39Å; C104-V108 PolarHBondContact O-N 3.48Å
105	V	96.4	Very high	91.5	Very high	88 Å²	88	96.7 Å²	96.7	53%	0.533	55%	0.547	S	S	.	.	H	α-helix	trans	-63.2	-45.1	178.8	174.1	0	0	0	0	111.2	L101 G102 A103 M107 V108 I109	L101-V105 WeakPolarHBondContact O-CG2 3.38Å; L101-V105 PolarHBondContact O-N 3.05Å; L101-V105 VanDerWaalsContact O-N 3.08Å; G102-V105 PolarHBondContact O-N 3.23Å; A103-V105 PolarHBondContact O-N 2.94Å; V105-M107 VanDerWaalsContact C-N 3.31Å; V105-M107 PolarHBondContact O-N 2.9Å; V105-V108 PolarHBondContact O-N 2.84Å; V105-I109 HydrophobicContact CG1-CD1 4.04Å; V105-I109 WeakPolarHBondContact O-CG1 3.33Å; V105-I109 PolarHBondContact O-N 2.85Å
106	L	95.4	Very high	90.2	Very high	109 Å²	109	94 Å²	94	57%	0.571	55%	0.548	S	S	*	.	H	α-helix	trans	-58.6	-43.9	175.9	-71.2	174.2	0	0	0	111.5	G102 A103 V108 I109 M110	G102-L106 WeakPolarHBondContact O-CG 3.48Å; G102-L106 PolarHBondContact O-N 3.41Å; A103-L106 PolarHBondContact O-N 2.97Å; L106-V108 VanDerWaalsContact C-N 3.3Å; L106-V108 PolarHBondContact O-N 2.85Å; L106-I109 PolarHBondContact O-N 3.28Å; L106-M110 WeakPolarHBondContact O-CB 3.43Å; L106-M110 WeakPolarHBondContact O-CG 3.33Å; L106-M110 PolarHBondContact O-N 3.41Å
107	M	93.5	Very high	88.8	Confident	147 Å²	147	95 Å²	95	72%	0.724	55%	0.547	S	S	*	.	H	α-helix	trans	-61.9	-37.9	178.4	-163.6	171.3	-144.9	0	0	112.1	A103 C104 V105 G111	A103-M107 WeakPolarHBondContact O-CB 3.4Å; A103-M107 PolarHBondContact O-N 3.2Å; C104-M107 PolarHBondContact O-N 2.95Å; V105-M107 VanDerWaalsContact C-N 3.31Å; V105-M107 PolarHBondContact O-N 2.9Å; M107-G111 PolarHBondContact O-N 3.34Å
108	V	92.7	Very high	87	Confident	91 Å²	91	95.4 Å²	95.4	55%	0.552	55%	0.551	S	S	*	*	H	α-helix	trans	-67.2	-42.3	175.7	173.4	0	0	0	0	111.5	C104 V105 L106 G111 K112	C104-V108 WeakPolarHBondContact O-CG2 3.39Å; C104-V108 PolarHBondContact O-N 3.48Å; V105-V108 PolarHBondContact O-N 2.84Å; L106-V108 VanDerWaalsContact C-N 3.3Å; L106-V108 PolarHBondContact O-N 2.85Å; V108-G111 PolarHBondContact O-N 3.37Å; V108-K112 HydrophobicContact CG1-CD 4.19Å; V108-K112 HydrophobicContact CG1-CG 4.48Å; V108-K112 WeakPolarHBondContact O-CB 3.39Å; V108-K112 WeakPolarHBondContact O-CG 3.47Å; V108-K112 PolarHBondContact O-N 2.91Å
109	I	90.9	Very high	85.2	Confident	102 Å²	102	95.7 Å²	95.7	52%	0.523	55%	0.545	S	S	.	.	H	α-helix	trans	-64.3	-45.9	177.7	-64.3	166.5	0	0	0	110.2	V105 L106 G111 K112 K113	V105-I109 HydrophobicContact CG1-CD1 4.04Å; V105-I109 WeakPolarHBondContact O-CG1 3.33Å; V105-I109 PolarHBondContact O-N 2.85Å; L106-I109 PolarHBondContact O-N 3.28Å; I109-G111 VanDerWaalsContact C-N 3.33Å; I109-G111 PolarHBondContact O-N 2.81Å; I109-K112 PolarHBondContact O-N 2.82Å; I109-K113 WeakPolarHBondContact O-CB 3.34Å; I109-K113 PolarHBondContact O-N 3.35Å
110	M	86.3	Confident	83.5	Confident	134 Å²	134	93.8 Å²	93.8	66%	0.66	54%	0.541	S	S	*	.	H	α-helix	trans	-62.2	-41.1	175.9	-69.8	177	72	0	0	111.5	L106 K113 A114	L106-M110 WeakPolarHBondContact O-CB 3.43Å; L106-M110 WeakPolarHBondContact O-CG 3.33Å; L106-M110 PolarHBondContact O-N 3.41Å; M110-K113 PolarHBondContact O-N 2.88Å; M110-A114 VanDerWaalsContact O-CB 3.31Å; M110-A114 WeakPolarHBondContact O-CB 3.49Å; M110-A114 PolarHBondContact O-N 3.03Å
111	G	87.1	Confident	81.8	Confident	38 Å²	38	96.8 Å²	96.8	39%	0.392	55%	0.553	S	S	.	*	H	α-helix	trans	-62.9	-45.3	175.9	0	0	0	0	0	112.6	M107 V108 I109 A114 A115	M107-G111 PolarHBondContact O-N 3.34Å; V108-G111 PolarHBondContact O-N 3.37Å; I109-G111 VanDerWaalsContact C-N 3.33Å; I109-G111 PolarHBondContact O-N 2.81Å; G111-A114 PolarHBondContact O-N 3.48Å; G111-A115 WeakPolarHBondContact O-CB 3.39Å; G111-A115 PolarHBondContact O-N 3.16Å
112	K	84.1	Confident	80.2	Confident	157 Å²	157	95.3 Å²	95.3	68%	0.683	55%	0.549	S	S	*	.	H	α-helix	trans	-65.2	-39.1	175	-72.2	179.2	76.8	-178.6	0	111.9	V108 I109 A114 G116	V108-K112 HydrophobicContact CG1-CD 4.19Å; V108-K112 HydrophobicContact CG1-CG 4.48Å; V108-K112 WeakPolarHBondContact O-CB 3.39Å; V108-K112 WeakPolarHBondContact O-CG 3.47Å; V108-K112 PolarHBondContact O-N 2.91Å; I109-K112 PolarHBondContact O-N 2.82Å; K112-A114 VanDerWaalsContact C-N 3.35Å; K112-G116 PolarHBondContact O-N 3.47Å
113	K	80.1	Confident	78.9	Confident	137 Å²	137	95.9 Å²	95.9	60%	0.596	55%	0.551	S	S	*	*	H	α-helix	trans	-67.8	-34.1	175.3	-169.3	179.5	176	175.9	0	111.9	I109 M110 R117	I109-K113 WeakPolarHBondContact O-CB 3.34Å; I109-K113 PolarHBondContact O-N 3.35Å; M110-K113 PolarHBondContact O-N 2.88Å; K113-R117 WeakPolarHBondContact O-CB 3.31Å; K113-R117 PolarHBondContact O-N 3Å; K113-R117 VanDerWaalsContact O-N 3.16Å; K113-R117 PolarHBondContact O-NE 2.95Å
114	A	77.6	Confident	77.8	Confident	53 Å²	53	100.2 Å²	100.2	44%	0.438	56%	0.556	S	S	.	*	H	α-helix	trans	-71.8	-44.1	174.9	0	0	0	0	0	111.7	M110 G111 K112 R117	M110-A114 VanDerWaalsContact O-CB 3.31Å; M110-A114 WeakPolarHBondContact O-CB 3.49Å; M110-A114 PolarHBondContact O-N 3.03Å; G111-A114 PolarHBondContact O-N 3.48Å; K112-A114 VanDerWaalsContact C-N 3.35Å; A114-R117 PolarHBondContact O-N 3.32Å
115	A	74.9	Confident	76.9	Confident	69 Å²	69	100.2 Å²	100.2	57%	0.57	55%	0.55	S	S	*	*	H	α-helix	trans	-63.4	-43.5	174.7	0	0	0	0	0	111.9	G111 R117 N118	G111-A115 WeakPolarHBondContact O-CB 3.39Å; G111-A115 PolarHBondContact O-N 3.16Å; A115-R117 PolarHBondContact O-N 3.22Å; A115-N118 PolarHBondContact O-N 3.28Å
116	G	68.3	Low	76.1	Confident	57 Å²	57	100.8 Å²	100.8	59%	0.588	55%	0.55	S	S	*	*	H	α-helix	trans	-69.7	-27.8	179.8	0	0	0	0	0	114.2	K112 N118	K112-G116 PolarHBondContact O-N 3.47Å; G116-N118 PolarHBondContact O-N 2.8Å; G116-N118 PolarHBondContact O-ND2 2.74Å
117	R	65.6	Low	75.4	Confident	127 Å²	127	100.5 Å²	100.5	48%	0.479	55%	0.546	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.6	-5.9	175.3	-86.4	171.5	-59.8	148	-4.7	114.1	K113 A114 A115 E119	K113-R117 WeakPolarHBondContact O-CB 3.31Å; K113-R117 PolarHBondContact O-N 3Å; K113-R117 VanDerWaalsContact O-N 3.16Å; K113-R117 PolarHBondContact O-NE 2.95Å; A114-R117 PolarHBondContact O-N 3.32Å; A115-R117 PolarHBondContact O-N 3.22Å; R117-E119 HydrophobicContact CB-CG 3.5Å; R117-E119 VanDerWaalsContact CB-CG 3.5Å; R117-E119 VanDerWaalsContact CB-OE1 3.27Å; R117-E119 WeakPolarHBondContact CB-OE1 3.39Å; R117-E119 WeakPolarHBondContact CD-OE1 3.04Å; R117-E119 IonicContact CZ-OE1 3.23Å; R117-E119 VanDerWaalsContact CZ-OE1 3.23Å; R117-E119 IonicContact NE-OE1 3.29Å; R117-E119 PolarHBondContact NE-OE1 3.42Å; R117-E119 IonicContact NH1-OE1 2.74Å; R117-E119 PolarHBondContact NH1-OE1 2.72Å; R117-E119 WeakPolarHBondContact O-CG 3.27Å; R117-E119 PolarHBondContact O-N 3.45Å
118	N	58	Low	74.9	Confident	129 Å²	129	98.1 Å²	98.1	69%	0.69	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	39.1	38	177	-69.7	-74.5	0	0	0	112.5	A115 G116 S120	A115-N118 PolarHBondContact O-N 3.28Å; G116-N118 PolarHBondContact O-N 2.8Å; G116-N118 PolarHBondContact O-ND2 2.74Å; N118-S120 PolarHBondContact O-N 3.29Å
119	E	59.7	Low	74.3	Confident	107 Å²	107	99.1 Å²	99.1	50%	0.5	53%	0.528	S	S	.	.			trans	-76.4	65.3	176	-42.3	-171.7	-154.3	0	0	105.5	R117	R117-E119 HydrophobicContact CB-CG 3.5Å; R117-E119 VanDerWaalsContact CB-CG 3.5Å; R117-E119 VanDerWaalsContact CB-OE1 3.27Å; R117-E119 WeakPolarHBondContact CB-OE1 3.39Å; R117-E119 WeakPolarHBondContact CD-OE1 3.04Å; R117-E119 IonicContact CZ-OE1 3.23Å; R117-E119 VanDerWaalsContact CZ-OE1 3.23Å; R117-E119 IonicContact NE-OE1 3.29Å; R117-E119 PolarHBondContact NE-OE1 3.42Å; R117-E119 IonicContact NH1-OE1 2.74Å; R117-E119 PolarHBondContact NH1-OE1 2.72Å; R117-E119 WeakPolarHBondContact O-CG 3.27Å; R117-E119 PolarHBondContact O-N 3.45Å
120	S	60.7	Low	74.1	Confident	61 Å²	61	96 Å²	96	43%	0.427	52%	0.518	S	S	.	.			trans	-49.1	145	163.4	57.6	0	0	0	0	106.6	N118 T122 A123	N118-S120 PolarHBondContact O-N 3.29Å; S120-T122 CarbonylContact O-C 3.56Å; S120-T122 PolarHBondContact O-N 2.72Å; S120-T122 WeakPolarHBondContact OG-CB 3.38Å; S120-A123 PolarHBondContact O-N 3.49Å
121	L	60.9	Low	74.3	Confident	138 Å²	138	94.7 Å²	94.7	72%	0.723	51%	0.509	S	S	*	.	H	α-helix	trans	-42.3	-32.7	170.7	-82.6	157.1	0	0	0	110.9	Y124 N125	L121-Y124 PolarHBondContact O-N 2.75Å; L121-N125 WeakPolarHBondContact O-CB 3.5Å; L121-N125 PolarHBondContact O-N 2.82Å; L121-N125 PolarHBondContact O-ND2 2.84Å
122	T	64.8	Low	74.2	Confident	88 Å²	88	99.6 Å²	99.6	54%	0.54	52%	0.515	S	S	.	.	H	α-helix	trans	-54.6	-48.4	173.6	-36.6	0	0	0	0	114.5	S120 N125 L126	S120-T122 CarbonylContact O-C 3.56Å; S120-T122 PolarHBondContact O-N 2.72Å; S120-T122 WeakPolarHBondContact OG-CB 3.38Å; T122-N125 PolarHBondContact O-N 2.82Å; T122-L126 HydrophobicContact CG2-CD1 4.15Å; T122-L126 HydrophobicContact CG2-CG 4.48Å; T122-L126 VanDerWaalsContact O-CB 3.31Å; T122-L126 WeakPolarHBondContact O-CB 3.34Å; T122-L126 WeakPolarHBondContact O-CG 3.31Å; T122-L126 PolarHBondContact O-N 3.36Å
123	A	69.2	Low	74.3	Confident	45 Å²	45	98.7 Å²	98.7	37%	0.372	51%	0.508	S	S	.	.	H	α-helix	trans	-64.8	-45.2	-179.5	0	0	0	0	0	111.7	S120 L126 E127	S120-A123 PolarHBondContact O-N 3.49Å; A123-L126 PolarHBondContact O-N 3Å; A123-E127 PolarHBondContact O-N 3.27Å
124	Y	72.2	Confident	74.7	Confident	150 Å²	150	97 Å²	97	59%	0.588	50%	0.502	S	S	*	.	H	α-helix	trans	-65.8	-38.6	175.8	-172	-101.9	0	0	0	112.3	L121 K128	L121-Y124 PolarHBondContact O-N 2.75Å; Y124-K128 WeakPolarHBondContact O-CB 3.2Å; Y124-K128 PolarHBondContact O-N 2.79Å
125	N	77.4	Confident	75.1	Confident	77 Å²	77	99.6 Å²	99.6	41%	0.412	51%	0.505	S	S	.	.	H	α-helix	trans	-67.1	-37.1	173.9	-85.2	-75.7	0	0	0	112.1	L121 T122 K129	L121-N125 WeakPolarHBondContact O-CB 3.5Å; L121-N125 PolarHBondContact O-N 2.82Å; L121-N125 PolarHBondContact O-ND2 2.84Å; T122-N125 PolarHBondContact O-N 2.82Å; N125-K129 VanDerWaalsContact O-CB 3.3Å; N125-K129 WeakPolarHBondContact O-CB 3.18Å; N125-K129 WeakPolarHBondContact O-CG 3.31Å; N125-K129 PolarHBondContact O-N 2.96Å
126	L	78.7	Confident	75.9	Confident	101 Å²	101	100 Å²	100	53%	0.529	50%	0.497	S	S	.	.	H	α-helix	trans	-66.6	-44.4	176.5	-77.6	169.3	0	0	0	111	T122 A123 K129 A130	T122-L126 HydrophobicContact CG2-CD1 4.15Å; T122-L126 HydrophobicContact CG2-CG 4.48Å; T122-L126 VanDerWaalsContact O-CB 3.31Å; T122-L126 WeakPolarHBondContact O-CB 3.34Å; T122-L126 WeakPolarHBondContact O-CG 3.31Å; T122-L126 PolarHBondContact O-N 3.36Å; A123-L126 PolarHBondContact O-N 3Å; L126-K129 PolarHBondContact O-N 3.26Å; L126-A130 VanDerWaalsContact O-CB 3.31Å; L126-A130 WeakPolarHBondContact O-CB 3.3Å; L126-A130 PolarHBondContact O-N 3.01Å
127	E	81.6	Confident	76.8	Confident	102 Å²	102	103.7 Å²	103.7	48%	0.477	50%	0.499	S	S	.	.	H	α-helix	trans	-63.3	-43	176.2	-164.7	-168	153.8	0	0	111.4	A123 A130 K131	A123-E127 PolarHBondContact O-N 3.27Å; E127-A130 PolarHBondContact O-N 2.82Å; E127-K131 PolarHBondContact O-N 3.35Å; E127-K131 WeakPolarHBondContact OE1-CE 3.33Å; E127-K131 IonicContact OE1-NZ 2.75Å; E127-K131 PolarHBondContact OE1-NZ 2.88Å
128	K	82.4	Confident	77.8	Confident	97 Å²	97	103.9 Å²	103.9	42%	0.422	50%	0.503	S	S	.	.	H	α-helix	trans	-64.1	-42.1	176.1	-167.1	171.3	-175.2	-180	0	112.1	Y124 A130 W132	Y124-K128 WeakPolarHBondContact O-CB 3.2Å; Y124-K128 PolarHBondContact O-N 2.79Å; K128-A130 VanDerWaalsContact C-N 3.34Å; K128-W132 HydrophobicContact CD-CH2 4.44Å; K128-W132 HydrophobicContact CD-CZ2 4.25Å; K128-W132 VanDerWaalsContact CE-CZ2 3.4Å; K128-W132 HydrophobicContact CG-CD2 4.44Å; K128-W132 HydrophobicContact CG-CZ2 4.2Å; K128-W132 PolarHBondContact O-N 3.44Å; K128-W132 VanDerWaalsContact O-N 3.13Å
129	K	80.9	Confident	79	Confident	112 Å²	112	104.4 Å²	104.4	49%	0.487	50%	0.502	S	S	.	.	H	α-helix	trans	-67.8	-31.7	174.6	-78.7	-173	176.1	-173.7	0	112.8	N125 L126 R133	N125-K129 VanDerWaalsContact O-CB 3.3Å; N125-K129 WeakPolarHBondContact O-CB 3.18Å; N125-K129 WeakPolarHBondContact O-CG 3.31Å; N125-K129 PolarHBondContact O-N 2.96Å; L126-K129 PolarHBondContact O-N 3.26Å; K129-R133 PolarHBondContact O-N 3.14Å; K129-R133 VanDerWaalsContact O-N 3.14Å; K129-R133 PolarHBondContact O-NE 2.92Å
130	A	86.4	Confident	80	Confident	38 Å²	38	107.2 Å²	107.2	31%	0.314	51%	0.512	S	S	.	.	H	α-helix	trans	-67.5	-48.1	175.9	0	0	0	0	0	110.7	L126 E127 K128 W132 R133 E134	L126-A130 VanDerWaalsContact O-CB 3.31Å; L126-A130 WeakPolarHBondContact O-CB 3.3Å; L126-A130 PolarHBondContact O-N 3.01Å; E127-A130 PolarHBondContact O-N 2.82Å; K128-A130 VanDerWaalsContact C-N 3.34Å; A130-W132 PolarHBondContact O-N 3.27Å; A130-R133 PolarHBondContact O-N 3.36Å; A130-R133 VanDerWaalsContact O-N 3.11Å; A130-E134 PolarHBondContact O-N 3.47Å
131	K	89.9	Confident	80.8	Confident	105 Å²	105	108.7 Å²	108.7	46%	0.457	53%	0.528	S	S	.	.	H	α-helix	trans	-58.1	-45.5	175.5	-74.3	176.5	-177.1	160.7	0	112.6	E127 R133 E134 E135	E127-K131 PolarHBondContact O-N 3.35Å; E127-K131 WeakPolarHBondContact OE1-CE 3.33Å; E127-K131 IonicContact OE1-NZ 2.75Å; E127-K131 PolarHBondContact OE1-NZ 2.88Å; K131-R133 VanDerWaalsContact C-N 3.3Å; K131-R133 PolarHBondContact O-N 3.11Å; K131-E134 PolarHBondContact O-N 2.88Å; K131-E135 WeakPolarHBondContact O-CG 3.4Å; K131-E135 PolarHBondContact O-N 3.13Å
132	W	85.9	Confident	80.6	Confident	141 Å²	141	112.6 Å²	112.6	53%	0.534	54%	0.542	S	S	.	.	H	α-helix	trans	-62.3	-35	176.2	-71.2	-18.9	0	0	0	113.5	K128 A130 I136	K128-W132 HydrophobicContact CD-CH2 4.44Å; K128-W132 HydrophobicContact CD-CZ2 4.25Å; K128-W132 VanDerWaalsContact CE-CZ2 3.4Å; K128-W132 HydrophobicContact CG-CD2 4.44Å; K128-W132 HydrophobicContact CG-CZ2 4.2Å; K128-W132 PolarHBondContact O-N 3.44Å; K128-W132 VanDerWaalsContact O-N 3.13Å; A130-W132 PolarHBondContact O-N 3.27Å; W132-I136 WeakPolarHBondContact O-CB 3.44Å; W132-I136 WeakPolarHBondContact O-CD1 3.39Å; W132-I136 WeakPolarHBondContact O-CG1 3.22Å; W132-I136 PolarHBondContact O-N 3.01Å
133	R	85.3	Confident	81.4	Confident	138 Å²	138	113.8 Å²	113.8	52%	0.521	54%	0.542	S	S	.	.	H	α-helix	trans	-69	-42.8	175.8	-83.2	-174.3	-79.8	-104.9	4.1	112	K129 A130 K131 E135 I136 E137	K129-R133 PolarHBondContact O-N 3.14Å; K129-R133 VanDerWaalsContact O-N 3.14Å; K129-R133 PolarHBondContact O-NE 2.92Å; A130-R133 PolarHBondContact O-N 3.36Å; A130-R133 VanDerWaalsContact O-N 3.11Å; K131-R133 VanDerWaalsContact C-N 3.3Å; K131-R133 PolarHBondContact O-N 3.11Å; R133-E135 VanDerWaalsContact C-N 3.35Å; R133-I136 PolarHBondContact O-N 3.41Å; R133-E137 WeakPolarHBondContact O-CB 3.37Å; R133-E137 WeakPolarHBondContact O-CG 3.18Å; R133-E137 PolarHBondContact O-N 2.95Å
134	E	88.6	Confident	82.1	Confident	103 Å²	103	117.4 Å²	117.4	48%	0.481	55%	0.551	S	S	.	*	H	α-helix	trans	-64	-39.1	176.3	-71.4	179.7	-167.6	0	0	112.4	A130 K131 E137 K138	A130-E134 PolarHBondContact O-N 3.47Å; K131-E134 PolarHBondContact O-N 2.88Å; E134-E137 PolarHBondContact O-N 3.39Å; E134-K138 WeakPolarHBondContact O-CB 3.44Å; E134-K138 WeakPolarHBondContact O-CD 3.43Å; E134-K138 WeakPolarHBondContact O-CG 3.42Å; E134-K138 PolarHBondContact O-N 3.06Å; E134-K138 IonicContact OE2-NZ 3.97Å
135	E	86.7	Confident	82.6	Confident	107 Å²	107	115.6 Å²	115.6	50%	0.5	55%	0.549	S	S	.	.	H	α-helix	trans	-64.8	-46.2	175.6	-73.2	170.4	-176.6	0	0	111.1	K131 R133 E137 K138 E139	K131-E135 WeakPolarHBondContact O-CG 3.4Å; K131-E135 PolarHBondContact O-N 3.13Å; R133-E135 VanDerWaalsContact C-N 3.35Å; E135-E137 VanDerWaalsContact C-N 3.33Å; E135-E137 PolarHBondContact O-N 3.39Å; E135-K138 PolarHBondContact O-N 2.85Å; E135-E139 WeakPolarHBondContact O-CB 3.48Å; E135-E139 WeakPolarHBondContact O-CG 3.2Å; E135-E139 PolarHBondContact O-N 3.23Å
136	I	90.7	Very high	82.9	Confident	78 Å²	78	117.9 Å²	117.9	40%	0.4	56%	0.557	S	S	.	*	H	α-helix	trans	-63.2	-38.7	176.1	-69.6	170.3	0	0	0	111.6	W132 R133 K140	W132-I136 WeakPolarHBondContact O-CB 3.44Å; W132-I136 WeakPolarHBondContact O-CD1 3.39Å; W132-I136 WeakPolarHBondContact O-CG1 3.22Å; W132-I136 PolarHBondContact O-N 3.01Å; R133-I136 PolarHBondContact O-N 3.41Å; I136-K140 HydrophobicContact CG2-CD 3.97Å; I136-K140 VanDerWaalsContact CG2-CE 3.49Å; I136-K140 HydrophobicContact CG2-CG 4.5Å; I136-K140 WeakPolarHBondContact O-CB 3.44Å; I136-K140 WeakPolarHBondContact O-CG 3.26Å; I136-K140 PolarHBondContact O-N 2.99Å
137	E	88.3	Confident	83.2	Confident	133 Å²	133	118.9 Å²	118.9	62%	0.621	56%	0.559	S	S	*	*	H	α-helix	trans	-67.9	-38.3	176.1	-80.1	179.3	171.5	0	0	112	R133 E134 E135 K140 A141	R133-E137 WeakPolarHBondContact O-CB 3.37Å; R133-E137 WeakPolarHBondContact O-CG 3.18Å; R133-E137 PolarHBondContact O-N 2.95Å; E134-E137 PolarHBondContact O-N 3.39Å; E135-E137 VanDerWaalsContact C-N 3.33Å; E135-E137 PolarHBondContact O-N 3.39Å; E137-K140 PolarHBondContact O-N 3.42Å; E137-A141 VanDerWaalsContact O-CB 3.26Å; E137-A141 WeakPolarHBondContact O-CB 3.37Å; E137-A141 PolarHBondContact O-N 3.01Å
138	K	86.6	Confident	83.3	Confident	131 Å²	131	120.1 Å²	120.1	57%	0.57	57%	0.565	S	S	*	*	H	α-helix	trans	-65.9	-42.2	173.6	-74.2	166.6	-172.9	165.9	0	112	E134 E135 K140 A141 Q142	E134-K138 WeakPolarHBondContact O-CB 3.44Å; E134-K138 WeakPolarHBondContact O-CD 3.43Å; E134-K138 WeakPolarHBondContact O-CG 3.42Å; E134-K138 PolarHBondContact O-N 3.06Å; E134-K138 IonicContact OE2-NZ 3.97Å; E135-K138 PolarHBondContact O-N 2.85Å; K138-K140 VanDerWaalsContact C-N 3.3Å; K138-K140 PolarHBondContact O-N 3.21Å; K138-A141 PolarHBondContact O-N 3.34Å; K138-Q142 WeakPolarHBondContact O-CB 3.47Å; K138-Q142 PolarHBondContact O-N 3.45Å
139	E	83	Confident	83.4	Confident	141 Å²	141	121.7 Å²	121.7	66%	0.659	58%	0.575	S	S	*	*	H	α-helix	trans	-66.3	-29.6	175.7	-75	-178.8	168	0	0	113	E135	E135-E139 WeakPolarHBondContact O-CB 3.48Å; E135-E139 WeakPolarHBondContact O-CG 3.2Å; E135-E139 PolarHBondContact O-N 3.23Å
140	K	80.4	Confident	83.6	Confident	166 Å²	166	122.5 Å²	122.5	72%	0.722	58%	0.582	S	S	*	*	H	α-helix	trans	-82.8	-24.1	175.7	-74.6	173.2	-180	178.1	0	113.8	I136 E137 K138 Q142	I136-K140 HydrophobicContact CG2-CD 3.97Å; I136-K140 VanDerWaalsContact CG2-CE 3.49Å; I136-K140 HydrophobicContact CG2-CG 4.5Å; I136-K140 WeakPolarHBondContact O-CB 3.44Å; I136-K140 WeakPolarHBondContact O-CG 3.26Å; I136-K140 PolarHBondContact O-N 2.99Å; E137-K140 PolarHBondContact O-N 3.42Å; K138-K140 VanDerWaalsContact C-N 3.3Å; K138-K140 PolarHBondContact O-N 3.21Å; K140-Q142 VanDerWaalsContact C-N 3.33Å
141	A	76.1	Confident	83.4	Confident	92 Å²	92	129.5 Å²	129.5	76%	0.76	60%	0.604	S	S	*	*			trans	-87.9	-6	177.6	0	0	0	0	0	112.9	E137 K138	E137-A141 VanDerWaalsContact O-CB 3.26Å; E137-A141 WeakPolarHBondContact O-CB 3.37Å; E137-A141 PolarHBondContact O-N 3.01Å; K138-A141 PolarHBondContact O-N 3.34Å
142	Q	58.7	Low	82.8	Confident	219 Å²	219	131.7 Å²	131.7	100%	1.023	62%	0.617	S	S	*	*			trans	-101.3	0	175	-168.3	169.3	3.5	0	0	110.4	K138 K140	K138-Q142 WeakPolarHBondContact O-CB 3.47Å; K138-Q142 PolarHBondContact O-N 3.45Å; K140-Q142 VanDerWaalsContact C-N 3.33Å

Retrieved 142 of 142 residues in 126.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).