A0A087XH33_POEFO Loading...

BBSome interacting protein 1

AlphaFold DB , UniProt , Accession A0A087XH33, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 76 aa.

						>A0A087XH33_POEFO|A0A087XH33
MPEVKSILREVLPKQASTGQLYMEDVPTMVLCKPKLLPLKSVTLEKLEKMQMEAQEAVKQQELAMKEQVPRTHKAL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.4	Very low	66.8	Low	232 Å²	232	165.4 Å²	165.4	100%	1.143	85%	0.845	S	S	*	*				0	129.2	0	-76.5	174.5	144	0	0	107.3
2	P	49.6	Very low	68.2	Low	122 Å²	122	160.7 Å²	160.7	79%	0.792	82%	0.822	S	S	*	*			trans	-76.8	127.5	-177.1	31.1	-29.7	0	0	0	109.7	V4	P2-V4 PolarHBondContact O-N 3.43Å
3	E	57.3	Low	69.4	Low	191 Å²	191	154.8 Å²	154.8	89%	0.893	80%	0.8	S	S	*	*			trans	-75.5	102.9	176.9	-62.2	-172.3	-176.3	0	0	109.6	K5	E3-K5 PolarHBondContact O-N 3.07Å
4	V	60	Low	69.9	Low	139 Å²	139	156.6 Å²	156.6	84%	0.842	80%	0.8	S	S	*	*			trans	-71.3	100.9	172.8	-176.6	0	0	0	0	107.8	P2 S6	P2-V4 PolarHBondContact O-N 3.43Å; V4-S6 PolarHBondContact O-N 2.9Å; V4-S6 VanDerWaalsContact O-N 3.15Å
5	K	62.9	Low	70	Confident	195 Å²	195	156.9 Å²	156.9	85%	0.848	80%	0.796	S	S	*	*			trans	-62.7	110.7	176.9	-140.5	170.9	-172.6	175.4	0	109	E3 I7	E3-K5 PolarHBondContact O-N 3.07Å; K5-I7 PolarHBondContact O-N 3.43Å
6	S	64.3	Low	69.5	Low	105 Å²	105	150.9 Å²	150.9	73%	0.734	78%	0.778	S	S	*	*			trans	-60.8	124.2	-179.6	44.4	0	0	0	0	111.3	V4 L8	V4-S6 PolarHBondContact O-N 2.9Å; V4-S6 VanDerWaalsContact O-N 3.15Å; S6-L8 VanDerWaalsContact C-N 3.28Å; S6-L8 PolarHBondContact O-N 3.11Å
7	I	75.9	Confident	69.1	Low	172 Å²	172	147.8 Å²	147.8	88%	0.882	77%	0.773	S	S	*	*	S	Bend	trans	-77.4	-16.1	-177.8	-62	166.7	0	0	0	111.7	K5	K5-I7 PolarHBondContact O-N 3.43Å
8	L	77.1	Confident	69.2	Low	156 Å²	156	145.9 Å²	145.9	82%	0.817	77%	0.768	S	S	*	*			trans	-91.4	117.8	-179.5	-61.7	176.6	0	0	0	110.4	S6	S6-L8 VanDerWaalsContact C-N 3.28Å; S6-L8 PolarHBondContact O-N 3.11Å
9	R	80.9	Confident	69.8	Low	223 Å²	223	140.2 Å²	140.2	84%	0.842	75%	0.748	S	S	*	*			trans	-87.1	113.9	169.9	-175.1	-178.1	-67.4	-170.2	-0.8	108.3	V11	R9-V11 PolarHBondContact O-N 3.43Å
10	E	81.5	Confident	70.6	Confident	161 Å²	161	141.4 Å²	141.4	75%	0.752	75%	0.749	S	S	*	*			trans	-62.3	119.1	169.9	-171.8	176.8	177.1	0	0	109.1	L12	E10-L12 HydrophobicContact CG-CD2 4.26Å
11	V	83.4	Confident	71.4	Confident	123 Å²	123	140.9 Å²	140.9	75%	0.745	75%	0.746	S	S	*	*			trans	-109.8	106.8	176.3	-179.8	0	0	0	0	107.7	R9	R9-V11 PolarHBondContact O-N 3.43Å
12	L	83.3	Confident	73.6	Confident	109 Å²	109	139.7 Å²	139.7	57%	0.571	73%	0.73	S	S	*	*			trans	-80.8	149.1	173	-61.7	176.5	0	0	0	110	E10 K14	E10-L12 HydrophobicContact CG-CD2 4.26Å; L12-K14 PolarHBondContact O-N 3.35Å
13	P	83.9	Confident	75.6	Confident	84 Å²	84	142 Å²	142	55%	0.545	73%	0.732	S	S	.	*			trans	-56.4	132.5	172.1	10.1	-12.9	0	0	0	108.9	Q15 A16 S17	P13-Q15 PolarHBondContact O-N 3.44Å; P13-A16 HydrophobicContact CB-CB 4.31Å; P13-A16 HydrophobicContact CG-CB 3.69Å; P13-A16 WeakPolarHBondContact O-CA 3.28Å; P13-A16 WeakPolarHBondContact O-CB 3.43Å; P13-A16 PolarHBondContact O-N 2.87Å; P13-S17 PolarHBondContact O-N 3.46Å
14	K	76.6	Confident	77.3	Confident	181 Å²	181	140.5 Å²	140.5	79%	0.787	73%	0.726	S	S	*	*	H	α-helix	trans	-53.9	-33.7	177.7	-64.3	-177.6	-179.9	-179.8	0	111.2	L12 A16 S17 T18	L12-K14 PolarHBondContact O-N 3.35Å; K14-A16 VanDerWaalsContact C-N 3.35Å; K14-A16 PolarHBondContact O-N 3.42Å; K14-S17 WeakPolarHBondContact O-CB 3.23Å; K14-S17 PolarHBondContact O-N 2.9Å; K14-S17 VanDerWaalsContact O-N 3.07Å; K14-S17 PolarHBondContact O-OG 2.91Å; K14-T18 PolarHBondContact O-N 3.47Å; K14-T18 PolarHBondContact O-OG1 2.96Å; K14-T18 VanDerWaalsContact O-OG1 3.09Å
15	Q	71.6	Confident	78.8	Confident	160 Å²	160	141.7 Å²	141.7	75%	0.748	73%	0.727	S	S	*	*	H	α-helix	trans	-63.8	-34.6	173.8	-65.8	-179.7	1.1	0	0	113.3	P13 S17 T18 G19	P13-Q15 PolarHBondContact O-N 3.44Å; Q15-S17 VanDerWaalsContact C-N 3.29Å; Q15-S17 PolarHBondContact O-N 3.23Å; Q15-T18 VanDerWaalsContact CA-OG1 3.3Å; Q15-T18 WeakPolarHBondContact CA-OG1 3.49Å; Q15-T18 PolarHBondContact O-N 3.21Å; Q15-T18 PolarHBondContact O-OG1 3.38Å; Q15-T18 VanDerWaalsContact O-OG1 3.14Å; Q15-G19 PolarHBondContact O-N 3.03Å
16	A	61.7	Low	80.3	Confident	62 Å²	62	137 Å²	137	51%	0.512	72%	0.715	S	S	.	*	H	α-helix	trans	-69	-27.2	171.5	0	0	0	0	0	112.5	P13 K14 G19	P13-A16 HydrophobicContact CB-CB 4.31Å; P13-A16 HydrophobicContact CG-CB 3.69Å; P13-A16 WeakPolarHBondContact O-CA 3.28Å; P13-A16 WeakPolarHBondContact O-CB 3.43Å; P13-A16 PolarHBondContact O-N 2.87Å; K14-A16 VanDerWaalsContact C-N 3.35Å; K14-A16 PolarHBondContact O-N 3.42Å; A16-G19 PolarHBondContact O-N 3Å
17	S	61.7	Low	81.7	Confident	98 Å²	98	138.1 Å²	138.1	69%	0.685	72%	0.719	S	S	*	*	H	α-helix	trans	-75.9	-30.4	172	73.3	0	0	0	0	113.7	P13 K14 Q15 G19	P13-S17 PolarHBondContact O-N 3.46Å; K14-S17 WeakPolarHBondContact O-CB 3.23Å; K14-S17 PolarHBondContact O-N 2.9Å; K14-S17 VanDerWaalsContact O-N 3.07Å; K14-S17 PolarHBondContact O-OG 2.91Å; Q15-S17 VanDerWaalsContact C-N 3.29Å; Q15-S17 PolarHBondContact O-N 3.23Å; S17-G19 VanDerWaalsContact C-N 3.32Å
18	T	71.4	Confident	82.5	Confident	113 Å²	113	135.2 Å²	135.2	69%	0.693	71%	0.71	S	S	*	*	H	α-helix	trans	-81.6	-8.3	169.8	31.5	0	0	0	0	114	K14 Q15	K14-T18 PolarHBondContact O-N 3.47Å; K14-T18 PolarHBondContact O-OG1 2.96Å; K14-T18 VanDerWaalsContact O-OG1 3.09Å; Q15-T18 VanDerWaalsContact CA-OG1 3.3Å; Q15-T18 WeakPolarHBondContact CA-OG1 3.49Å; Q15-T18 PolarHBondContact O-N 3.21Å; Q15-T18 PolarHBondContact O-OG1 3.38Å; Q15-T18 VanDerWaalsContact O-OG1 3.14Å
19	G	81.1	Confident	83.4	Confident	37 Å²	37	136.5 Å²	136.5	38%	0.381	71%	0.714	S	S	.	*			trans	80.5	163.6	176.5	0	0	0	0	0	114.4	Q15 A16 S17	Q15-G19 PolarHBondContact O-N 3.03Å; A16-G19 PolarHBondContact O-N 3Å; S17-G19 VanDerWaalsContact C-N 3.32Å
20	Q	85.6	Confident	84	Confident	165 Å²	165	132.2 Å²	132.2	77%	0.771	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-71.5	132.4	172	-176.9	64	26.2	0	0	109.7
21	L	87.4	Confident	84.7	Confident	130 Å²	130	131.8 Å²	131.8	68%	0.681	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-94.9	132.4	176.7	-59.3	178.4	0	0	0	110.4
22	Y	89.4	Confident	85.3	Confident	207 Å²	207	131.8 Å²	131.8	81%	0.812	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-96.5	116.1	167.9	-66.1	-93.5	0	0	0	107.9
23	M	91.2	Very high	85.9	Confident	170 Å²	170	135.4 Å²	135.4	84%	0.837	73%	0.73	S	S	*	*			trans	-88.2	-25.9	-176.5	-65.7	-103.4	64.6	0	0	112.6
24	E	93	Very high	86.6	Confident	161 Å²	161	137.8 Å²	137.8	75%	0.752	75%	0.745	S	S	*	*	S	Bend	trans	-142.4	150.9	-175	-60.4	-175.1	148.1	0	0	109.9
25	D	90.9	Very high	87.4	Confident	163 Å²	163	138.3 Å²	138.3	87%	0.872	75%	0.747	S	S	*	*			trans	-88.6	107.3	173.8	-170.5	7.8	0	0	0	109.4
26	V	93.6	Very high	88.6	Confident	97 Å²	97	138.9 Å²	138.9	59%	0.588	76%	0.755	S	S	*	*			trans	-97.6	124.8	179.4	-179	0	0	0	0	108.1	T28	V26-T28 PolarHBondContact O-N 3.36Å
27	P	93.8	Very high	90.3	Very high	128 Å²	128	142.8 Å²	142.8	83%	0.831	77%	0.766	S	S	*	*			trans	-63.6	115.2	-179.6	25.4	-33.4	0	0	0	110.5
28	T	94.2	Very high	91.8	Very high	112 Å²	112	143.6 Å²	143.6	69%	0.687	77%	0.769	S	S	*	*			trans	-110.4	152.3	176.1	59.4	0	0	0	0	111.5	V26 V30	V26-T28 PolarHBondContact O-N 3.36Å; T28-V30 PolarHBondContact O-N 2.87Å
29	M	94.8	Very high	93	Very high	182 Å²	182	146.4 Å²	146.4	90%	0.897	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-62.2	126.7	169.6	-71.5	-176.5	51.3	0	0	110.7
30	V	94.8	Very high	93.7	Very high	134 Å²	134	150.8 Å²	150.8	81%	0.812	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-92.5	125.3	-178.9	-177.7	0	0	0	0	110	T28	T28-V30 PolarHBondContact O-N 2.87Å
31	L	96.1	Very high	94.2	Very high	151 Å²	151	145.2 Å²	145.2	79%	0.791	77%	0.767	S	S	*	*	P	Polyproline II helix	trans	-80.5	149.8	170.6	-61	177.8	0	0	0	110.7	K33	L31-K33 PolarHBondContact O-N 3.17Å
32	C	95.7	Very high	94.7	Very high	124 Å²	124	144.9 Å²	144.9	84%	0.838	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-59.3	137.3	170.4	-62.7	0	0	0	0	110.1
33	K	96.1	Very high	95	Very high	185 Å²	185	139.7 Å²	139.7	80%	0.804	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-64.1	148.4	170.6	-62	-158.2	-176.6	-164.9	0	109.9	L31 K35	L31-K33 PolarHBondContact O-N 3.17Å; K33-K35 PolarHBondContact O-N 3.09Å
34	P	97.2	Very high	95.3	Very high	134 Å²	134	135.9 Å²	135.9	87%	0.87	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-57.2	135.5	175.8	24	-34	0	0	0	110.5
35	K	95.1	Very high	95.5	Very high	192 Å²	192	134.1 Å²	134.1	84%	0.835	73%	0.734	S	S	*	*	P	Polyproline II helix	trans	-95.5	126.4	179.6	-71.3	-173.9	176.2	178.3	0	110.5	K33	K33-K35 PolarHBondContact O-N 3.09Å
36	L	96.9	Very high	95.8	Very high	171 Å²	171	133.8 Å²	133.8	90%	0.895	73%	0.725	S	S	*	*	P	Polyproline II helix	trans	-80.9	122.6	167.5	-173.6	65.5	0	0	0	108.9
37	L	95.6	Very high	96	Very high	144 Å²	144	134 Å²	134	75%	0.754	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-71.6	136.9	175.1	-65.3	177.9	0	0	0	109.8
38	P	94.6	Very high	96.1	Very high	116 Å²	116	131.6 Å²	131.6	75%	0.753	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-67.6	147.4	177.6	29.1	-34.3	0	0	0	110.6
39	L	95.4	Very high	96.3	Very high	172 Å²	172	132.4 Å²	132.4	90%	0.901	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-73.1	137.7	172	-60.3	177.9	0	0	0	109.6
40	K	95.5	Very high	96.4	Very high	128 Å²	128	129.2 Å²	129.2	56%	0.557	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-69.1	143.7	173.4	-61	-172.9	-175.7	-169.7	0	109.7	E48	K40-E48 WeakPolarHBondContact CD-OE2 3.37Å; K40-E48 IonicContact NZ-OE1 3Å; K40-E48 PolarHBondContact NZ-OE1 3.37Å; K40-E48 IonicContact NZ-OE2 2.62Å; K40-E48 PolarHBondContact NZ-OE2 3.19Å
41	S	97.2	Very high	96.5	Very high	49 Å²	49	129.2 Å²	129.2	34%	0.343	67%	0.67	S	S	.	*	P	Polyproline II helix	trans	-75.9	155.3	170.7	66.1	0	0	0	0	110.3	T43 L44 E45	S41-T43 PolarHBondContact O-N 2.96Å; S41-T43 VanDerWaalsContact O-N 3.16Å; S41-T43 PolarHBondContact OG-OG1 3.15Å; S41-L44 PolarHBondContact O-N 3.41Å; S41-L44 WeakPolarHBondContact OG-CB 3.5Å; S41-L44 VanDerWaalsContact OG-CG 3.3Å; S41-L44 WeakPolarHBondContact OG-CG 3.29Å; S41-L44 PolarHBondContact OG-N 3.43Å; S41-L44 VanDerWaalsContact OG-N 3.14Å; S41-E45 PolarHBondContact O-N 3.05Å
42	V	96.9	Very high	96.5	Very high	122 Å²	122	128.4 Å²	128.4	74%	0.739	66%	0.663	S	S	*	*	H	α-helix	trans	-54.8	-35.8	175	-179.5	0	0	0	0	111.5	K46	V42-K46 WeakPolarHBondContact O-CB 3.43Å; V42-K46 PolarHBondContact O-N 3.15Å; V42-K46 VanDerWaalsContact O-N 3.12Å
43	T	97	Very high	96.6	Very high	98 Å²	98	127.4 Å²	127.4	60%	0.601	65%	0.646	S	S	*	*	H	α-helix	trans	-67.8	-44.1	176.4	46.5	0	0	0	0	112.5	S41 K46 L47	S41-T43 PolarHBondContact O-N 2.96Å; S41-T43 VanDerWaalsContact O-N 3.16Å; S41-T43 PolarHBondContact OG-OG1 3.15Å; T43-K46 PolarHBondContact O-N 2.91Å; T43-L47 WeakPolarHBondContact O-CG 3.46Å; T43-L47 PolarHBondContact O-N 3.44Å
44	L	96.8	Very high	96.7	Very high	90 Å²	90	121.4 Å²	121.4	47%	0.471	63%	0.631	S	S	.	*	H	α-helix	trans	-65.7	-42.5	178.4	-77.7	172.9	0	0	0	111.3	S41 K46 L47 E48	S41-L44 PolarHBondContact O-N 3.41Å; S41-L44 WeakPolarHBondContact OG-CB 3.5Å; S41-L44 VanDerWaalsContact OG-CG 3.3Å; S41-L44 WeakPolarHBondContact OG-CG 3.29Å; S41-L44 PolarHBondContact OG-N 3.43Å; S41-L44 VanDerWaalsContact OG-N 3.14Å; L44-K46 VanDerWaalsContact C-N 3.33Å; L44-K46 PolarHBondContact O-N 3.22Å; L44-L47 PolarHBondContact O-N 3.02Å; L44-E48 WeakPolarHBondContact O-CB 3.31Å; L44-E48 WeakPolarHBondContact O-CG 3.3Å; L44-E48 PolarHBondContact O-N 3.48Å
45	E	96.5	Very high	96.6	Very high	124 Å²	124	121.6 Å²	121.6	58%	0.579	62%	0.621	S	S	*	*	H	α-helix	trans	-60.7	-43	176.8	-172.8	177.9	179.2	0	0	111.8	S41 K49	S41-E45 PolarHBondContact O-N 3.05Å; E45-K49 WeakPolarHBondContact O-CB 3.37Å; E45-K49 PolarHBondContact O-N 2.93Å
46	K	97.6	Very high	96.7	Very high	157 Å²	157	117.8 Å²	117.8	68%	0.683	61%	0.605	S	S	*	*	H	α-helix	trans	-65.1	-40.4	176.7	-172.9	174	-179.2	179.4	0	112.5	V42 T43 L44 M50	V42-K46 WeakPolarHBondContact O-CB 3.43Å; V42-K46 PolarHBondContact O-N 3.15Å; V42-K46 VanDerWaalsContact O-N 3.12Å; T43-K46 PolarHBondContact O-N 2.91Å; L44-K46 VanDerWaalsContact C-N 3.33Å; L44-K46 PolarHBondContact O-N 3.22Å; K46-M50 WeakPolarHBondContact O-CB 3.38Å; K46-M50 PolarHBondContact O-N 3.32Å
47	L	97.6	Very high	96.6	Very high	100 Å²	100	111.8 Å²	111.8	52%	0.524	58%	0.581	S	S	.	*	H	α-helix	trans	-67	-44.5	178.2	-73.1	173.3	0	0	0	111.8	T43 L44 K49 M50 Q51	T43-L47 WeakPolarHBondContact O-CG 3.46Å; T43-L47 PolarHBondContact O-N 3.44Å; L44-L47 PolarHBondContact O-N 3.02Å; L47-K49 VanDerWaalsContact C-N 3.33Å; L47-K49 PolarHBondContact O-N 3.39Å; L47-M50 HydrophobicContact CD2-CE 4.31Å; L47-M50 PolarHBondContact O-N 2.96Å; L47-Q51 WeakPolarHBondContact O-CB 3.38Å; L47-Q51 PolarHBondContact O-N 3.35Å
48	E	96.7	Very high	96.6	Very high	79 Å²	79	108.6 Å²	108.6	37%	0.369	57%	0.567	S	S	.	*	H	α-helix	trans	-60.4	-44	175.7	-72.9	177	165.4	0	0	111.3	K40 L44 Q51 M52	K40-E48 WeakPolarHBondContact CD-OE2 3.37Å; K40-E48 IonicContact NZ-OE1 3Å; K40-E48 PolarHBondContact NZ-OE1 3.37Å; K40-E48 IonicContact NZ-OE2 2.62Å; K40-E48 PolarHBondContact NZ-OE2 3.19Å; L44-E48 WeakPolarHBondContact O-CB 3.31Å; L44-E48 WeakPolarHBondContact O-CG 3.3Å; L44-E48 PolarHBondContact O-N 3.48Å; E48-Q51 PolarHBondContact O-N 3.49Å; E48-M52 PolarHBondContact O-N 3.09Å
49	K	97.6	Very high	96.6	Very high	128 Å²	128	109.5 Å²	109.5	56%	0.557	56%	0.559	S	S	*	*	H	α-helix	trans	-61.6	-46.9	176.1	179.7	175.5	170	176.1	0	111.9	E45 L47 Q51 M52 E53	E45-K49 WeakPolarHBondContact O-CB 3.37Å; E45-K49 PolarHBondContact O-N 2.93Å; L47-K49 VanDerWaalsContact C-N 3.33Å; L47-K49 PolarHBondContact O-N 3.39Å; K49-Q51 VanDerWaalsContact C-N 3.28Å; K49-Q51 PolarHBondContact O-N 2.99Å; K49-M52 WeakPolarHBondContact O-CB 3.43Å; K49-M52 PolarHBondContact O-N 3.47Å; K49-E53 WeakPolarHBondContact CE-OE1 3.46Å; K49-E53 HydrophobicContact CG-CG 4.47Å; K49-E53 IonicContact NZ-OE1 3.79Å; K49-E53 WeakPolarHBondContact O-CG 3.5Å; K49-E53 PolarHBondContact O-N 2.97Å
50	M	97.2	Very high	96.5	Very high	116 Å²	116	106.8 Å²	106.8	57%	0.571	54%	0.542	S	S	*	.	H	α-helix	trans	-61.8	-38.1	178.4	-170	-178.6	75.8	0	0	111.7	K46 L47 A54	K46-M50 WeakPolarHBondContact O-CB 3.38Å; K46-M50 PolarHBondContact O-N 3.32Å; L47-M50 HydrophobicContact CD2-CE 4.31Å; L47-M50 PolarHBondContact O-N 2.96Å; M50-A54 WeakPolarHBondContact O-CB 3.35Å; M50-A54 PolarHBondContact O-N 3.03Å
51	Q	97	Very high	96.3	Very high	134 Å²	134	106.6 Å²	106.6	63%	0.626	54%	0.543	S	S	*	.	H	α-helix	trans	-64.7	-43.6	175.1	-176.7	179.6	-7.9	0	0	111.6	L47 E48 K49 Q55	L47-Q51 WeakPolarHBondContact O-CB 3.38Å; L47-Q51 PolarHBondContact O-N 3.35Å; E48-Q51 PolarHBondContact O-N 3.49Å; K49-Q51 VanDerWaalsContact C-N 3.28Å; K49-Q51 PolarHBondContact O-N 2.99Å; Q51-Q55 WeakPolarHBondContact O-CB 3.46Å; Q51-Q55 PolarHBondContact O-N 3.33Å; Q51-Q55 VanDerWaalsContact O-N 3.09Å
52	M	97.4	Very high	95.9	Very high	133 Å²	133	110.2 Å²	110.2	66%	0.655	56%	0.555	S	S	*	*	H	α-helix	trans	-60.8	-48.7	175.5	-82.8	-179.9	53.4	0	0	112	E48 K49 A54 Q55 E56	E48-M52 PolarHBondContact O-N 3.09Å; K49-M52 WeakPolarHBondContact O-CB 3.43Å; K49-M52 PolarHBondContact O-N 3.47Å; M52-A54 VanDerWaalsContact C-N 3.34Å; M52-A54 PolarHBondContact O-N 3.22Å; M52-Q55 PolarHBondContact O-N 3.12Å; M52-E56 WeakPolarHBondContact O-CB 3.4Å; M52-E56 PolarHBondContact O-N 3.42Å
53	E	97.4	Very high	95.5	Very high	103 Å²	103	109 Å²	109	48%	0.481	54%	0.543	S	S	.	.	H	α-helix	trans	-61.2	-42.4	-179.8	-72.6	174.3	176.6	0	0	111.8	K49 Q55 E56 A57	K49-E53 WeakPolarHBondContact CE-OE1 3.46Å; K49-E53 HydrophobicContact CG-CG 4.47Å; K49-E53 IonicContact NZ-OE1 3.79Å; K49-E53 WeakPolarHBondContact O-CG 3.5Å; K49-E53 PolarHBondContact O-N 2.97Å; E53-Q55 PolarHBondContact O-N 3.4Å; E53-E56 PolarHBondContact O-N 2.96Å; E53-A57 WeakPolarHBondContact O-CB 3.35Å; E53-A57 PolarHBondContact O-N 3.16Å
54	A	97	Very high	95	Very high	59 Å²	59	106.2 Å²	106.2	49%	0.488	53%	0.53	S	S	.	.	H	α-helix	trans	-62.1	-43.4	176.5	0	0	0	0	0	111.8	M50 M52 A57 V58	M50-A54 WeakPolarHBondContact O-CB 3.35Å; M50-A54 PolarHBondContact O-N 3.03Å; M52-A54 VanDerWaalsContact C-N 3.34Å; M52-A54 PolarHBondContact O-N 3.22Å; A54-A57 PolarHBondContact O-N 2.62Å; A54-V58 WeakPolarHBondContact O-CG2 2.8Å; A54-V58 PolarHBondContact O-N 3Å; A54-V58 VanDerWaalsContact O-N 3.15Å
55	Q	96.6	Very high	94.2	Very high	139 Å²	139	108.4 Å²	108.4	65%	0.65	54%	0.54	S	S	*	.	H	α-helix	trans	-67.3	-37.9	178.6	-171.2	173.3	5.4	0	0	112	Q51 M52 E53 K59	Q51-Q55 WeakPolarHBondContact O-CB 3.46Å; Q51-Q55 PolarHBondContact O-N 3.33Å; Q51-Q55 VanDerWaalsContact O-N 3.09Å; M52-Q55 PolarHBondContact O-N 3.12Å; E53-Q55 PolarHBondContact O-N 3.4Å; Q55-K59 PolarHBondContact O-N 3.25Å; Q55-K59 VanDerWaalsContact O-N 3.09Å
56	E	96.4	Very high	93.2	Very high	111 Å²	111	110.5 Å²	110.5	52%	0.519	55%	0.547	S	S	.	.	H	α-helix	trans	-67.7	-42.4	176.8	-172.2	168.9	-159	0	0	111.9	M52 E53 V58 K59 Q60	M52-E56 WeakPolarHBondContact O-CB 3.4Å; M52-E56 PolarHBondContact O-N 3.42Å; E53-E56 PolarHBondContact O-N 2.96Å; E56-V58 VanDerWaalsContact C-N 3.32Å; E56-V58 PolarHBondContact O-N 2.91Å; E56-K59 PolarHBondContact O-N 3.02Å; E56-K59 VanDerWaalsContact O-N 3.17Å; E56-Q60 WeakPolarHBondContact O-CG 3.5Å; E56-Q60 PolarHBondContact O-N 3.14Å
57	A	95.3	Very high	91.7	Very high	45 Å²	45	110.6 Å²	110.6	37%	0.372	55%	0.55	S	S	.	.	H	α-helix	trans	-58.9	-43.3	175.7	0	0	0	0	0	111.9	E53 A54 Q60 Q61	E53-A57 WeakPolarHBondContact O-CB 3.35Å; E53-A57 PolarHBondContact O-N 3.16Å; A54-A57 PolarHBondContact O-N 2.62Å; A57-Q60 PolarHBondContact O-N 2.86Å; A57-Q61 WeakPolarHBondContact O-CG 3.48Å; A57-Q61 PolarHBondContact O-N 3.48Å
58	V	95.4	Very high	89.9	Confident	78 Å²	78	113.3 Å²	113.3	47%	0.473	56%	0.56	S	S	.	*	H	α-helix	trans	-60.4	-47.6	174.8	171.5	0	0	0	0	110.7	A54 E56 Q60 Q61 E62	A54-V58 WeakPolarHBondContact O-CG2 2.8Å; A54-V58 PolarHBondContact O-N 3Å; A54-V58 VanDerWaalsContact O-N 3.15Å; E56-V58 VanDerWaalsContact C-N 3.32Å; E56-V58 PolarHBondContact O-N 2.91Å; V58-Q60 VanDerWaalsContact C-N 3.32Å; V58-Q60 PolarHBondContact O-N 3.28Å; V58-Q61 WeakPolarHBondContact O-CB 3.36Å; V58-Q61 PolarHBondContact O-N 2.78Å; V58-E62 WeakPolarHBondContact O-CG 3.4Å; V58-E62 PolarHBondContact O-N 2.94Å
59	K	95	Very high	88	Confident	134 Å²	134	115.4 Å²	115.4	58%	0.583	58%	0.578	S	S	*	*	H	α-helix	trans	-61.6	-39.6	179	-171.9	179.5	179.5	-176.4	0	112.4	Q55 E56 E62 L63	Q55-K59 PolarHBondContact O-N 3.25Å; Q55-K59 VanDerWaalsContact O-N 3.09Å; E56-K59 PolarHBondContact O-N 3.02Å; E56-K59 VanDerWaalsContact O-N 3.17Å; K59-E62 PolarHBondContact O-N 3.07Å; K59-L63 HydrophobicContact CG-CD1 4.39Å; K59-L63 VanDerWaalsContact O-CG 3.3Å; K59-L63 WeakPolarHBondContact O-CG 3.33Å; K59-L63 PolarHBondContact O-N 3.42Å
60	Q	92.4	Very high	85.6	Confident	116 Å²	116	113.6 Å²	113.6	54%	0.542	58%	0.579	S	S	.	*	H	α-helix	trans	-66.7	-40.6	176.3	-72.4	179.2	2.8	0	0	111.9	E56 A57 V58 L63 A64	E56-Q60 WeakPolarHBondContact O-CG 3.5Å; E56-Q60 PolarHBondContact O-N 3.14Å; A57-Q60 PolarHBondContact O-N 2.86Å; V58-Q60 VanDerWaalsContact C-N 3.32Å; V58-Q60 PolarHBondContact O-N 3.28Å; Q60-L63 PolarHBondContact O-N 3.24Å; Q60-A64 VanDerWaalsContact O-CB 3.31Å; Q60-A64 WeakPolarHBondContact O-CB 3.38Å; Q60-A64 PolarHBondContact O-N 3.07Å
61	Q	90.5	Very high	83.6	Confident	124 Å²	124	119 Å²	119	58%	0.579	59%	0.593	S	S	*	*	H	α-helix	trans	-61.4	-43.2	174	-74.5	177.5	-4.9	0	0	111.7	A57 V58 A64 M65	A57-Q61 WeakPolarHBondContact O-CG 3.48Å; A57-Q61 PolarHBondContact O-N 3.48Å; V58-Q61 WeakPolarHBondContact O-CB 3.36Å; V58-Q61 PolarHBondContact O-N 2.78Å; Q61-A64 PolarHBondContact O-N 3.06Å; Q61-M65 WeakPolarHBondContact O-CB 3.48Å; Q61-M65 WeakPolarHBondContact O-CG 3.46Å; Q61-M65 PolarHBondContact O-N 3.33Å
62	E	90.3	Very high	81.5	Confident	125 Å²	125	119.9 Å²	119.9	58%	0.584	61%	0.608	S	S	*	*	H	α-helix	trans	-61.4	-44.4	175.7	-72.1	-178	147.8	0	0	112.2	V58 K59 M65 K66	V58-E62 WeakPolarHBondContact O-CG 3.4Å; V58-E62 PolarHBondContact O-N 2.94Å; K59-E62 PolarHBondContact O-N 3.07Å; E62-M65 PolarHBondContact O-N 3.48Å; E62-K66 WeakPolarHBondContact O-CB 3.46Å; E62-K66 PolarHBondContact O-N 3.4Å
63	L	88.3	Confident	79.5	Confident	96 Å²	96	122.4 Å²	122.4	50%	0.503	62%	0.618	S	S	.	*	H	α-helix	trans	-64.8	-45.6	177.4	-70.5	170.9	0	0	0	111.5	K59 Q60 M65 K66 E67	K59-L63 HydrophobicContact CG-CD1 4.39Å; K59-L63 VanDerWaalsContact O-CG 3.3Å; K59-L63 WeakPolarHBondContact O-CG 3.33Å; K59-L63 PolarHBondContact O-N 3.42Å; Q60-L63 PolarHBondContact O-N 3.24Å; L63-M65 VanDerWaalsContact C-N 3.33Å; L63-M65 PolarHBondContact O-N 3.09Å; L63-K66 WeakPolarHBondContact O-CB 3.43Å; L63-K66 PolarHBondContact O-N 3.14Å; L63-K66 VanDerWaalsContact O-N 3.07Å; L63-E67 WeakPolarHBondContact O-CG 3.42Å; L63-E67 PolarHBondContact O-N 2.62Å
64	A	85.5	Confident	77.3	Confident	40 Å²	40	127 Å²	127	33%	0.331	64%	0.636	S	S	.	*	H	α-helix	trans	-63.6	-37.3	177.8	0	0	0	0	0	112.4	Q60 Q61 K66 Q68	Q60-A64 VanDerWaalsContact O-CB 3.31Å; Q60-A64 WeakPolarHBondContact O-CB 3.38Å; Q60-A64 PolarHBondContact O-N 3.07Å; Q61-A64 PolarHBondContact O-N 3.06Å; A64-K66 VanDerWaalsContact C-N 3.33Å; A64-Q68 WeakPolarHBondContact O-CB 3.49Å; A64-Q68 VanDerWaalsContact O-CG 3.29Å; A64-Q68 WeakPolarHBondContact O-CG 3.33Å; A64-Q68 PolarHBondContact O-N 3.48Å; A64-Q68 VanDerWaalsContact O-N 3.11Å; A64-Q68 PolarHBondContact O-NE2 3.33Å
65	M	80.1	Confident	74.9	Confident	135 Å²	135	128.6 Å²	128.6	67%	0.665	65%	0.649	S	S	*	*	H	α-helix	trans	-65.3	-37.7	171.8	-78.3	-174	178.4	0	0	111.7	Q61 E62 L63 Q68 V69	Q61-M65 WeakPolarHBondContact O-CB 3.48Å; Q61-M65 WeakPolarHBondContact O-CG 3.46Å; Q61-M65 PolarHBondContact O-N 3.33Å; E62-M65 PolarHBondContact O-N 3.48Å; L63-M65 VanDerWaalsContact C-N 3.33Å; L63-M65 PolarHBondContact O-N 3.09Å; M65-Q68 PolarHBondContact O-N 2.99Å; M65-V69 WeakPolarHBondContact O-CG2 3.39Å; M65-V69 PolarHBondContact O-N 3.06Å
66	K	76.4	Confident	72.3	Confident	169 Å²	169	134.2 Å²	134.2	74%	0.735	68%	0.682	S	S	*	*	H	α-helix	trans	-72.4	-33.8	-179.5	-151.3	160.2	-176.8	173.2	0	112.5	E62 L63 A64	E62-K66 WeakPolarHBondContact O-CB 3.46Å; E62-K66 PolarHBondContact O-N 3.4Å; L63-K66 WeakPolarHBondContact O-CB 3.43Å; L63-K66 PolarHBondContact O-N 3.14Å; L63-K66 VanDerWaalsContact O-N 3.07Å; A64-K66 VanDerWaalsContact C-N 3.33Å
67	E	66.5	Low	71.1	Confident	158 Å²	158	135.4 Å²	135.4	74%	0.738	69%	0.69	S	S	*	*	H	α-helix	trans	-75.6	-25.3	174	-70.4	-172.2	142.2	0	0	113.3	L63 V69 P70	L63-E67 WeakPolarHBondContact O-CG 3.42Å; L63-E67 PolarHBondContact O-N 2.62Å; E67-V69 VanDerWaalsContact C-N 3.29Å; E67-P70 VanDerWaalsContact O-CD 3.28Å; E67-P70 WeakPolarHBondContact O-CD 3.3Å; E67-P70 WeakPolarHBondContact O-CG 3.33Å
68	Q	58.3	Low	69.8	Low	158 Å²	158	140.1 Å²	140.1	74%	0.738	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	-4.1	173.8	-74.9	179.1	57.9	0	0	114.1	A64 M65 P70	A64-Q68 WeakPolarHBondContact O-CB 3.49Å; A64-Q68 VanDerWaalsContact O-CG 3.29Å; A64-Q68 WeakPolarHBondContact O-CG 3.33Å; A64-Q68 PolarHBondContact O-N 3.48Å; A64-Q68 VanDerWaalsContact O-N 3.11Å; A64-Q68 PolarHBondContact O-NE2 3.33Å; M65-Q68 PolarHBondContact O-N 2.99Å; Q68-P70 VanDerWaalsContact O-CD 3.23Å; Q68-P70 WeakPolarHBondContact O-CD 3.3Å
69	V	57.9	Low	68.4	Low	123 Å²	123	143.6 Å²	143.6	75%	0.745	72%	0.72	S	S	*	*			trans	-96.8	75.1	166.7	-174.2	0	0	0	0	111	M65 E67	M65-V69 WeakPolarHBondContact O-CG2 3.39Å; M65-V69 PolarHBondContact O-N 3.06Å; E67-V69 VanDerWaalsContact C-N 3.29Å
70	P	47.2	Very low	66.8	Low	89 Å²	89	144.1 Å²	144.1	58%	0.578	73%	0.728	S	S	*	*			trans	-120.4	117.9	150.5	14.6	7.2	0	0	0	111.6	E67 Q68	E67-P70 VanDerWaalsContact O-CD 3.28Å; E67-P70 WeakPolarHBondContact O-CD 3.3Å; E67-P70 WeakPolarHBondContact O-CG 3.33Å; Q68-P70 VanDerWaalsContact O-CD 3.23Å; Q68-P70 WeakPolarHBondContact O-CD 3.3Å
71	R	54.1	Low	65.2	Low	230 Å²	230	145.9 Å²	145.9	87%	0.868	74%	0.74	S	S	*	*			trans	78.5	48.2	149	-47.8	-176.2	-165.4	171	5.8	120.7
72	T	54.2	Low	63.6	Low	152 Å²	152	147.3 Å²	147.3	93%	0.933	75%	0.75	S	S	*	*	S	Bend	trans	-95	3	157.9	47.5	0	0	0	0	114.7
73	H	54.1	Low	61.7	Low	187 Å²	187	148.9 Å²	148.9	87%	0.866	76%	0.762	S	S	*	*	S	Bend	trans	-116.7	36.2	179	-147.6	-71.3	0	0	0	114.8
74	K	50.9	Low	59.6	Low	199 Å²	199	153 Å²	153	87%	0.865	78%	0.782	S	S	*	*	S	Bend	trans	-126.1	64.2	164.7	-92.6	-164	177	-172.2	0	110.3
75	A	47	Very low	57.5	Low	93 Å²	93	162.4 Å²	162.4	77%	0.769	82%	0.82	S	S	*	*			trans	-170.6	88.2	157.5	0	0	0	0	0	108.1
76	L	42.9	Very low	55.4	Low	256 Å²	256	164.9 Å²	164.9	100%	1.34	83%	0.834	S	S	*	*			trans	-166.3	0	148.2	-99	162.1	0	0	0	107.3

Retrieved 76 of 76 residues in 73.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).