A0A087XGE4_POEFO Loading...

Anaphase-promoting complex subunit 16

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins.

AlphaFold DB , UniProt , Accession A0A087XGE4, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 108 aa.

						>A0A087XGE4_POEFO|A0A087XGE4
MAASSSSSSAGGVSGSSVTGSGFSASELIPPRKVLYTYPKGAGEMMEDGSDRFLCESVFSYQVASTLKQVKQDQQASRMEKLASLVEELEADEWRYKPIEQLLGFTPS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.7	Very low	44.1	Very low	250 Å²	250	122.6 Å²	122.6	100%	1.232	87%	0.872	S	S	*	*				0	129.3	0	-79.8	-177.3	165.3	0	0	108.1
2	A	46.9	Very low	44.2	Very low	104 Å²	104	118.6 Å²	118.6	86%	0.86	86%	0.863	S	S	*	*			trans	-89.1	141.6	168.8	0	0	0	0	0	109.1
3	A	43.1	Very low	43.8	Very low	105 Å²	105	120.7 Å²	120.7	87%	0.868	87%	0.865	S	S	*	*			trans	-156.2	103.7	151	0	0	0	0	0	108.2
4	S	39.2	Very low	43.8	Very low	113 Å²	113	120.7 Å²	120.7	79%	0.79	86%	0.864	S	S	*	*			trans	-79.2	145.1	161.2	-52.3	0	0	0	0	109.3
5	S	37.7	Very low	44.2	Very low	108 Å²	108	117.9 Å²	117.9	76%	0.755	86%	0.86	S	S	*	*			trans	170.4	108.2	136.6	48.7	0	0	0	0	108.7
6	S	42	Very low	44.2	Very low	118 Å²	118	117.6 Å²	117.6	83%	0.825	86%	0.855	S	S	*	*				71.8	114.7	87.7	-53.6	0	0	0	0	113.6
7	S	44.6	Very low	44.3	Very low	117 Å²	117	115.8 Å²	115.8	82%	0.818	84%	0.841	S	S	*	*				178.2	123.2	116.6	58.1	0	0	0	0	112.5
8	S	48.5	Very low	44.3	Very low	122 Å²	122	117.3 Å²	117.3	85%	0.853	84%	0.843	S	S	*	*			trans	-62.3	148	160.4	-24.7	0	0	0	0	111.3
9	S	46.8	Very low	44.5	Very low	122 Å²	122	117.7 Å²	117.7	85%	0.853	84%	0.839	S	S	*	*			trans	-146.6	100.7	156.1	46	0	0	0	0	110.3
10	A	49.3	Very low	44.7	Very low	106 Å²	106	115.6 Å²	115.6	88%	0.876	84%	0.835	S	S	*	*			trans	-79.8	151	157.5	0	0	0	0	0	109.2
11	G	41.9	Very low	45.1	Very low	84 Å²	84	115.6 Å²	115.6	87%	0.866	83%	0.834	S	S	*	*			trans	132.5	121.5	156.1	0	0	0	0	0	114.1
12	G	45.3	Very low	45.1	Very low	74 Å²	74	107.4 Å²	107.4	76%	0.763	81%	0.813	S	S	*	*			trans	139.1	59	159.8	0	0	0	0	0	114.5	S14	G12-S14 PolarHBondContact O-N 3.5Å
13	V	39.9	Very low	44.8	Very low	146 Å²	146	111.5 Å²	111.5	89%	0.885	81%	0.812	S	S	*	*			trans	-71.3	105.1	157.7	-51.4	0	0	0	0	106.1	G15	V13-G15 PolarHBondContact O-N 2.84Å
14	S	43.3	Very low	44.8	Very low	121 Å²	121	111.7 Å²	111.7	85%	0.846	81%	0.807	S	S	*	*			trans	-77.9	103.4	166.8	-80	0	0	0	0	107.1	G12 S16	G12-S14 PolarHBondContact O-N 3.5Å; S14-S16 PolarHBondContact O-N 3.06Å; S14-S16 VanDerWaalsContact O-N 3.08Å
15	G	49.9	Very low	45.2	Very low	78 Å²	78	109.4 Å²	109.4	80%	0.804	80%	0.795	S	S	*	*			trans	-60.2	107.9	170.8	0	0	0	0	0	109.4	V13	V13-G15 PolarHBondContact O-N 2.84Å
16	S	44.8	Very low	45.8	Very low	113 Å²	113	109.7 Å²	109.7	79%	0.79	80%	0.797	S	S	*	*			trans	-90	113.6	155.9	-163.4	0	0	0	0	107	S14 V18	S14-S16 PolarHBondContact O-N 3.06Å; S14-S16 VanDerWaalsContact O-N 3.08Å; S16-V18 PolarHBondContact O-N 3.29Å
17	S	45.1	Very low	46	Very low	88 Å²	88	112.3 Å²	112.3	62%	0.615	80%	0.796	S	S	*	*			trans	-20.4	119.9	169.6	37.6	0	0	0	0	114.8	T19	S17-T19 PolarHBondContact O-N 2.91Å
18	V	45.1	Very low	46.6	Very low	143 Å²	143	115.3 Å²	115.3	87%	0.867	80%	0.802	S	S	*	*			trans	-49.2	103.8	150.7	18.3	0	0	0	0	108.1	S16	S16-V18 PolarHBondContact O-N 3.29Å
19	T	48.2	Very low	46.5	Very low	125 Å²	125	115.8 Å²	115.8	77%	0.767	79%	0.794	S	S	*	*			trans	-104.7	103.6	155.2	56.9	0	0	0	0	105.9	S17 S21	S17-T19 PolarHBondContact O-N 2.91Å; T19-S21 PolarHBondContact O-N 3.49Å
20	G	48.5	Very low	46.4	Very low	74 Å²	74	114.7 Å²	114.7	76%	0.763	78%	0.784	S	S	*	*			trans	-62.7	132.8	174.3	0	0	0	0	0	110.6
21	S	51.9	Low	46.4	Very low	116 Å²	116	115.9 Å²	115.9	81%	0.811	78%	0.783	S	S	*	*			trans	-155.4	118.2	147.6	73.3	0	0	0	0	110	T19	T19-S21 PolarHBondContact O-N 3.49Å
22	G	45.5	Very low	47.3	Very low	78 Å²	78	122 Å²	122	80%	0.804	78%	0.779	S	S	*	*			trans	74.7	95.7	144	0	0	0	0	0	116.9	S24	G22-S24 PolarHBondContact O-N 3.25Å
23	F	41.2	Very low	47.7	Very low	191 Å²	191	127.2 Å²	127.2	84%	0.838	78%	0.781	S	S	*	*			trans	-49.2	128.1	145.3	-180	-91.2	0	0	0	110.3	A25	F23-A25 HydrophobicContact CZ-CB 4.23Å
24	S	42.8	Very low	48.3	Very low	108 Å²	108	127.3 Å²	127.3	76%	0.755	78%	0.782	S	S	*	*			trans	-155.1	96.6	139.1	-146.9	0	0	0	0	109.7	G22	G22-S24 PolarHBondContact O-N 3.25Å
25	A	45.9	Very low	48.8	Very low	66 Å²	66	128.5 Å²	128.5	55%	0.545	78%	0.778	S	S	.	*			trans	-63.9	142.1	157.7	0	0	0	0	0	108.4	F23	F23-A25 HydrophobicContact CZ-CB 4.23Å
26	S	51.4	Low	48.7	Very low	114 Å²	114	134.7 Å²	134.7	80%	0.797	78%	0.779	S	S	*	*			trans	80.7	88.5	173	-50.8	0	0	0	0	116.1
27	E	46.5	Very low	49.3	Very low	172 Å²	172	135.6 Å²	135.6	80%	0.804	78%	0.779	S	S	*	*			trans	-150.4	113.4	132.2	-145.1	154.3	-172.6	0	0	110.4	I29	E27-I29 VanDerWaalsContact C-N 3.3Å; E27-I29 HydrophobicContact CB-CD1 4.44Å; E27-I29 HydrophobicContact CB-CG1 4.31Å; E27-I29 HydrophobicContact CG-CG1 4.42Å; E27-I29 PolarHBondContact O-N 3.23Å
28	L	56	Low	49.2	Very low	180 Å²	180	138.2 Å²	138.2	94%	0.942	78%	0.777	S	S	*	*			trans	-63.7	87.8	171	-81.8	152.8	0	0	0	108.8	P30	L28-P30 WeakPolarHBondContact O-CD 3.27Å
29	I	46.8	Very low	49.5	Very low	133 Å²	133	136.4 Å²	136.4	68%	0.682	77%	0.768	S	S	*	*			trans	-97.8	114.7	172.6	-59.8	165.7	0	0	0	107.7	E27	E27-I29 VanDerWaalsContact C-N 3.3Å; E27-I29 HydrophobicContact CB-CD1 4.44Å; E27-I29 HydrophobicContact CB-CG1 4.31Å; E27-I29 HydrophobicContact CG-CG1 4.42Å; E27-I29 PolarHBondContact O-N 3.23Å
30	P	44.1	Very low	50.1	Low	99 Å²	99	140.2 Å²	140.2	64%	0.643	77%	0.774	S	S	*	*			trans	-53.9	144.3	175.5	-26.3	34.9	0	0	0	111.4	L28 R32	L28-P30 WeakPolarHBondContact O-CD 3.27Å; P30-R32 PolarHBondContact O-N 3.49Å
31	P	50.2	Low	50.4	Low	131 Å²	131	140.4 Å²	140.4	85%	0.851	78%	0.776	S	S	*	*	S	Bend	trans	-78.4	66.3	-170	33.4	-35.7	0	0	0	110.7
32	R	60.2	Low	50.5	Low	211 Å²	211	138.3 Å²	138.3	80%	0.796	77%	0.765	S	S	*	*			trans	-151.5	81.1	174.5	-70.7	-166.4	170.8	112.1	0	109.6	P30	P30-R32 PolarHBondContact O-N 3.49Å
33	K	53.8	Low	51	Low	185 Å²	185	137.1 Å²	137.1	80%	0.804	75%	0.754	S	S	*	*			trans	163.3	59.8	140.3	-70.9	-22.8	159.9	165.7	0	109.7	L35	K33-L35 PolarHBondContact O-N 2.78Å
34	V	52.8	Low	51.6	Low	148 Å²	148	137.1 Å²	137.1	90%	0.897	76%	0.756	S	S	*	*			trans	-86	103.7	153.5	169.1	0	0	0	0	105.2	Y36	V34-Y36 PolarHBondContact O-N 3.48Å
35	L	54.4	Low	52.1	Low	146 Å²	146	141 Å²	141	76%	0.764	77%	0.765	S	S	*	*			trans	-53.5	120.5	175.3	-69.3	163.3	0	0	0	108.4	K33 T37	K33-L35 PolarHBondContact O-N 2.78Å; L35-T37 VanDerWaalsContact C-N 3.3Å; L35-T37 PolarHBondContact O-N 3.42Å; L35-T37 PolarHBondContact O-OG1 3.39Å
36	Y	48.3	Very low	52.6	Low	208 Å²	208	144.5 Å²	144.5	82%	0.816	77%	0.771	S	S	*	*			trans	-56.2	93.6	169.3	-169.8	-94.7	0	0	0	108.4	V34 Y38	V34-Y36 PolarHBondContact O-N 3.48Å; Y36-Y38 HydrophobicContact CE1-CD2 4.1Å; Y36-Y38 PolarHBondContact O-N 3.11Å
37	T	57.2	Low	52.8	Low	131 Å²	131	145.7 Å²	145.7	80%	0.804	76%	0.764	S	S	*	*			trans	-86.3	94	172.7	11	0	0	0	0	106.6	L35 P39	L35-T37 VanDerWaalsContact C-N 3.3Å; L35-T37 PolarHBondContact O-N 3.42Å; L35-T37 PolarHBondContact O-OG1 3.39Å; T37-P39 WeakPolarHBondContact O-CD 3.41Å
38	Y	42.5	Very low	53.5	Low	144 Å²	144	145.2 Å²	145.2	57%	0.565	77%	0.767	S	S	*	*			trans	-60.9	118.2	172	-177.2	-97.2	0	0	0	108.8	Y36 K40	Y36-Y38 HydrophobicContact CE1-CD2 4.1Å; Y36-Y38 PolarHBondContact O-N 3.11Å; Y38-K40 PolarHBondContact O-N 3.22Å
39	P	51.7	Low	53.9	Low	105 Å²	105	139 Å²	139	68%	0.682	75%	0.747	S	S	*	*			trans	-64.5	111.1	176.1	24.4	-29.9	0	0	0	108.6	T37 G41	T37-P39 WeakPolarHBondContact O-CD 3.41Å; P39-G41 PolarHBondContact O-N 3.15Å; P39-G41 VanDerWaalsContact O-N 3.07Å
40	K	60.9	Low	55.5	Low	205 Å²	205	134.8 Å²	134.8	89%	0.891	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.8	95.4	-179.7	-156.1	114.5	-178.4	175.3	0	108.1	Y38	Y38-K40 PolarHBondContact O-N 3.22Å
41	G	53.8	Low	57.5	Low	78 Å²	78	135.8 Å²	135.8	80%	0.804	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	152.4	20	170.6	0	0	0	0	0	119.3	P39	P39-G41 PolarHBondContact O-N 3.15Å; P39-G41 VanDerWaalsContact O-N 3.07Å
42	A	53.7	Low	59.5	Low	71 Å²	71	139.2 Å²	139.2	59%	0.587	73%	0.725	S	S	*	*			trans	-133.1	35.6	179.1	0	0	0	0	0	113.2	E44	A42-E44 PolarHBondContact O-N 3.05Å
43	G	57.2	Low	61	Low	54 Å²	54	135.9 Å²	135.9	56%	0.557	72%	0.716	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.8	9.6	-170.6	0	0	0	0	0	116.9
44	E	54	Low	62.8	Low	190 Å²	190	132 Å²	132	89%	0.888	70%	0.704	S	S	*	*	T	Hydrogen-bonded Turn	trans	-128.1	9.7	-174.6	-72.7	-156.4	141	0	0	116	A42	A42-E44 PolarHBondContact O-N 3.05Å
45	M	52.5	Low	64.8	Low	190 Å²	190	128.9 Å²	128.9	94%	0.936	69%	0.688	S	S	*	*	S	Bend	trans	-139.9	8.8	178.2	-48.1	-168.7	93.2	0	0	115.9
46	M	55.9	Low	66.8	Low	140 Å²	140	127.3 Å²	127.3	69%	0.69	68%	0.676	S	S	*	*	S	Bend	trans	-120.8	13.6	-169.3	-154.5	175.6	165	0	0	115
47	E	56.3	Low	69	Low	139 Å²	139	119.6 Å²	119.6	65%	0.65	65%	0.653	S	S	*	*	H	α-helix	trans	-97.9	-28.6	-170.6	-65	-66	126.7	0	0	114.1	S50	E47-S50 PolarHBondContact O-OG 2.92Å
48	D	61	Low	71	Confident	162 Å²	162	117.8 Å²	117.8	87%	0.866	64%	0.641	S	S	*	*	H	α-helix	trans	-83.6	-15.4	-177	-85.5	-22.7	0	0	0	114.5
49	G	65.6	Low	73.6	Confident	49 Å²	49	116.8 Å²	116.8	51%	0.505	64%	0.64	S	S	.	*	H	α-helix	trans	-93.6	-31.3	-177	0	0	0	0	0	114.1	F53	G49-F53 VanDerWaalsContact O-CB 3.27Å; G49-F53 WeakPolarHBondContact O-CB 3.5Å; G49-F53 PolarHBondContact O-N 3Å
50	S	79.9	Confident	75.8	Confident	44 Å²	44	114.5 Å²	114.5	31%	0.308	63%	0.627	S	S	.	*	H	α-helix	trans	-69	-46.1	-174.7	46.3	0	0	0	0	112	E47 R52 F53 L54	E47-S50 PolarHBondContact O-OG 2.92Å; S50-R52 PolarHBondContact O-N 3.15Å; S50-F53 PolarHBondContact O-N 2.76Å; S50-L54 WeakPolarHBondContact O-CB 3.43Å; S50-L54 VanDerWaalsContact O-CG 3.29Å; S50-L54 WeakPolarHBondContact O-CG 3.41Å; S50-L54 PolarHBondContact O-N 3.12Å
51	D	86.3	Confident	77.6	Confident	120 Å²	120	113 Å²	113	64%	0.642	62%	0.616	S	S	*	*	H	α-helix	trans	-66.6	-39.7	-179.7	-80.6	4.3	0	0	0	111.6	L54 C55	D51-L54 PolarHBondContact O-N 3.36Å; D51-C55 VanDerWaalsContact O-CB 3.27Å; D51-C55 WeakPolarHBondContact O-CB 3.44Å; D51-C55 PolarHBondContact O-N 3.3Å
52	R	91.2	Very high	79.8	Confident	203 Å²	203	115.6 Å²	115.6	77%	0.766	61%	0.608	S	S	*	*	H	α-helix	trans	-62.9	-43	172.7	-177.6	176.2	175.4	177.4	-0.6	111.6	S50 C55 E56	S50-R52 PolarHBondContact O-N 3.15Å; R52-C55 PolarHBondContact O-N 3.04Å; R52-E56 WeakPolarHBondContact O-CB 3.39Å; R52-E56 PolarHBondContact O-N 2.9Å
53	F	92.6	Very high	81.9	Confident	142 Å²	142	115.5 Å²	115.5	62%	0.623	60%	0.6	S	S	*	*	H	α-helix	trans	-67.7	-39.8	178.6	-179.3	-94.8	0	0	0	112.4	G49 S50 E56 S57	G49-F53 VanDerWaalsContact O-CB 3.27Å; G49-F53 WeakPolarHBondContact O-CB 3.5Å; G49-F53 PolarHBondContact O-N 3Å; S50-F53 PolarHBondContact O-N 2.76Å; F53-E56 PolarHBondContact O-N 3.39Å; F53-S57 WeakPolarHBondContact CE1-OG 3.32Å; F53-S57 VanDerWaalsContact O-CB 3.27Å; F53-S57 WeakPolarHBondContact O-CB 3.46Å; F53-S57 PolarHBondContact O-N 3.1Å; F53-S57 PolarHBondContact O-OG 3.23Å
54	L	92.1	Very high	83.9	Confident	104 Å²	104	115.6 Å²	115.6	55%	0.545	60%	0.596	S	S	.	*	H	α-helix	trans	-63.4	-45.6	174.8	-72.9	174.9	0	0	0	110.7	S50 D51 E56 S57 V58	S50-L54 WeakPolarHBondContact O-CB 3.43Å; S50-L54 VanDerWaalsContact O-CG 3.29Å; S50-L54 WeakPolarHBondContact O-CG 3.41Å; S50-L54 PolarHBondContact O-N 3.12Å; D51-L54 PolarHBondContact O-N 3.36Å; L54-E56 PolarHBondContact O-N 3.34Å; L54-S57 PolarHBondContact O-N 3.1Å; L54-V58 WeakPolarHBondContact O-CG1 3.49Å; L54-V58 WeakPolarHBondContact O-CG2 3.42Å; L54-V58 PolarHBondContact O-N 3.43Å
55	C	94	Very high	86	Confident	82 Å²	82	109.3 Å²	109.3	55%	0.554	57%	0.572	S	S	*	*	H	α-helix	trans	-57.1	-48	174.5	-171.8	0	0	0	0	111.6	D51 R52 S57 V58 F59	D51-C55 VanDerWaalsContact O-CB 3.27Å; D51-C55 WeakPolarHBondContact O-CB 3.44Å; D51-C55 PolarHBondContact O-N 3.3Å; R52-C55 PolarHBondContact O-N 3.04Å; C55-S57 VanDerWaalsContact C-N 3.32Å; C55-S57 PolarHBondContact O-N 3.39Å; C55-V58 WeakPolarHBondContact O-CG2 3.47Å; C55-V58 PolarHBondContact O-N 3.19Å; C55-F59 VanDerWaalsContact O-CB 3.29Å; C55-F59 WeakPolarHBondContact O-CB 3.46Å; C55-F59 PolarHBondContact O-N 3.16Å
56	E	95.9	Very high	88.2	Confident	113 Å²	113	104 Å²	104	53%	0.528	55%	0.55	S	S	.	*	H	α-helix	trans	-63.5	-37.9	177.2	-172.6	66.6	-175.5	0	0	112.3	R52 F53 L54 F59 S60	R52-E56 WeakPolarHBondContact O-CB 3.39Å; R52-E56 PolarHBondContact O-N 2.9Å; F53-E56 PolarHBondContact O-N 3.39Å; L54-E56 PolarHBondContact O-N 3.34Å; E56-F59 PolarHBondContact O-N 3.34Å; E56-S60 VanDerWaalsContact O-CB 3.22Å; E56-S60 WeakPolarHBondContact O-CB 3.33Å; E56-S60 PolarHBondContact O-N 3.2Å; E56-S60 PolarHBondContact O-OG 3.21Å
57	S	95.7	Very high	90.2	Very high	46 Å²	46	101.7 Å²	101.7	32%	0.322	54%	0.541	S	S	.	.	H	α-helix	trans	-68.4	-45.3	-179.9	-63.6	0	0	0	0	111.7	F53 L54 C55 F59 S60 Y61	F53-S57 WeakPolarHBondContact CE1-OG 3.32Å; F53-S57 VanDerWaalsContact O-CB 3.27Å; F53-S57 WeakPolarHBondContact O-CB 3.46Å; F53-S57 PolarHBondContact O-N 3.1Å; F53-S57 PolarHBondContact O-OG 3.23Å; L54-S57 PolarHBondContact O-N 3.1Å; C55-S57 VanDerWaalsContact C-N 3.32Å; C55-S57 PolarHBondContact O-N 3.39Å; S57-F59 VanDerWaalsContact C-N 3.33Å; S57-S60 PolarHBondContact O-N 3.16Å; S57-Y61 WeakPolarHBondContact O-CB 3.41Å; S57-Y61 PolarHBondContact O-N 3.26Å
58	V	97.7	Very high	92.3	Very high	92 Å²	92	102.3 Å²	102.3	56%	0.558	54%	0.541	S	S	*	.	H	α-helix	trans	-67.6	-37.2	176.5	-61.1	0	0	0	0	111.2	L54 C55 Y61 Q62	L54-V58 WeakPolarHBondContact O-CG1 3.49Å; L54-V58 WeakPolarHBondContact O-CG2 3.42Å; L54-V58 PolarHBondContact O-N 3.43Å; C55-V58 WeakPolarHBondContact O-CG2 3.47Å; C55-V58 PolarHBondContact O-N 3.19Å; V58-Y61 PolarHBondContact O-N 2.79Å; V58-Q62 WeakPolarHBondContact O-CB 3.46Å; V58-Q62 PolarHBondContact O-N 3.38Å
59	F	98.3	Very high	94	Very high	124 Å²	124	99 Å²	99	54%	0.544	52%	0.521	S	S	.	.	H	α-helix	trans	-62.1	-50.3	174	177.7	-100.6	0	0	0	111.4	C55 E56 S57 Y61 Q62 V63	C55-F59 VanDerWaalsContact O-CB 3.29Å; C55-F59 WeakPolarHBondContact O-CB 3.46Å; C55-F59 PolarHBondContact O-N 3.16Å; E56-F59 PolarHBondContact O-N 3.34Å; S57-F59 VanDerWaalsContact C-N 3.33Å; F59-Y61 VanDerWaalsContact C-N 3.31Å; F59-Y61 PolarHBondContact O-N 3.28Å; F59-Q62 WeakPolarHBondContact O-CB 3.45Å; F59-Q62 PolarHBondContact O-N 3.05Å; F59-Q62 VanDerWaalsContact O-N 3.1Å; F59-V63 HydrophobicContact CD1-CG2 4.3Å; F59-V63 HydrophobicContact CE1-CG2 3.84Å; F59-V63 HydrophobicContact CE2-CG2 4.11Å; F59-V63 HydrophobicContact CZ-CG2 3.73Å; F59-V63 WeakPolarHBondContact O-CG2 3.38Å; F59-V63 PolarHBondContact O-N 3.43Å
60	S	98.2	Very high	95.6	Very high	57 Å²	57	101 Å²	101	40%	0.399	52%	0.523	S	S	.	.	H	α-helix	trans	-59.5	-42.4	178.1	-65.7	0	0	0	0	111.8	E56 S57 V63 A64	E56-S60 VanDerWaalsContact O-CB 3.22Å; E56-S60 WeakPolarHBondContact O-CB 3.33Å; E56-S60 PolarHBondContact O-N 3.2Å; E56-S60 PolarHBondContact O-OG 3.21Å; S57-S60 PolarHBondContact O-N 3.16Å; S60-V63 PolarHBondContact O-N 2.85Å; S60-A64 WeakPolarHBondContact O-CB 3.39Å; S60-A64 PolarHBondContact O-N 3.5Å
61	Y	98.3	Very high	96.5	Very high	172 Å²	172	105 Å²	105	68%	0.675	53%	0.534	S	S	*	.	H	α-helix	trans	-61.3	-44.8	174.3	175	-101.7	0	0	0	111.7	S57 V58 F59 V63 A64 S65	S57-Y61 WeakPolarHBondContact O-CB 3.41Å; S57-Y61 PolarHBondContact O-N 3.26Å; V58-Y61 PolarHBondContact O-N 2.79Å; F59-Y61 VanDerWaalsContact C-N 3.31Å; F59-Y61 PolarHBondContact O-N 3.28Å; Y61-V63 PolarHBondContact O-N 3.37Å; Y61-A64 PolarHBondContact O-N 3.08Å; Y61-S65 WeakPolarHBondContact O-CB 3.49Å; Y61-S65 PolarHBondContact O-N 3.32Å
62	Q	98.6	Very high	97.1	Very high	133 Å²	133	104.8 Å²	104.8	62%	0.621	53%	0.53	S	S	*	.	H	α-helix	trans	-62.1	-44.8	179.2	-167.6	124	23.9	0	0	111.4	V58 F59 S65 T66	V58-Q62 WeakPolarHBondContact O-CB 3.46Å; V58-Q62 PolarHBondContact O-N 3.38Å; F59-Q62 WeakPolarHBondContact O-CB 3.45Å; F59-Q62 PolarHBondContact O-N 3.05Å; F59-Q62 VanDerWaalsContact O-N 3.1Å; Q62-S65 PolarHBondContact O-N 3.05Å; Q62-T66 WeakPolarHBondContact O-CG2 3.38Å; Q62-T66 PolarHBondContact O-N 3.41Å; Q62-T66 PolarHBondContact O-OG1 3.14Å
63	V	98.8	Very high	97.5	Very high	69 Å²	69	99 Å²	99	42%	0.418	51%	0.514	S	S	.	.	H	α-helix	trans	-63.1	-42.8	175.4	174.1	0	0	0	0	111.5	F59 S60 Y61 S65 T66 L67	F59-V63 HydrophobicContact CD1-CG2 4.3Å; F59-V63 HydrophobicContact CE1-CG2 3.84Å; F59-V63 HydrophobicContact CE2-CG2 4.11Å; F59-V63 HydrophobicContact CZ-CG2 3.73Å; F59-V63 WeakPolarHBondContact O-CG2 3.38Å; F59-V63 PolarHBondContact O-N 3.43Å; S60-V63 PolarHBondContact O-N 2.85Å; Y61-V63 PolarHBondContact O-N 3.37Å; V63-S65 VanDerWaalsContact C-N 3.31Å; V63-S65 PolarHBondContact O-N 3.15Å; V63-T66 WeakPolarHBondContact CA-OG1 3.48Å; V63-T66 PolarHBondContact O-N 3.07Å; V63-T66 PolarHBondContact O-OG1 2.94Å; V63-L67 VanDerWaalsContact O-CB 3.3Å; V63-L67 WeakPolarHBondContact O-CB 3.32Å; V63-L67 PolarHBondContact O-N 3.4Å
64	A	98.6	Very high	97.8	Very high	57 Å²	57	97.5 Å²	97.5	47%	0.471	51%	0.509	S	S	.	.	H	α-helix	trans	-63.2	-40.1	176.6	0	0	0	0	0	111.6	S60 Y61 L67 K68	S60-A64 WeakPolarHBondContact O-CB 3.39Å; S60-A64 PolarHBondContact O-N 3.5Å; Y61-A64 PolarHBondContact O-N 3.08Å; A64-L67 PolarHBondContact O-N 3.21Å; A64-K68 WeakPolarHBondContact O-CB 3.5Å; A64-K68 PolarHBondContact O-N 3.29Å
65	S	98.6	Very high	98.1	Very high	57 Å²	57	96.8 Å²	96.8	40%	0.399	50%	0.503	S	S	.	.	H	α-helix	trans	-65.4	-45.7	177	-172.6	0	0	0	0	111.8	Y61 Q62 V63 K68 Q69	Y61-S65 WeakPolarHBondContact O-CB 3.49Å; Y61-S65 PolarHBondContact O-N 3.32Å; Q62-S65 PolarHBondContact O-N 3.05Å; V63-S65 VanDerWaalsContact C-N 3.31Å; V63-S65 PolarHBondContact O-N 3.15Å; S65-K68 WeakPolarHBondContact O-CB 3.49Å; S65-K68 PolarHBondContact O-N 2.86Å; S65-Q69 PolarHBondContact O-N 3.48Å
66	T	98.6	Very high	98.3	Very high	78 Å²	78	95.5 Å²	95.5	48%	0.479	50%	0.498	S	S	.	.	H	α-helix	trans	-65.7	-39.6	177	55.3	0	0	0	0	111.4	Q62 V63 K68 Q69 V70	Q62-T66 WeakPolarHBondContact O-CG2 3.38Å; Q62-T66 PolarHBondContact O-N 3.41Å; Q62-T66 PolarHBondContact O-OG1 3.14Å; V63-T66 WeakPolarHBondContact CA-OG1 3.48Å; V63-T66 PolarHBondContact O-N 3.07Å; V63-T66 PolarHBondContact O-OG1 2.94Å; T66-K68 VanDerWaalsContact C-N 3.32Å; T66-K68 PolarHBondContact O-N 3.28Å; T66-Q69 WeakPolarHBondContact O-CB 3.48Å; T66-Q69 PolarHBondContact O-N 3.09Å; T66-V70 WeakPolarHBondContact O-CG2 3.45Å; T66-V70 PolarHBondContact O-N 3.38Å
67	L	98.8	Very high	98.4	Very high	92 Å²	92	92.5 Å²	92.5	48%	0.482	49%	0.489	S	S	.	.	H	α-helix	trans	-60.8	-41.8	174.3	-179.4	62.5	0	0	0	111.8	V63 A64 K71	V63-L67 VanDerWaalsContact O-CB 3.3Å; V63-L67 WeakPolarHBondContact O-CB 3.32Å; V63-L67 PolarHBondContact O-N 3.4Å; A64-L67 PolarHBondContact O-N 3.21Å; L67-K71 WeakPolarHBondContact O-CG 3.39Å; L67-K71 PolarHBondContact O-N 3.05Å
68	K	98.7	Very high	98.6	Very high	153 Å²	153	96 Å²	96	67%	0.665	50%	0.496	S	S	*	.	H	α-helix	trans	-61.1	-45.7	175.1	-175.4	-177	176.3	-174.3	0	110.9	A64 S65 T66 K71 Q72	A64-K68 WeakPolarHBondContact O-CB 3.5Å; A64-K68 PolarHBondContact O-N 3.29Å; S65-K68 WeakPolarHBondContact O-CB 3.49Å; S65-K68 PolarHBondContact O-N 2.86Å; T66-K68 VanDerWaalsContact C-N 3.32Å; T66-K68 PolarHBondContact O-N 3.28Å; K68-K71 PolarHBondContact O-N 2.84Å; K68-Q72 PolarHBondContact O-N 2.94Å
69	Q	98.6	Very high	98.6	Very high	92 Å²	92	96.6 Å²	96.6	43%	0.43	49%	0.494	S	S	.	.	H	α-helix	trans	-60.1	-50.6	177.9	-174.2	61	39.2	0	0	111.5	S65 T66 K71 Q72 D73	S65-Q69 PolarHBondContact O-N 3.48Å; T66-Q69 WeakPolarHBondContact O-CB 3.48Å; T66-Q69 PolarHBondContact O-N 3.09Å; Q69-K71 VanDerWaalsContact C-N 3.29Å; Q69-K71 PolarHBondContact O-N 3.28Å; Q69-Q72 WeakPolarHBondContact O-CB 3.48Å; Q69-Q72 PolarHBondContact O-N 3.42Å; Q69-D73 PolarHBondContact NE2-OD1 3.02Å; Q69-D73 PolarHBondContact NE2-OD2 3.47Å; Q69-D73 VanDerWaalsContact O-CG 3.31Å; Q69-D73 PolarHBondContact O-N 2.96Å
70	V	98.8	Very high	98.6	Very high	91 Å²	91	97.4 Å²	97.4	55%	0.552	50%	0.499	S	S	*	.	H	α-helix	trans	-58.8	-40.9	179.7	170.2	0	0	0	0	111.7	T66 D73 Q74	T66-V70 WeakPolarHBondContact O-CG2 3.45Å; T66-V70 PolarHBondContact O-N 3.38Å; V70-D73 PolarHBondContact O-N 3.05Å; V70-Q74 WeakPolarHBondContact O-CB 3.3Å; V70-Q74 PolarHBondContact O-N 3.07Å
71	K	98.7	Very high	98.6	Very high	127 Å²	127	101.3 Å²	101.3	55%	0.552	51%	0.509	S	S	*	.	H	α-helix	trans	-63.8	-41.4	176.1	-76.6	-179	177.9	-178.9	0	112.2	L67 K68 Q69 Q75	L67-K71 WeakPolarHBondContact O-CG 3.39Å; L67-K71 PolarHBondContact O-N 3.05Å; K68-K71 PolarHBondContact O-N 2.84Å; Q69-K71 VanDerWaalsContact C-N 3.29Å; Q69-K71 PolarHBondContact O-N 3.28Å; K71-Q75 WeakPolarHBondContact O-CB 3.22Å; K71-Q75 PolarHBondContact O-N 3.47Å
72	Q	98.7	Very high	98.6	Very high	116 Å²	116	98.1 Å²	98.1	54%	0.542	50%	0.503	S	S	.	.	H	α-helix	trans	-64	-46.1	176.9	-177	176.8	-16.2	0	0	111	K68 Q69 Q74 Q75 A76	K68-Q72 PolarHBondContact O-N 2.94Å; Q69-Q72 WeakPolarHBondContact O-CB 3.48Å; Q69-Q72 PolarHBondContact O-N 3.42Å; Q72-Q74 VanDerWaalsContact C-N 3.35Å; Q72-Q74 PolarHBondContact O-N 3.28Å; Q72-Q75 PolarHBondContact O-N 2.91Å; Q72-Q75 VanDerWaalsContact O-N 3.15Å; Q72-A76 WeakPolarHBondContact O-CB 3.45Å; Q72-A76 PolarHBondContact O-N 2.88Å
73	D	98.7	Very high	98.6	Very high	81 Å²	81	94.8 Å²	94.8	43%	0.433	50%	0.498	S	S	.	.	H	α-helix	trans	-65.1	-40.1	179.9	-64.6	-19.6	0	0	0	111.5	Q69 V70 Q75 A76 S77	Q69-D73 PolarHBondContact NE2-OD1 3.02Å; Q69-D73 PolarHBondContact NE2-OD2 3.47Å; Q69-D73 VanDerWaalsContact O-CG 3.31Å; Q69-D73 PolarHBondContact O-N 2.96Å; V70-D73 PolarHBondContact O-N 3.05Å; D73-Q75 VanDerWaalsContact C-N 3.29Å; D73-Q75 PolarHBondContact O-N 3.43Å; D73-A76 PolarHBondContact O-N 2.85Å; D73-S77 WeakPolarHBondContact O-CB 3.43Å; D73-S77 PolarHBondContact O-N 2.81Å
74	Q	98.7	Very high	98.5	Very high	112 Å²	112	94.8 Å²	94.8	52%	0.523	50%	0.501	S	S	.	.	H	α-helix	trans	-62.8	-38.1	174.5	-166.7	-166.6	40.9	0	0	111.8	V70 Q72 R78	V70-Q74 WeakPolarHBondContact O-CB 3.3Å; V70-Q74 PolarHBondContact O-N 3.07Å; Q72-Q74 VanDerWaalsContact C-N 3.35Å; Q72-Q74 PolarHBondContact O-N 3.28Å; Q74-R78 WeakPolarHBondContact O-CB 3.5Å; Q74-R78 WeakPolarHBondContact O-CG 3.41Å; Q74-R78 PolarHBondContact O-N 2.88Å; Q74-R78 VanDerWaalsContact O-N 3.07Å; Q74-R78 PolarHBondContact O-NE 3.45Å
75	Q	98.6	Very high	98.5	Very high	88 Å²	88	96.1 Å²	96.1	41%	0.411	50%	0.5	S	S	.	.	H	α-helix	trans	-70.1	-41.9	176.1	-177.5	63.2	6.2	0	0	111.2	K71 Q72 D73 R78 M79	K71-Q75 WeakPolarHBondContact O-CB 3.22Å; K71-Q75 PolarHBondContact O-N 3.47Å; Q72-Q75 PolarHBondContact O-N 2.91Å; Q72-Q75 VanDerWaalsContact O-N 3.15Å; D73-Q75 VanDerWaalsContact C-N 3.29Å; D73-Q75 PolarHBondContact O-N 3.43Å; Q75-R78 PolarHBondContact O-N 2.89Å; Q75-R78 VanDerWaalsContact OE1-CZ 3.3Å; Q75-R78 VanDerWaalsContact OE1-NH1 3.11Å; Q75-M79 WeakPolarHBondContact O-CG 3.34Å; Q75-M79 PolarHBondContact O-N 3.48Å
76	A	98.6	Very high	98.5	Very high	55 Å²	55	97 Å²	97	46%	0.455	50%	0.502	S	S	.	.	H	α-helix	trans	-60.2	-47	175.8	0	0	0	0	0	111.3	Q72 D73 R78 M79 E80	Q72-A76 WeakPolarHBondContact O-CB 3.45Å; Q72-A76 PolarHBondContact O-N 2.88Å; D73-A76 PolarHBondContact O-N 2.85Å; A76-R78 VanDerWaalsContact C-N 3.33Å; A76-R78 PolarHBondContact O-N 2.84Å; A76-M79 WeakPolarHBondContact O-CB 3.34Å; A76-M79 PolarHBondContact O-N 3.28Å; A76-M79 VanDerWaalsContact O-N 3.14Å; A76-E80 WeakPolarHBondContact O-CB 3.37Å; A76-E80 PolarHBondContact O-N 3.43Å
77	S	98.6	Very high	98.4	Very high	50 Å²	50	99.6 Å²	99.6	35%	0.35	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-37.4	176.7	-179.5	0	0	0	0	112.7	D73 E80 K81	D73-S77 WeakPolarHBondContact O-CB 3.43Å; D73-S77 PolarHBondContact O-N 2.81Å; S77-E80 PolarHBondContact O-N 3.48Å; S77-K81 WeakPolarHBondContact O-CG 3.43Å; S77-K81 PolarHBondContact O-N 3.44Å; S77-K81 VanDerWaalsContact O-N 3.09Å
78	R	98.6	Very high	98.3	Very high	120 Å²	120	100.9 Å²	100.9	45%	0.453	51%	0.513	S	S	.	.	H	α-helix	trans	-62.9	-44.7	172.6	-81.8	-176.9	-89.4	157.8	-13	111.6	Q74 Q75 A76 K81 L82	Q74-R78 WeakPolarHBondContact O-CB 3.5Å; Q74-R78 WeakPolarHBondContact O-CG 3.41Å; Q74-R78 PolarHBondContact O-N 2.88Å; Q74-R78 VanDerWaalsContact O-N 3.07Å; Q74-R78 PolarHBondContact O-NE 3.45Å; Q75-R78 PolarHBondContact O-N 2.89Å; Q75-R78 VanDerWaalsContact OE1-CZ 3.3Å; Q75-R78 VanDerWaalsContact OE1-NH1 3.11Å; A76-R78 VanDerWaalsContact C-N 3.33Å; A76-R78 PolarHBondContact O-N 2.84Å; R78-K81 PolarHBondContact O-N 3.29Å; R78-L82 WeakPolarHBondContact O-CG 3.38Å; R78-L82 PolarHBondContact O-N 3.21Å; R78-L82 VanDerWaalsContact O-N 3.1Å
79	M	98.8	Very high	98.3	Very high	105 Å²	105	99.5 Å²	99.5	52%	0.517	51%	0.512	S	S	.	.	H	α-helix	trans	-64.6	-40	177.6	-73	-60	-56.4	0	0	112.3	Q75 A76 L82 A83	Q75-M79 WeakPolarHBondContact O-CG 3.34Å; Q75-M79 PolarHBondContact O-N 3.48Å; A76-M79 WeakPolarHBondContact O-CB 3.34Å; A76-M79 PolarHBondContact O-N 3.28Å; A76-M79 VanDerWaalsContact O-N 3.14Å; M79-L82 PolarHBondContact O-N 2.86Å; M79-L82 HydrophobicContact SD-CD1 4.45Å; M79-A83 WeakPolarHBondContact O-CB 3.45Å; M79-A83 PolarHBondContact O-N 3.43Å
80	E	98.4	Very high	98.1	Very high	140 Å²	140	100.8 Å²	100.8	65%	0.654	52%	0.518	S	S	*	.	H	α-helix	trans	-60.9	-45.7	176.3	-175.9	-179	-171.6	0	0	111.6	A76 S77 L82 A83 S84	A76-E80 WeakPolarHBondContact O-CB 3.37Å; A76-E80 PolarHBondContact O-N 3.43Å; S77-E80 PolarHBondContact O-N 3.48Å; E80-L82 VanDerWaalsContact C-N 3.3Å; E80-L82 PolarHBondContact O-N 2.9Å; E80-A83 WeakPolarHBondContact O-CB 3.48Å; E80-A83 PolarHBondContact O-N 2.91Å; E80-A83 VanDerWaalsContact O-N 3.16Å; E80-S84 PolarHBondContact O-N 2.97Å
81	K	98.4	Very high	98	Very high	139 Å²	139	99.6 Å²	99.6	60%	0.604	52%	0.518	S	S	*	.	H	α-helix	trans	-62	-36.9	174.9	-71.6	179.6	-176.9	-174.7	0	113.1	S77 R78 S84	S77-K81 WeakPolarHBondContact O-CG 3.43Å; S77-K81 PolarHBondContact O-N 3.44Å; S77-K81 VanDerWaalsContact O-N 3.09Å; R78-K81 PolarHBondContact O-N 3.29Å; K81-S84 PolarHBondContact O-OG 3.21Å
82	L	98.5	Very high	98	Very high	106 Å²	106	95.8 Å²	95.8	56%	0.555	50%	0.503	S	S	*	.	H	α-helix	trans	-70.2	-37.7	175.3	-69.3	175.4	0	0	0	111.3	R78 M79 E80 S84 L85	R78-L82 WeakPolarHBondContact O-CG 3.38Å; R78-L82 PolarHBondContact O-N 3.21Å; R78-L82 VanDerWaalsContact O-N 3.1Å; M79-L82 PolarHBondContact O-N 2.86Å; M79-L82 HydrophobicContact SD-CD1 4.45Å; E80-L82 VanDerWaalsContact C-N 3.3Å; E80-L82 PolarHBondContact O-N 2.9Å; L82-S84 VanDerWaalsContact C-N 3.32Å; L82-S84 PolarHBondContact O-N 2.94Å; L82-L85 HydrophobicContact CD2-CD1 3.93Å; L82-L85 WeakPolarHBondContact O-CB 3.46Å; L82-L85 PolarHBondContact O-N 3.23Å
83	A	98.3	Very high	97.8	Very high	63 Å²	63	96.8 Å²	96.8	52%	0.521	51%	0.508	S	S	.	.	H	α-helix	trans	-64.5	-37.7	175.9	0	0	0	0	0	111.6	M79 E80 L85 V86	M79-A83 WeakPolarHBondContact O-CB 3.45Å; M79-A83 PolarHBondContact O-N 3.43Å; E80-A83 WeakPolarHBondContact O-CB 3.48Å; E80-A83 PolarHBondContact O-N 2.91Å; E80-A83 VanDerWaalsContact O-N 3.16Å; A83-L85 PolarHBondContact O-N 2.91Å; A83-V86 WeakPolarHBondContact O-CB 3.27Å; A83-V86 WeakPolarHBondContact O-CG2 3.27Å; A83-V86 PolarHBondContact O-N 2.91Å; A83-V86 VanDerWaalsContact O-N 3.16Å
84	S	96.9	Very high	97.7	Very high	68 Å²	68	102.8 Å²	102.8	48%	0.476	53%	0.525	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.8	-16.3	176.2	62.1	0	0	0	0	114.2	E80 K81 L82 V86 E87	E80-S84 PolarHBondContact O-N 2.97Å; K81-S84 PolarHBondContact O-OG 3.21Å; L82-S84 VanDerWaalsContact C-N 3.32Å; L82-S84 PolarHBondContact O-N 2.94Å; S84-V86 PolarHBondContact O-N 2.84Å; S84-E87 PolarHBondContact O-N 2.75Å
85	L	98.3	Very high	97.6	Very high	86 Å²	86	104 Å²	104	45%	0.45	53%	0.525	S	S	.	.	H	α-helix	trans	-66.3	-17.7	174.4	-64.1	175.6	0	0	0	112.7	L82 A83 E87 E88 L89	L82-L85 HydrophobicContact CD2-CD1 3.93Å; L82-L85 WeakPolarHBondContact O-CB 3.46Å; L82-L85 PolarHBondContact O-N 3.23Å; A83-L85 PolarHBondContact O-N 2.91Å; L85-E87 VanDerWaalsContact C-N 3.35Å; L85-E88 PolarHBondContact O-N 3.46Å; L85-L89 WeakPolarHBondContact O-CB 3.39Å; L85-L89 PolarHBondContact O-N 2.82Å
86	V	97.8	Very high	97.5	Very high	74 Å²	74	106.8 Å²	106.8	45%	0.448	53%	0.532	S	S	.	.	H	α-helix	trans	-63.1	-44	174	175.5	0	0	0	0	110.5	A83 S84 E88 L89 E90	A83-V86 WeakPolarHBondContact O-CB 3.27Å; A83-V86 WeakPolarHBondContact O-CG2 3.27Å; A83-V86 PolarHBondContact O-N 2.91Å; A83-V86 VanDerWaalsContact O-N 3.16Å; S84-V86 PolarHBondContact O-N 2.84Å; V86-E88 VanDerWaalsContact C-N 3.29Å; V86-E88 PolarHBondContact O-N 2.91Å; V86-L89 WeakPolarHBondContact O-CB 3.45Å; V86-L89 PolarHBondContact O-N 3.48Å; V86-L89 VanDerWaalsContact O-N 3.12Å; V86-E90 HydrophobicContact CG1-CG 4.49Å; V86-E90 WeakPolarHBondContact O-CG 3.4Å; V86-E90 PolarHBondContact O-N 2.94Å
87	E	97.1	Very high	97.3	Very high	133 Å²	133	109.9 Å²	109.9	62%	0.621	54%	0.536	S	S	*	.	H	α-helix	trans	-62.1	-38.4	177.5	-55.5	-67.8	152.2	0	0	111.6	S84 L85 A91	S84-E87 PolarHBondContact O-N 2.75Å; L85-E87 VanDerWaalsContact C-N 3.35Å; E87-A91 WeakPolarHBondContact O-CB 3.42Å; E87-A91 PolarHBondContact O-N 3.4Å
88	E	96.9	Very high	97.1	Very high	119 Å²	119	110.6 Å²	110.6	56%	0.556	54%	0.539	S	S	*	.	H	α-helix	trans	-66.5	-41.3	174.4	-173.3	177.3	166.2	0	0	111.3	L85 V86 A91 D92	L85-E88 PolarHBondContact O-N 3.46Å; V86-E88 VanDerWaalsContact C-N 3.29Å; V86-E88 PolarHBondContact O-N 2.91Å; E88-A91 PolarHBondContact O-N 3.41Å; E88-D92 WeakPolarHBondContact O-CB 3.37Å; E88-D92 PolarHBondContact O-N 3.21Å
89	L	97.3	Very high	97	Very high	124 Å²	124	109.5 Å²	109.5	65%	0.649	54%	0.541	S	S	*	.	H	α-helix	trans	-63.7	-41.2	177.6	-169.6	71.7	0	0	0	111.9	L85 V86 D92 E93	L85-L89 WeakPolarHBondContact O-CB 3.39Å; L85-L89 PolarHBondContact O-N 2.82Å; V86-L89 WeakPolarHBondContact O-CB 3.45Å; V86-L89 PolarHBondContact O-N 3.48Å; V86-L89 VanDerWaalsContact O-N 3.12Å; L89-D92 PolarHBondContact O-N 3.48Å; L89-E93 PolarHBondContact O-N 2.91Å; L89-E93 VanDerWaalsContact O-N 3.1Å
90	E	95.8	Very high	96.9	Very high	120 Å²	120	108.9 Å²	108.9	56%	0.561	54%	0.537	S	S	*	.	H	α-helix	trans	-64.5	-41.8	175	-71.7	178.5	-171.5	0	0	111.4	V86 D92 E93	V86-E90 HydrophobicContact CG1-CG 4.49Å; V86-E90 WeakPolarHBondContact O-CG 3.4Å; V86-E90 PolarHBondContact O-N 2.94Å; E90-D92 VanDerWaalsContact C-N 3.27Å; E90-D92 PolarHBondContact O-N 2.92Å; E90-E93 WeakPolarHBondContact O-CB 3.45Å; E90-E93 PolarHBondContact O-N 3.38Å
91	A	96.9	Very high	96.8	Very high	66 Å²	66	104.3 Å²	104.3	55%	0.545	52%	0.516	S	S	.	.	H	α-helix	trans	-64.3	-31.5	176.6	0	0	0	0	0	113.1	E87 E88 W94	E87-A91 WeakPolarHBondContact O-CB 3.42Å; E87-A91 PolarHBondContact O-N 3.4Å; E88-A91 PolarHBondContact O-N 3.41Å; A91-W94 PolarHBondContact O-NE1 2.97Å
92	D	97.5	Very high	96.6	Very high	46 Å²	46	103 Å²	103	25%	0.246	52%	0.515	C	S	.	.	T	Hydrogen-bonded Turn	trans	-95.2	1.5	-178.1	-93.2	6.4	0	0	0	114.2	E88 L89 E90 W94 R95	E88-D92 WeakPolarHBondContact O-CB 3.37Å; E88-D92 PolarHBondContact O-N 3.21Å; L89-D92 PolarHBondContact O-N 3.48Å; E90-D92 VanDerWaalsContact C-N 3.27Å; E90-D92 PolarHBondContact O-N 2.92Å; D92-W94 PolarHBondContact O-N 3.1Å; D92-W94 VanDerWaalsContact O-N 3.15Å; D92-R95 VanDerWaalsContact O-CB 3.32Å; D92-R95 WeakPolarHBondContact O-CB 3.4Å; D92-R95 WeakPolarHBondContact O-CG 3.29Å; D92-R95 PolarHBondContact O-N 3.45Å; D92-R95 WeakPolarHBondContact OD1-CD 3.27Å; D92-R95 IonicContact OD1-NH1 3.9Å; D92-R95 IonicContact OD2-CZ 3.84Å; D92-R95 IonicContact OD2-NH1 2.76Å; D92-R95 PolarHBondContact OD2-NH1 3.43Å
93	E	96	Very high	96.6	Very high	138 Å²	138	103 Å²	103	65%	0.645	52%	0.515	S	S	*	.	G	3₁₀ helix	trans	-54.7	-39.7	-175	-173.5	176.5	-156.3	0	0	112.6	L89 E90 R95 Y96	L89-E93 PolarHBondContact O-N 2.91Å; L89-E93 VanDerWaalsContact O-N 3.1Å; E90-E93 WeakPolarHBondContact O-CB 3.45Å; E90-E93 PolarHBondContact O-N 3.38Å; E93-R95 PolarHBondContact O-N 3.44Å; E93-Y96 PolarHBondContact O-N 2.73Å; E93-Y96 VanDerWaalsContact O-N 3.15Å
94	W	95.8	Very high	96.5	Very high	207 Å²	207	103 Å²	103	78%	0.784	52%	0.52	S	S	*	.	G	3₁₀ helix	trans	-61.7	-18.2	-179.1	70.3	-86.9	0	0	0	114.3	A91 D92 Y96	A91-W94 PolarHBondContact O-NE1 2.97Å; D92-W94 PolarHBondContact O-N 3.1Å; D92-W94 VanDerWaalsContact O-N 3.15Å; W94-Y96 VanDerWaalsContact C-N 3.31Å
95	R	97.2	Very high	96.5	Very high	136 Å²	136	107.2 Å²	107.2	51%	0.513	53%	0.531	S	S	.	.	G	3₁₀ helix	trans	-79.5	-17.1	-178.3	-59.6	175.9	64.9	-164.3	-2.3	112.5	D92 E93	D92-R95 VanDerWaalsContact O-CB 3.32Å; D92-R95 WeakPolarHBondContact O-CB 3.4Å; D92-R95 WeakPolarHBondContact O-CG 3.29Å; D92-R95 PolarHBondContact O-N 3.45Å; D92-R95 WeakPolarHBondContact OD1-CD 3.27Å; D92-R95 IonicContact OD1-NH1 3.9Å; D92-R95 IonicContact OD2-CZ 3.84Å; D92-R95 IonicContact OD2-NH1 2.76Å; D92-R95 PolarHBondContact OD2-NH1 3.43Å; E93-R95 PolarHBondContact O-N 3.44Å
96	Y	94.8	Very high	96.3	Very high	147 Å²	147	106.3 Å²	106.3	58%	0.576	53%	0.529	S	S	*	.	S	Bend	trans	-120.9	162.9	-170.9	-58.8	-75	0	0	0	111.6	E93 W94	E93-Y96 PolarHBondContact O-N 2.73Å; E93-Y96 VanDerWaalsContact O-N 3.15Å; W94-Y96 VanDerWaalsContact C-N 3.31Å
97	K	95.5	Very high	95.9	Very high	120 Å²	120	108.8 Å²	108.8	52%	0.522	55%	0.546	S	S	.	.			trans	-70.1	140.5	172.2	-69.4	-169	176.5	-165.3	0	109.4	L102	K97-L102 HydrophobicContact CB-CD1 4.45Å; K97-L102 HydrophobicContact CB-CD2 3.97Å; K97-L102 HydrophobicContact CB-CG 4.06Å; K97-L102 HydrophobicContact CD-CD2 4.18Å
98	P	94.9	Very high	95	Very high	66 Å²	66	109.1 Å²	109.1	43%	0.429	56%	0.563	S	S	.	*			trans	-53.2	142.2	173.8	-25.8	34.3	0	0	0	111.8	E100 Q101 L102	P98-E100 WeakPolarHBondContact CB-OE2 3.29Å; P98-E100 PolarHBondContact O-N 3.22Å; P98-Q101 PolarHBondContact O-N 3.32Å; P98-Q101 VanDerWaalsContact O-N 3.11Å; P98-L102 PolarHBondContact O-N 3.21Å
99	I	95.6	Very high	94.9	Very high	97 Å²	97	108.6 Å²	108.6	50%	0.497	56%	0.563	S	S	.	*	H	α-helix	trans	-61.7	-31.8	-175.2	-170.3	61	0	0	0	111.5	Q101 L102 L103	I99-Q101 VanDerWaalsContact C-N 3.32Å; I99-Q101 PolarHBondContact O-N 3.29Å; I99-L102 HydrophobicContact CD1-CD1 4.48Å; I99-L102 PolarHBondContact O-N 3.48Å; I99-L103 HydrophobicContact CD1-CD1 4.29Å; I99-L103 HydrophobicContact CD1-CG 4.24Å; I99-L103 HydrophobicContact CG1-CD1 3.84Å; I99-L103 HydrophobicContact CG1-CG 4.21Å; I99-L103 WeakPolarHBondContact O-CB 3.19Å; I99-L103 VanDerWaalsContact O-CG 3.27Å; I99-L103 WeakPolarHBondContact O-CG 3.42Å; I99-L103 PolarHBondContact O-N 2.95Å
100	E	96.7	Very high	94.8	Very high	91 Å²	91	107.8 Å²	107.8	43%	0.425	56%	0.559	S	S	.	*	H	α-helix	trans	-63.3	-38.9	178.3	-59.8	75.8	-165.9	0	0	111.9	P98 L103 G104 F105 T106	P98-E100 WeakPolarHBondContact CB-OE2 3.29Å; P98-E100 PolarHBondContact O-N 3.22Å; E100-L103 PolarHBondContact O-N 3.46Å; E100-G104 PolarHBondContact O-N 2.92Å; E100-F105 HydrophobicContact CB-CB 4.22Å; E100-F105 HydrophobicContact CB-CD2 4.5Å; E100-F105 PolarHBondContact O-N 3.01Å; E100-T106 HydrophobicContact CB-CG2 4.21Å; E100-T106 PolarHBondContact O-N 3.29Å
101	Q	96.3	Very high	94.8	Very high	44 Å²	44	107.1 Å²	107.1	21%	0.206	56%	0.559	C	S	.	*	H	α-helix	trans	-72.8	-36.9	178.2	-172.1	-177.3	-10.2	0	0	110.9	P98 I99 L103 G104 T106 S108	P98-Q101 PolarHBondContact O-N 3.32Å; P98-Q101 VanDerWaalsContact O-N 3.11Å; I99-Q101 VanDerWaalsContact C-N 3.32Å; I99-Q101 PolarHBondContact O-N 3.29Å; Q101-L103 VanDerWaalsContact C-N 3.33Å; Q101-G104 PolarHBondContact O-N 2.82Å; Q101-T106 WeakPolarHBondContact CA-OG1 3.49Å; Q101-T106 PolarHBondContact N-OG1 3.07Å; Q101-S108 VanDerWaalsContact NE2-CA 3.29Å; Q101-S108 VanDerWaalsContact NE2-CB 3.3Å; Q101-S108 PolarHBondContact NE2-OG 3.39Å; Q101-S108 PolarHBondContact NE2-OXT 2.82Å
102	L	95.4	Very high	94.6	Very high	112 Å²	112	109.5 Å²	109.5	59%	0.586	56%	0.56	S	S	*	*	H	α-helix	trans	-67.2	-35.1	175.3	-65.9	177	0	0	0	112.3	K97 P98 I99 G104	K97-L102 HydrophobicContact CB-CD1 4.45Å; K97-L102 HydrophobicContact CB-CD2 3.97Å; K97-L102 HydrophobicContact CB-CG 4.06Å; K97-L102 HydrophobicContact CD-CD2 4.18Å; P98-L102 PolarHBondContact O-N 3.21Å; I99-L102 HydrophobicContact CD1-CD1 4.48Å; I99-L102 PolarHBondContact O-N 3.48Å; L102-G104 VanDerWaalsContact C-N 3.31Å
103	L	96.8	Very high	94.5	Very high	107 Å²	107	113.5 Å²	113.5	56%	0.56	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.9	-2.9	176.7	-63.7	177.8	0	0	0	113.3	I99 E100 Q101 F105	I99-L103 HydrophobicContact CD1-CD1 4.29Å; I99-L103 HydrophobicContact CD1-CG 4.24Å; I99-L103 HydrophobicContact CG1-CD1 3.84Å; I99-L103 HydrophobicContact CG1-CG 4.21Å; I99-L103 WeakPolarHBondContact O-CB 3.19Å; I99-L103 VanDerWaalsContact O-CG 3.27Å; I99-L103 WeakPolarHBondContact O-CG 3.42Å; I99-L103 PolarHBondContact O-N 2.95Å; E100-L103 PolarHBondContact O-N 3.46Å; Q101-L103 VanDerWaalsContact C-N 3.33Å; L103-F105 VanDerWaalsContact C-N 3.33Å; L103-F105 HydrophobicContact CB-CD2 3.8Å; L103-F105 HydrophobicContact CB-CE2 3.68Å; L103-F105 HydrophobicContact CB-CZ 4.36Å; L103-F105 HydrophobicContact CD1-CD2 4.37Å; L103-F105 HydrophobicContact CD1-CE2 3.74Å; L103-F105 HydrophobicContact CG-CE2 4.38Å; L103-F105 PolarHBondContact O-N 3.46Å
104	G	96.1	Very high	94.4	Very high	61 Å²	61	111.9 Å²	111.9	63%	0.629	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	75.3	17.7	176.6	0	0	0	0	0	114.8	E100 Q101 L102 T106	E100-G104 PolarHBondContact O-N 2.92Å; Q101-G104 PolarHBondContact O-N 2.82Å; L102-G104 VanDerWaalsContact C-N 3.31Å; G104-T106 VanDerWaalsContact C-N 3.32Å
105	F	96.9	Very high	94.3	Very high	158 Å²	158	105.1 Å²	105.1	69%	0.693	56%	0.56	S	S	*	*	S	Bend	trans	-73.6	-27.1	172.6	-62.7	-48.9	0	0	0	112.2	E100 L103	E100-F105 HydrophobicContact CB-CB 4.22Å; E100-F105 HydrophobicContact CB-CD2 4.5Å; E100-F105 PolarHBondContact O-N 3.01Å; L103-F105 VanDerWaalsContact C-N 3.33Å; L103-F105 HydrophobicContact CB-CD2 3.8Å; L103-F105 HydrophobicContact CB-CE2 3.68Å; L103-F105 HydrophobicContact CB-CZ 4.36Å; L103-F105 HydrophobicContact CD1-CD2 4.37Å; L103-F105 HydrophobicContact CD1-CE2 3.74Å; L103-F105 HydrophobicContact CG-CE2 4.38Å; L103-F105 PolarHBondContact O-N 3.46Å
106	T	94.8	Very high	94	Very high	67 Å²	67	102.7 Å²	102.7	41%	0.411	56%	0.563	S	S	.	*	S	Bend	trans	-124.8	146	177.1	56.2	0	0	0	0	111.3	E100 Q101 G104	E100-T106 HydrophobicContact CB-CG2 4.21Å; E100-T106 PolarHBondContact O-N 3.29Å; Q101-T106 WeakPolarHBondContact CA-OG1 3.49Å; Q101-T106 PolarHBondContact N-OG1 3.07Å; G104-T106 VanDerWaalsContact C-N 3.32Å
107	P	88.8	Confident	94	Very high	126 Å²	126	99 Å²	99	82%	0.818	56%	0.562	S	S	*	*			trans	-67	151.5	173.2	28.7	-33.4	0	0	0	111
108	S	79.9	Confident	93.8	Very high	139 Å²	139	97.1 Å²	97.1	97%	0.972	57%	0.566	S	S	*	*			trans	-83.2	0	-176	-179.5	0	0	0	0	114.6	Q101	Q101-S108 VanDerWaalsContact NE2-CA 3.29Å; Q101-S108 VanDerWaalsContact NE2-CB 3.3Å; Q101-S108 PolarHBondContact NE2-OG 3.39Å; Q101-S108 PolarHBondContact NE2-OXT 2.82Å

Retrieved 108 of 108 residues in 26.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).