A0A087XEW8_POEFO Loading...

Small vasohibin-binding protein

AlphaFold DB , UniProt , Accession A0A087XEW8, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 66 aa.

						>A0A087XEW8_POEFO|A0A087XEW8
MEPACRKDKPKLNSTPTRGDRAKQKSAQQEAKQRQRAEIYALNKVMTELEQQQFEAFCKQMQSQGE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.6	Low	50.9	Low	238 Å²	238	166.1 Å²	166.1	100%	1.172	85%	0.849	S	S	*	*				0	110.4	0	-166.6	-175	-161.9	0	0	106.3
2	E	39.9	Very low	50.5	Low	190 Å²	190	165.2 Å²	165.2	89%	0.888	85%	0.846	S	S	*	*			trans	-145.9	114.5	170.6	-90.8	-93.8	107	0	0	104.7
3	P	55.7	Low	50.6	Low	114 Å²	114	165.1 Å²	165.1	74%	0.74	85%	0.848	S	S	*	*			trans	-99.1	152.2	-173.3	35.4	-28.9	0	0	0	113.1
4	A	51	Low	50.6	Low	93 Å²	93	159.4 Å²	159.4	77%	0.769	83%	0.83	S	S	*	*			trans	76.8	107.7	154.9	0	0	0	0	0	119.8
5	C	41.9	Very low	50.7	Low	134 Å²	134	156.1 Å²	156.1	91%	0.905	82%	0.82	S	S	*	*				-145	94	126.7	-106.5	0	0	0	0	109.4	K7	C5-K7 PolarHBondContact O-N 3.44Å
6	R	58.1	Low	51	Low	250 Å²	250	150.4 Å²	150.4	94%	0.943	80%	0.795	S	S	*	*			trans	-66.4	117.3	162	-65.9	-179.3	179.1	-166.2	0.3	107.2
7	K	54.4	Low	51.8	Low	192 Å²	192	147.2 Å²	147.2	84%	0.835	78%	0.783	S	S	*	*			trans	-131.8	98.7	164.2	-139.6	170.1	-175.3	177	0	109.3	C5	C5-K7 PolarHBondContact O-N 3.44Å
8	D	42.3	Very low	52.3	Low	136 Å²	136	151.8 Å²	151.8	73%	0.727	79%	0.788	S	S	*	*			trans	49	109.7	146.1	-61.3	-70.1	0	0	0	120.3	P10	D8-P10 WeakPolarHBondContact O-CD 3.33Å
9	K	51.8	Low	52.7	Low	174 Å²	174	146 Å²	146	76%	0.757	77%	0.769	S	S	*	*			trans	-48.9	130.8	152.1	-69.4	166	170	163	0	110.3	K11	K9-K11 PolarHBondContact O-N 3.46Å
10	P	49.1	Very low	53.3	Low	127 Å²	127	142.9 Å²	142.9	83%	0.825	75%	0.753	S	S	*	*			trans	-82.3	95.9	135.3	17.9	-4.5	0	0	0	107.3	D8 L12	D8-P10 WeakPolarHBondContact O-CD 3.33Å; P10-L12 VanDerWaalsContact C-N 3.31Å; P10-L12 PolarHBondContact O-N 2.78Å; P10-L12 VanDerWaalsContact O-N 3.1Å
11	K	52.8	Low	53.8	Low	179 Å²	179	143 Å²	143	78%	0.778	74%	0.743	S	S	*	*			trans	-67.1	100.4	152.6	-92.1	-174.5	174.8	-176.9	0	105.8	K9	K9-K11 PolarHBondContact O-N 3.46Å
12	L	46.8	Very low	54.1	Low	155 Å²	155	134.4 Å²	134.4	81%	0.812	71%	0.71	S	S	*	*			trans	-140.9	98.1	147.9	-130	102.7	0	0	0	107.4	P10 S14	P10-L12 VanDerWaalsContact C-N 3.31Å; P10-L12 PolarHBondContact O-N 2.78Å; P10-L12 VanDerWaalsContact O-N 3.1Å; L12-S14 PolarHBondContact O-N 3.27Å
13	N	51.3	Low	55.5	Low	164 Å²	164	132.4 Å²	132.4	88%	0.877	70%	0.698	S	S	*	*			trans	-56.7	86.6	156	-78.2	-11.9	0	0	0	107.1	T15	N13-T15 VanDerWaalsContact C-N 3.33Å; N13-T15 PolarHBondContact O-N 3.04Å
14	S	50.4	Low	56.5	Low	85 Å²	85	133.8 Å²	133.8	59%	0.594	70%	0.695	S	S	*	*			trans	-77.4	95.7	160.5	-174	0	0	0	0	105.5	L12 P16	L12-S14 PolarHBondContact O-N 3.27Å; S14-P16 VanDerWaalsContact O-CD 3.31Å; S14-P16 WeakPolarHBondContact O-CD 3.37Å; S14-P16 VanDerWaalsContact O-N 3.17Å
15	T	52	Low	58	Low	111 Å²	111	136 Å²	136	68%	0.681	69%	0.687	S	S	*	*			trans	-53.3	120.3	163.4	31.2	0	0	0	0	106.6	N13 T17	N13-T15 VanDerWaalsContact C-N 3.33Å; N13-T15 PolarHBondContact O-N 3.04Å; T15-T17 PolarHBondContact O-N 3.04Å
16	P	56.3	Low	59.9	Low	64 Å²	64	132.8 Å²	132.8	42%	0.416	67%	0.666	S	S	.	*			trans	-59.9	108.2	-179.6	-19.7	29.7	0	0	0	107.5	S14 R21	S14-P16 VanDerWaalsContact O-CD 3.31Å; S14-P16 WeakPolarHBondContact O-CD 3.37Å; S14-P16 VanDerWaalsContact O-N 3.17Å; P16-R21 HydrophobicContact CB-CG 4.07Å; P16-R21 PolarHBondContact O-NE 3.48Å
17	T	63.6	Low	61.2	Low	97 Å²	97	123.6 Å²	123.6	60%	0.595	64%	0.644	S	S	*	*			trans	-60.7	147.6	-179.7	-56	0	0	0	0	107	T15 G19 D20	T15-T17 PolarHBondContact O-N 3.04Å; T17-G19 PolarHBondContact O-N 3.32Å; T17-D20 PolarHBondContact O-N 3.44Å
18	R	60.8	Low	63.1	Low	230 Å²	230	121.3 Å²	121.3	87%	0.868	64%	0.636	S	S	*	*	H	α-helix	trans	-48.9	-31.8	-173.7	-173.6	178.9	177.5	-171.2	-0.2	113.4	A22	R18-A22 PolarHBondContact O-N 3.15Å
19	G	61.2	Low	65.6	Low	41 Å²	41	120.8 Å²	120.8	42%	0.423	63%	0.629	S	S	.	*	H	α-helix	trans	-67.2	-36.1	174.7	0	0	0	0	0	115.3	T17 A22 K23	T17-G19 PolarHBondContact O-N 3.32Å; G19-A22 PolarHBondContact O-N 3.23Å; G19-K23 PolarHBondContact O-N 3.45Å; G19-K23 VanDerWaalsContact O-N 3.17Å
20	D	63.4	Low	67.6	Low	84 Å²	84	118.6 Å²	118.6	45%	0.449	62%	0.622	S	S	.	*	H	α-helix	trans	-67.9	-37.3	178.3	-81.8	-41.6	0	0	0	112	T17 A22 K23 Q24	T17-D20 PolarHBondContact O-N 3.44Å; D20-A22 VanDerWaalsContact C-N 3.28Å; D20-A22 PolarHBondContact O-N 3.4Å; D20-K23 PolarHBondContact O-N 3Å; D20-Q24 WeakPolarHBondContact O-CB 3.31Å; D20-Q24 PolarHBondContact O-N 3.49Å
21	R	65.1	Low	69.8	Low	144 Å²	144	114.8 Å²	114.8	54%	0.543	60%	0.601	S	S	.	*	H	α-helix	trans	-66.6	-31.8	175.7	-57.7	-171.4	-154.3	-156.3	4.7	112.2	P16 K25	P16-R21 HydrophobicContact CB-CG 4.07Å; P16-R21 PolarHBondContact O-NE 3.48Å; R21-K25 WeakPolarHBondContact O-CB 3.44Å; R21-K25 WeakPolarHBondContact O-CG 3.37Å; R21-K25 PolarHBondContact O-N 3.47Å; R21-K25 VanDerWaalsContact O-N 3.11Å
22	A	67.5	Low	71.9	Confident	59 Å²	59	113.5 Å²	113.5	49%	0.488	60%	0.595	S	S	.	*	H	α-helix	trans	-69.9	-44.8	176.7	0	0	0	0	0	111.3	R18 G19 D20 K25 S26	R18-A22 PolarHBondContact O-N 3.15Å; G19-A22 PolarHBondContact O-N 3.23Å; D20-A22 VanDerWaalsContact C-N 3.28Å; D20-A22 PolarHBondContact O-N 3.4Å; A22-K25 PolarHBondContact O-N 3.34Å; A22-S26 PolarHBondContact O-N 2.87Å; A22-S26 PolarHBondContact O-OG 3Å
23	K	70.5	Confident	74.4	Confident	148 Å²	148	112.8 Å²	112.8	64%	0.643	59%	0.587	S	S	*	*	H	α-helix	trans	-65.9	-38.4	176.1	-67.1	-178.6	-179.2	-177.8	0	112.8	G19 D20 S26 A27	G19-K23 PolarHBondContact O-N 3.45Å; G19-K23 VanDerWaalsContact O-N 3.17Å; D20-K23 PolarHBondContact O-N 3Å; K23-S26 WeakPolarHBondContact CA-OG 3.39Å; K23-S26 PolarHBondContact O-N 3.43Å; K23-S26 PolarHBondContact O-OG 3.02Å; K23-A27 WeakPolarHBondContact O-CB 3.4Å; K23-A27 PolarHBondContact O-N 3Å
24	Q	77	Confident	76.6	Confident	142 Å²	142	112.9 Å²	112.9	66%	0.664	58%	0.576	S	S	*	*	H	α-helix	trans	-65.1	-39.9	175.2	-168.4	-179.7	16.4	0	0	111.7	D20 Q28	D20-Q24 WeakPolarHBondContact O-CB 3.31Å; D20-Q24 PolarHBondContact O-N 3.49Å; Q24-Q28 WeakPolarHBondContact O-CB 3.43Å; Q24-Q28 PolarHBondContact O-N 3.44Å
25	K	81.4	Confident	78.9	Confident	140 Å²	140	114.4 Å²	114.4	61%	0.609	57%	0.573	S	S	*	*	H	α-helix	trans	-65.8	-41.4	175.4	-77	177	-177.8	-169.2	0	112.5	R21 A22 Q28 Q29	R21-K25 WeakPolarHBondContact O-CB 3.44Å; R21-K25 WeakPolarHBondContact O-CG 3.37Å; R21-K25 PolarHBondContact O-N 3.47Å; R21-K25 VanDerWaalsContact O-N 3.11Å; A22-K25 PolarHBondContact O-N 3.34Å; K25-Q28 PolarHBondContact O-N 3.49Å; K25-Q29 WeakPolarHBondContact O-CG 3.34Å; K25-Q29 PolarHBondContact O-N 3.27Å
26	S	82.1	Confident	81.1	Confident	66 Å²	66	116.1 Å²	116.1	46%	0.462	57%	0.567	S	S	.	*	H	α-helix	trans	-65.2	-44.1	177.6	60.2	0	0	0	0	111.6	A22 K23 Q28 Q29 E30	A22-S26 PolarHBondContact O-N 2.87Å; A22-S26 PolarHBondContact O-OG 3Å; K23-S26 WeakPolarHBondContact CA-OG 3.39Å; K23-S26 PolarHBondContact O-N 3.43Å; K23-S26 PolarHBondContact O-OG 3.02Å; S26-Q28 VanDerWaalsContact C-N 3.29Å; S26-Q28 PolarHBondContact O-N 3.38Å; S26-Q29 PolarHBondContact O-N 3.19Å; S26-Q29 VanDerWaalsContact O-N 3.16Å; S26-E30 PolarHBondContact O-N 3.44Å
27	A	86.4	Confident	83.1	Confident	57 Å²	57	116 Å²	116	47%	0.471	57%	0.572	S	S	.	*	H	α-helix	trans	-59.9	-39.6	175.6	0	0	0	0	0	112.1	K23 A31	K23-A27 WeakPolarHBondContact O-CB 3.4Å; K23-A27 PolarHBondContact O-N 3Å; A27-A31 WeakPolarHBondContact O-CB 3.37Å; A27-A31 PolarHBondContact O-N 3.26Å
28	Q	92.5	Very high	84.7	Confident	144 Å²	144	116.7 Å²	116.7	67%	0.673	57%	0.568	S	S	*	*	H	α-helix	trans	-67.7	-38.6	175.8	-172.3	177.7	52.8	0	0	112.6	Q24 K25 S26 K32	Q24-Q28 WeakPolarHBondContact O-CB 3.43Å; Q24-Q28 PolarHBondContact O-N 3.44Å; K25-Q28 PolarHBondContact O-N 3.49Å; S26-Q28 VanDerWaalsContact C-N 3.29Å; S26-Q28 PolarHBondContact O-N 3.38Å; Q28-K32 WeakPolarHBondContact O-CB 3.4Å; Q28-K32 PolarHBondContact O-N 3.08Å
29	Q	94.8	Very high	86.6	Confident	126 Å²	126	110.3 Å²	110.3	59%	0.589	55%	0.551	S	S	*	*	H	α-helix	trans	-66.9	-42.4	176.8	-76.3	-179.2	-7.3	0	0	111.9	K25 S26 K32 Q33	K25-Q29 WeakPolarHBondContact O-CG 3.34Å; K25-Q29 PolarHBondContact O-N 3.27Å; S26-Q29 PolarHBondContact O-N 3.19Å; S26-Q29 VanDerWaalsContact O-N 3.16Å; Q29-K32 PolarHBondContact O-N 2.9Å; Q29-Q33 WeakPolarHBondContact O-CG 3.44Å; Q29-Q33 PolarHBondContact O-N 3.33Å
30	E	94.6	Very high	88.3	Confident	128 Å²	128	114.5 Å²	114.5	60%	0.598	55%	0.554	S	S	*	*	H	α-helix	trans	-61.9	-46.9	175.9	-171.2	-177.3	161.8	0	0	111	S26 K32 Q33 R34	S26-E30 PolarHBondContact O-N 3.44Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.44Å; E30-Q33 PolarHBondContact O-N 2.89Å; E30-R34 WeakPolarHBondContact O-CB 2.85Å; E30-R34 PolarHBondContact O-N 2.95Å
31	A	95.4	Very high	90	Very high	46 Å²	46	113.3 Å²	113.3	38%	0.38	56%	0.556	S	S	.	*	H	α-helix	trans	-58.1	-43.6	175.2	0	0	0	0	0	111.9	A27 R34 Q35	A27-A31 WeakPolarHBondContact O-CB 3.37Å; A27-A31 PolarHBondContact O-N 3.26Å; A31-R34 PolarHBondContact O-N 3.48Å; A31-Q35 WeakPolarHBondContact O-CB 3.49Å; A31-Q35 VanDerWaalsContact O-CG 3.28Å; A31-Q35 WeakPolarHBondContact O-CG 3.35Å; A31-Q35 PolarHBondContact O-N 3.01Å
32	K	97.5	Very high	91.6	Very high	153 Å²	153	111.3 Å²	111.3	67%	0.665	56%	0.556	S	S	*	*	H	α-helix	trans	-64.5	-41	177.5	-173.6	179.6	-179.5	-178.9	0	112.4	Q28 Q29 E30 R36	Q28-K32 WeakPolarHBondContact O-CB 3.4Å; Q28-K32 PolarHBondContact O-N 3.08Å; Q29-K32 PolarHBondContact O-N 2.9Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.44Å; K32-R36 WeakPolarHBondContact O-CB 3.47Å; K32-R36 PolarHBondContact O-N 3.46Å
33	Q	97.9	Very high	93.1	Very high	139 Å²	139	112.4 Å²	112.4	65%	0.65	55%	0.554	S	S	*	*	H	α-helix	trans	-66.4	-41.6	177.5	-73.7	177.6	9.7	0	0	111.3	Q29 E30 R36 A37	Q29-Q33 WeakPolarHBondContact O-CG 3.44Å; Q29-Q33 PolarHBondContact O-N 3.33Å; E30-Q33 PolarHBondContact O-N 2.89Å; Q33-R36 WeakPolarHBondContact O-CB 3.44Å; Q33-R36 PolarHBondContact O-N 3.4Å; Q33-A37 PolarHBondContact O-N 2.98Å
34	R	97.8	Very high	94.5	Very high	166 Å²	166	111.9 Å²	111.9	63%	0.626	55%	0.551	S	S	*	*	H	α-helix	trans	-62	-50.1	175.4	-167.2	-175.2	-165	124.9	3.2	111.7	E30 A31 R36 A37 E38	E30-R34 WeakPolarHBondContact O-CB 2.85Å; E30-R34 PolarHBondContact O-N 2.95Å; A31-R34 PolarHBondContact O-N 3.48Å; R34-R36 VanDerWaalsContact C-N 3.27Å; R34-R36 PolarHBondContact O-N 2.92Å; R34-A37 WeakPolarHBondContact O-CB 3.48Å; R34-A37 PolarHBondContact O-N 3.36Å; R34-A37 VanDerWaalsContact O-N 3.07Å; R34-E38 WeakPolarHBondContact CG-OE1 3.43Å; R34-E38 IonicContact NE-OE1 3.7Å; R34-E38 WeakPolarHBondContact O-CG 3.42Å; R34-E38 PolarHBondContact O-N 3.28Å
35	Q	98.3	Very high	95.5	Very high	117 Å²	117	109.3 Å²	109.3	55%	0.547	55%	0.545	S	S	.	.	H	α-helix	trans	-58.1	-40.6	174.8	-74.3	175.1	-6.9	0	0	111.7	A31 E38 I39	A31-Q35 WeakPolarHBondContact O-CB 3.49Å; A31-Q35 VanDerWaalsContact O-CG 3.28Å; A31-Q35 WeakPolarHBondContact O-CG 3.35Å; A31-Q35 PolarHBondContact O-N 3.01Å; Q35-E38 PolarHBondContact O-N 3.03Å; Q35-I39 VanDerWaalsContact O-CG1 3.28Å; Q35-I39 WeakPolarHBondContact O-CG1 3.46Å; Q35-I39 PolarHBondContact O-N 3.47Å
36	R	98.6	Very high	96.3	Very high	148 Å²	148	107.4 Å²	107.4	56%	0.558	54%	0.539	S	S	*	.	H	α-helix	trans	-61.6	-44.9	175.2	-173.9	177.5	-175.6	-84.1	-1.3	111.1	K32 Q33 R34 E38 I39 Y40	K32-R36 WeakPolarHBondContact O-CB 3.47Å; K32-R36 PolarHBondContact O-N 3.46Å; Q33-R36 WeakPolarHBondContact O-CB 3.44Å; Q33-R36 PolarHBondContact O-N 3.4Å; R34-R36 VanDerWaalsContact C-N 3.27Å; R34-R36 PolarHBondContact O-N 2.92Å; R36-E38 VanDerWaalsContact C-N 3.33Å; R36-E38 PolarHBondContact O-N 3.46Å; R36-I39 PolarHBondContact O-N 2.9Å; R36-Y40 HydrophobicContact CG-CD2 3.91Å; R36-Y40 HydrophobicContact CG-CE2 3.7Å; R36-Y40 PolarHBondContact NH2-OH 3.41Å; R36-Y40 WeakPolarHBondContact O-CD2 3.22Å; R36-Y40 PolarHBondContact O-N 2.98Å
37	A	98.4	Very high	97.1	Very high	62 Å²	62	108.5 Å²	108.5	51%	0.512	54%	0.544	S	S	.	.	H	α-helix	trans	-61.6	-42.2	177.3	0	0	0	0	0	111.8	Q33 R34 Y40 A41	Q33-A37 PolarHBondContact O-N 2.98Å; R34-A37 WeakPolarHBondContact O-CB 3.48Å; R34-A37 PolarHBondContact O-N 3.36Å; R34-A37 VanDerWaalsContact O-N 3.07Å; A37-Y40 PolarHBondContact O-N 3.4Å; A37-A41 PolarHBondContact O-N 2.92Å
38	E	98.5	Very high	97.7	Very high	111 Å²	111	110.1 Å²	110.1	52%	0.519	54%	0.541	S	S	.	.	H	α-helix	trans	-62	-42	175.6	-70.4	169.9	-162.3	0	0	111.9	R34 Q35 R36 Y40 A41 L42	R34-E38 WeakPolarHBondContact CG-OE1 3.43Å; R34-E38 IonicContact NE-OE1 3.7Å; R34-E38 WeakPolarHBondContact O-CG 3.42Å; R34-E38 PolarHBondContact O-N 3.28Å; Q35-E38 PolarHBondContact O-N 3.03Å; R36-E38 VanDerWaalsContact C-N 3.33Å; R36-E38 PolarHBondContact O-N 3.46Å; E38-Y40 PolarHBondContact O-N 3.29Å; E38-A41 PolarHBondContact O-N 3.31Å; E38-L42 WeakPolarHBondContact O-CB 3.43Å; E38-L42 PolarHBondContact O-N 2.93Å
39	I	98.8	Very high	98	Very high	96 Å²	96	106.8 Å²	106.8	49%	0.492	53%	0.528	S	S	.	.	H	α-helix	trans	-61.1	-43.3	174.7	-69.7	163.9	0	0	0	111.2	Q35 R36 L42 N43	Q35-I39 VanDerWaalsContact O-CG1 3.28Å; Q35-I39 WeakPolarHBondContact O-CG1 3.46Å; Q35-I39 PolarHBondContact O-N 3.47Å; R36-I39 PolarHBondContact O-N 2.9Å; I39-L42 PolarHBondContact O-N 3.31Å; I39-N43 WeakPolarHBondContact O-CB 3.37Å; I39-N43 VanDerWaalsContact O-CG 3.3Å; I39-N43 PolarHBondContact O-N 2.9Å
40	Y	98.8	Very high	98.2	Very high	128 Å²	128	107.2 Å²	107.2	50%	0.502	53%	0.53	S	S	.	.	H	α-helix	trans	-68.9	-37.3	178.1	-82.9	-73	0	0	0	112.8	R36 A37 E38 L42 N43 K44	R36-Y40 HydrophobicContact CG-CD2 3.91Å; R36-Y40 HydrophobicContact CG-CE2 3.7Å; R36-Y40 PolarHBondContact NH2-OH 3.41Å; R36-Y40 WeakPolarHBondContact O-CD2 3.22Å; R36-Y40 PolarHBondContact O-N 2.98Å; A37-Y40 PolarHBondContact O-N 3.4Å; E38-Y40 PolarHBondContact O-N 3.29Å; Y40-L42 VanDerWaalsContact C-N 3.34Å; Y40-N43 PolarHBondContact O-N 3.11Å; Y40-K44 WeakPolarHBondContact O-CB 3.48Å; Y40-K44 PolarHBondContact O-N 3.06Å
41	A	98.7	Very high	98.3	Very high	59 Å²	59	105.7 Å²	105.7	49%	0.488	52%	0.522	S	S	.	.	H	α-helix	trans	-61.5	-45.3	174.1	0	0	0	0	0	110.7	A37 E38 K44 V45	A37-A41 PolarHBondContact O-N 2.92Å; E38-A41 PolarHBondContact O-N 3.31Å; A41-K44 PolarHBondContact O-N 3.47Å; A41-V45 PolarHBondContact O-N 3.32Å
42	L	98.7	Very high	98.5	Very high	103 Å²	103	109.4 Å²	109.4	54%	0.539	53%	0.532	S	S	.	.	H	α-helix	trans	-62.7	-49.8	175.6	179.6	62.8	0	0	0	111.7	E38 I39 Y40 K44 V45 M46	E38-L42 WeakPolarHBondContact O-CB 3.43Å; E38-L42 PolarHBondContact O-N 2.93Å; I39-L42 PolarHBondContact O-N 3.31Å; Y40-L42 VanDerWaalsContact C-N 3.34Å; L42-K44 PolarHBondContact O-N 2.89Å; L42-V45 PolarHBondContact O-N 3.33Å; L42-V45 VanDerWaalsContact O-N 3.11Å; L42-M46 HydrophobicContact CD1-CG 4.12Å; L42-M46 HydrophobicContact CD1-SD 4.5Å; L42-M46 HydrophobicContact CG-CG 4.22Å; L42-M46 WeakPolarHBondContact O-CG 3.28Å; L42-M46 PolarHBondContact O-N 3.5Å
43	N	98.7	Very high	98.5	Very high	82 Å²	82	107.9 Å²	107.9	44%	0.439	53%	0.527	S	S	.	.	H	α-helix	trans	-57.7	-39.8	-179.3	-79.6	-4.9	0	0	0	111.8	I39 Y40 M46 T47	I39-N43 WeakPolarHBondContact O-CB 3.37Å; I39-N43 VanDerWaalsContact O-CG 3.3Å; I39-N43 PolarHBondContact O-N 2.9Å; Y40-N43 PolarHBondContact O-N 3.11Å; N43-M46 PolarHBondContact O-N 3.33Å; N43-T47 WeakPolarHBondContact O-CB 3.41Å; N43-T47 PolarHBondContact O-N 3.27Å; N43-T47 PolarHBondContact O-OG1 3.01Å; N43-T47 VanDerWaalsContact O-OG1 3.06Å
44	K	98.7	Very high	98.5	Very high	137 Å²	137	107 Å²	107	60%	0.596	52%	0.522	S	S	*	.	H	α-helix	trans	-59.2	-49.4	176.2	-178.2	177	172.8	-178.8	0	111.4	Y40 A41 L42 M46 T47 E48	Y40-K44 WeakPolarHBondContact O-CB 3.48Å; Y40-K44 PolarHBondContact O-N 3.06Å; A41-K44 PolarHBondContact O-N 3.47Å; L42-K44 PolarHBondContact O-N 2.89Å; K44-M46 VanDerWaalsContact C-N 3.31Å; K44-M46 PolarHBondContact O-N 2.85Å; K44-T47 PolarHBondContact O-N 3.46Å; K44-E48 WeakPolarHBondContact CE-OE1 3.28Å; K44-E48 IonicContact NZ-OE1 3.89Å; K44-E48 WeakPolarHBondContact O-CG 3.32Å; K44-E48 PolarHBondContact O-N 2.93Å
45	V	98.7	Very high	98.5	Very high	87 Å²	87	103.2 Å²	103.2	53%	0.527	51%	0.511	S	S	.	.	H	α-helix	trans	-62.5	-41.1	178.5	174.8	0	0	0	0	111.1	A41 L42 E48 L49	A41-V45 PolarHBondContact O-N 3.32Å; L42-V45 PolarHBondContact O-N 3.33Å; L42-V45 VanDerWaalsContact O-N 3.11Å; V45-E48 PolarHBondContact O-N 3.31Å; V45-L49 WeakPolarHBondContact O-CB 3.47Å; V45-L49 PolarHBondContact O-N 2.92Å
46	M	98.8	Very high	98.5	Very high	100 Å²	100	100.3 Å²	100.3	49%	0.493	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-43.7	177.9	-68.8	-57.5	-58.7	0	0	112	L42 N43 K44 L49 E50	L42-M46 HydrophobicContact CD1-CG 4.12Å; L42-M46 HydrophobicContact CD1-SD 4.5Å; L42-M46 HydrophobicContact CG-CG 4.22Å; L42-M46 WeakPolarHBondContact O-CG 3.28Å; L42-M46 PolarHBondContact O-N 3.5Å; N43-M46 PolarHBondContact O-N 3.33Å; K44-M46 VanDerWaalsContact C-N 3.31Å; K44-M46 PolarHBondContact O-N 2.85Å; M46-L49 PolarHBondContact O-N 3.06Å; M46-E50 PolarHBondContact O-N 2.9Å
47	T	98.7	Very high	98.4	Very high	90 Å²	90	98.9 Å²	98.9	55%	0.552	51%	0.505	S	S	*	.	H	α-helix	trans	-64.8	-42.4	176.3	-61.1	0	0	0	0	111.8	N43 K44 L49 E50 Q51	N43-T47 WeakPolarHBondContact O-CB 3.41Å; N43-T47 PolarHBondContact O-N 3.27Å; N43-T47 PolarHBondContact O-OG1 3.01Å; N43-T47 VanDerWaalsContact O-OG1 3.06Å; K44-T47 PolarHBondContact O-N 3.46Å; T47-L49 VanDerWaalsContact C-N 3.32Å; T47-L49 PolarHBondContact O-N 3.01Å; T47-E50 PolarHBondContact O-N 3.07Å; T47-Q51 WeakPolarHBondContact O-CB 3.37Å; T47-Q51 PolarHBondContact O-N 2.93Å
48	E	98.6	Very high	98.3	Very high	91 Å²	91	97.9 Å²	97.9	43%	0.425	49%	0.494	S	S	.	.	H	α-helix	trans	-63.2	-40	176.3	-73.5	173	-174.9	0	0	111.6	K44 V45 Q51 Q52	K44-E48 WeakPolarHBondContact CE-OE1 3.28Å; K44-E48 IonicContact NZ-OE1 3.89Å; K44-E48 WeakPolarHBondContact O-CG 3.32Å; K44-E48 PolarHBondContact O-N 2.93Å; V45-E48 PolarHBondContact O-N 3.31Å; E48-Q51 PolarHBondContact O-N 3.46Å; E48-Q52 VanDerWaalsContact O-CG 3.31Å; E48-Q52 WeakPolarHBondContact O-CG 3.39Å; E48-Q52 PolarHBondContact O-N 3.26Å
49	L	98.7	Very high	98.1	Very high	74 Å²	74	99 Å²	99	39%	0.387	50%	0.497	S	S	.	.	H	α-helix	trans	-63.6	-46.7	176.2	178.5	62.9	0	0	0	111.9	V45 M46 T47 Q51 Q52 Q53	V45-L49 WeakPolarHBondContact O-CB 3.47Å; V45-L49 PolarHBondContact O-N 2.92Å; M46-L49 PolarHBondContact O-N 3.06Å; T47-L49 VanDerWaalsContact C-N 3.32Å; T47-L49 PolarHBondContact O-N 3.01Å; L49-Q51 VanDerWaalsContact C-N 3.33Å; L49-Q51 PolarHBondContact O-N 3.37Å; L49-Q52 PolarHBondContact O-N 3.22Å; L49-Q53 WeakPolarHBondContact O-CG 3.34Å; L49-Q53 PolarHBondContact O-N 2.92Å
50	E	98.6	Very high	97.9	Very high	134 Å²	134	100 Å²	100	63%	0.626	50%	0.5	S	S	*	.	H	α-helix	trans	-61.1	-43.2	177.9	-174.8	177	-168.2	0	0	111.2	M46 T47 Q52 Q53 F54	M46-E50 PolarHBondContact O-N 2.9Å; T47-E50 PolarHBondContact O-N 3.07Å; E50-Q52 PolarHBondContact O-N 2.92Å; E50-Q53 PolarHBondContact O-N 2.93Å; E50-F54 WeakPolarHBondContact O-CB 3.41Å; E50-F54 PolarHBondContact O-N 3.39Å
51	Q	98.6	Very high	97.6	Very high	96 Å²	96	98.8 Å²	98.8	45%	0.449	50%	0.5	S	S	.	.	H	α-helix	trans	-60.9	-44.3	176.4	-176.6	63.4	44.4	0	0	111.8	T47 E48 L49 Q53 F54 E55	T47-Q51 WeakPolarHBondContact O-CB 3.37Å; T47-Q51 PolarHBondContact O-N 2.93Å; E48-Q51 PolarHBondContact O-N 3.46Å; L49-Q51 VanDerWaalsContact C-N 3.33Å; L49-Q51 PolarHBondContact O-N 3.37Å; Q51-Q53 VanDerWaalsContact C-N 3.35Å; Q51-Q53 PolarHBondContact O-N 2.99Å; Q51-F54 PolarHBondContact O-N 3.29Å; Q51-E55 WeakPolarHBondContact CG-OE1 3.21Å; Q51-E55 PolarHBondContact NE2-OE1 3.06Å; Q51-E55 WeakPolarHBondContact O-CG 3.41Å; Q51-E55 PolarHBondContact O-N 3.03Å
52	Q	98.4	Very high	97.1	Very high	125 Å²	125	102.8 Å²	102.8	58%	0.584	51%	0.508	S	S	*	.	H	α-helix	trans	-61.9	-42.5	176.9	-74	174.2	14.2	0	0	112.1	E48 L49 E50 F54 E55 A56	E48-Q52 VanDerWaalsContact O-CG 3.31Å; E48-Q52 WeakPolarHBondContact O-CG 3.39Å; E48-Q52 PolarHBondContact O-N 3.26Å; L49-Q52 PolarHBondContact O-N 3.22Å; E50-Q52 PolarHBondContact O-N 2.92Å; Q52-F54 VanDerWaalsContact C-N 3.34Å; Q52-E55 PolarHBondContact O-N 3.29Å; Q52-A56 WeakPolarHBondContact O-CB 3.41Å; Q52-A56 PolarHBondContact O-N 2.9Å
53	Q	98.1	Very high	96.2	Very high	121 Å²	121	101.4 Å²	101.4	57%	0.565	51%	0.508	S	S	*	.	H	α-helix	trans	-63.1	-42.6	176.3	-71.5	176.6	-10.5	0	0	111.3	L49 E50 Q51 A56 F57	L49-Q53 WeakPolarHBondContact O-CG 3.34Å; L49-Q53 PolarHBondContact O-N 2.92Å; E50-Q53 PolarHBondContact O-N 2.93Å; Q51-Q53 VanDerWaalsContact C-N 3.35Å; Q51-Q53 PolarHBondContact O-N 2.99Å; Q53-A56 PolarHBondContact O-N 3.36Å; Q53-F57 WeakPolarHBondContact O-CB 3.47Å; Q53-F57 PolarHBondContact O-N 3.49Å
54	F	98.1	Very high	95	Very high	120 Å²	120	103.9 Å²	103.9	53%	0.526	52%	0.517	S	S	.	.	H	α-helix	trans	-64.9	-45.8	177.5	-178.5	-106.3	0	0	0	112.2	E50 Q51 Q52 A56 F57 C58	E50-F54 WeakPolarHBondContact O-CB 3.41Å; E50-F54 PolarHBondContact O-N 3.39Å; Q51-F54 PolarHBondContact O-N 3.29Å; Q52-F54 VanDerWaalsContact C-N 3.34Å; F54-A56 VanDerWaalsContact C-N 3.34Å; F54-A56 PolarHBondContact O-N 3.36Å; F54-F57 WeakPolarHBondContact O-CB 3.47Å; F54-F57 PolarHBondContact O-N 3.16Å; F54-C58 VanDerWaalsContact CZ-SG 3.51Å; F54-C58 PolarHBondContact O-N 2.88Å; F54-C58 PolarHBondContact O-SG 3.43Å
55	E	97.6	Very high	93.5	Very high	86 Å²	86	100.9 Å²	100.9	40%	0.402	52%	0.524	S	S	.	.	H	α-helix	trans	-62.5	-40.9	177.3	-75.3	176	-162.8	0	0	112.5	Q51 Q52 F57 C58 K59	Q51-E55 WeakPolarHBondContact CG-OE1 3.21Å; Q51-E55 PolarHBondContact NE2-OE1 3.06Å; Q51-E55 WeakPolarHBondContact O-CG 3.41Å; Q51-E55 PolarHBondContact O-N 3.03Å; Q52-E55 PolarHBondContact O-N 3.29Å; E55-F57 VanDerWaalsContact C-N 3.32Å; E55-C58 PolarHBondContact O-N 3.05Å; E55-K59 WeakPolarHBondContact O-CG 3.41Å; E55-K59 PolarHBondContact O-N 3.01Å
56	A	97.1	Very high	91.3	Very high	57 Å²	57	107.9 Å²	107.9	47%	0.471	55%	0.551	S	S	.	*	H	α-helix	trans	-61	-43.6	174.5	0	0	0	0	0	111.1	Q52 Q53 F54 K59 Q60	Q52-A56 WeakPolarHBondContact O-CB 3.41Å; Q52-A56 PolarHBondContact O-N 2.9Å; Q53-A56 PolarHBondContact O-N 3.36Å; F54-A56 VanDerWaalsContact C-N 3.34Å; F54-A56 PolarHBondContact O-N 3.36Å; A56-K59 PolarHBondContact O-N 2.96Å; A56-Q60 PolarHBondContact O-N 3.33Å
57	F	96.4	Very high	90.9	Very high	117 Å²	117	108.3 Å²	108.3	51%	0.513	55%	0.554	S	S	.	*	H	α-helix	trans	-61.1	-46.8	175.6	175.7	-97.8	0	0	0	112.2	Q53 F54 E55 K59 Q60 M61	Q53-F57 WeakPolarHBondContact O-CB 3.47Å; Q53-F57 PolarHBondContact O-N 3.49Å; F54-F57 WeakPolarHBondContact O-CB 3.47Å; F54-F57 PolarHBondContact O-N 3.16Å; E55-F57 VanDerWaalsContact C-N 3.32Å; F57-K59 PolarHBondContact O-N 2.91Å; F57-Q60 PolarHBondContact O-N 3.27Å; F57-M61 HydrophobicContact CE1-CG 4.04Å; F57-M61 HydrophobicContact CE1-SD 4.25Å; F57-M61 HydrophobicContact CE2-CG 4.32Å; F57-M61 HydrophobicContact CZ-CG 3.92Å; F57-M61 HydrophobicContact CZ-SD 3.86Å; F57-M61 PolarHBondContact O-N 3.11Å; F57-M61 VanDerWaalsContact O-N 3.08Å
58	C	96.3	Very high	90.5	Very high	41 Å²	41	109.3 Å²	109.3	28%	0.277	55%	0.554	S	S	.	*	H	α-helix	trans	-60.2	-44.1	177.1	-72	0	0	0	0	112.5	F54 E55 Q60 M61 Q62	F54-C58 VanDerWaalsContact CZ-SG 3.51Å; F54-C58 PolarHBondContact O-N 2.88Å; F54-C58 PolarHBondContact O-SG 3.43Å; E55-C58 PolarHBondContact O-N 3.05Å; C58-Q60 VanDerWaalsContact C-N 3.33Å; C58-Q60 PolarHBondContact O-N 3.48Å; C58-M61 PolarHBondContact O-N 2.83Å; C58-Q62 WeakPolarHBondContact O-CG 3.31Å; C58-Q62 PolarHBondContact O-N 2.82Å
59	K	95.4	Very high	90	Very high	135 Å²	135	110.3 Å²	110.3	59%	0.587	56%	0.561	S	S	*	*	H	α-helix	trans	-61.6	-41.5	177.5	-73.8	172.9	-176.8	173.2	0	111.8	E55 A56 F57 M61 Q62 S63	E55-K59 WeakPolarHBondContact O-CG 3.41Å; E55-K59 PolarHBondContact O-N 3.01Å; A56-K59 PolarHBondContact O-N 2.96Å; F57-K59 PolarHBondContact O-N 2.91Å; K59-M61 VanDerWaalsContact C-N 3.35Å; K59-M61 PolarHBondContact O-N 3.39Å; K59-Q62 PolarHBondContact O-N 3.4Å; K59-S63 PolarHBondContact O-N 3.17Å; K59-S63 PolarHBondContact O-OG 3.35Å
60	Q	94.4	Very high	89.5	Confident	118 Å²	118	112.4 Å²	112.4	55%	0.551	57%	0.572	S	S	*	*	H	α-helix	trans	-61	-43.9	176.4	-176.9	179.6	-25.9	0	0	111.5	A56 F57 C58 S63 Q64	A56-Q60 PolarHBondContact O-N 3.33Å; F57-Q60 PolarHBondContact O-N 3.27Å; C58-Q60 VanDerWaalsContact C-N 3.33Å; C58-Q60 PolarHBondContact O-N 3.48Å; Q60-S63 PolarHBondContact O-N 2.9Å; Q60-S63 PolarHBondContact O-OG 3.37Å; Q60-Q64 PolarHBondContact O-N 3.45Å
61	M	91.6	Very high	89	Confident	101 Å²	101	111.1 Å²	111.1	50%	0.498	57%	0.568	S	S	.	*	H	α-helix	trans	-64.5	-39.5	177.3	-69.6	-116	69.8	0	0	112.6	F57 C58 K59 Q64	F57-M61 HydrophobicContact CE1-CG 4.04Å; F57-M61 HydrophobicContact CE1-SD 4.25Å; F57-M61 HydrophobicContact CE2-CG 4.32Å; F57-M61 HydrophobicContact CZ-CG 3.92Å; F57-M61 HydrophobicContact CZ-SD 3.86Å; F57-M61 PolarHBondContact O-N 3.11Å; F57-M61 VanDerWaalsContact O-N 3.08Å; C58-M61 PolarHBondContact O-N 2.83Å; K59-M61 VanDerWaalsContact C-N 3.35Å; K59-M61 PolarHBondContact O-N 3.39Å; M61-Q64 PolarHBondContact O-N 3.1Å
62	Q	88.2	Confident	88.3	Confident	143 Å²	143	112.1 Å²	112.1	67%	0.668	58%	0.576	S	S	*	*	H	α-helix	trans	-65.6	-40.1	177.9	-73.2	174.4	-19.9	0	0	112.1	C58 K59 Q64 G65	C58-Q62 WeakPolarHBondContact O-CG 3.31Å; C58-Q62 PolarHBondContact O-N 2.82Å; K59-Q62 PolarHBondContact O-N 3.4Å; Q62-Q64 PolarHBondContact O-N 2.79Å; Q62-G65 PolarHBondContact O-N 3.18Å; Q62-G65 VanDerWaalsContact O-N 3.15Å
63	S	80.4	Confident	87.6	Confident	75 Å²	75	111.1 Å²	111.1	52%	0.524	58%	0.576	S	S	.	*	H	α-helix	trans	-67.3	-15.5	177.8	67.1	0	0	0	0	115	K59 Q60	K59-S63 PolarHBondContact O-N 3.17Å; K59-S63 PolarHBondContact O-OG 3.35Å; Q60-S63 PolarHBondContact O-N 2.9Å; Q60-S63 PolarHBondContact O-OG 3.37Å
64	Q	74.8	Confident	86.8	Confident	134 Å²	134	110.4 Å²	110.4	63%	0.626	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	-11.1	175.3	-70.8	-175.8	-1.7	0	0	113.2	Q60 M61 Q62	Q60-Q64 PolarHBondContact O-N 3.45Å; M61-Q64 PolarHBondContact O-N 3.1Å; Q62-Q64 PolarHBondContact O-N 2.79Å
65	G	66.3	Low	85.8	Confident	73 Å²	73	109.6 Å²	109.6	75%	0.753	58%	0.581	S	S	*	*			trans	-97.5	-7.3	-178.8	0	0	0	0	0	115	Q62	Q62-G65 PolarHBondContact O-N 3.18Å; Q62-G65 VanDerWaalsContact O-N 3.15Å
66	E	51.7	Low	84.8	Confident	235 Å²	235	111.7 Å²	111.7	100%	1.098	60%	0.597	S	S	*	*			trans	-92.8	0	167.3	-69.2	-174.7	137.8	0	0	110.5

Retrieved 66 of 66 residues in 14.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).