A0A087XIF2_POEFO Loading...

NADH dehydrogenase [ubiquinone] 1 subunit C2

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087XIF2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 110 aa.

						>A0A087XIF2_POEFO|A0A087XIF2
MGIVPEDGKALPPPGIVNRNSVWLSGMGWFSAMLHNAFNHRPPLKSGVHRQFLLATLGWFIGYHLTKHENYTYARLDRDMNEYVKLYPERFETKEKKTLAEIVEPFHPVR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.6	Low	76.9	Confident	247 Å²	247	93.6 Å²	93.6	100%	1.217	53%	0.529	S	S	*	.				0	118.4	0	-75.5	174.8	175.2	0	0	107.4
2	G	63.7	Low	78	Confident	59 Å²	59	94.5 Å²	94.5	61%	0.608	54%	0.541	S	S	*	.			trans	-69.1	170.9	179.5	0	0	0	0	0	112.4	V4	G2-V4 PolarHBondContact O-N 3.37Å
3	I	70.2	Confident	78.9	Confident	128 Å²	128	94.5 Å²	94.5	66%	0.656	55%	0.547	S	S	*	.	S	Bend	trans	-56.1	-21.5	174.9	-67.9	166.4	0	0	0	112.5	H68	I3-H68 PolarHBondContact O-ND1 3.08Å
4	V	77.3	Confident	79.8	Confident	18 Å²	18	88.8 Å²	88.8	11%	0.109	51%	0.514	C	S	.	.	S	Bend	trans	-123.3	129.2	173.9	-179.3	0	0	0	0	108.2	G2 K67 H68 Y71	G2-V4 PolarHBondContact O-N 3.37Å; V4-K67 HydrophobicContact CG2-CD 4.18Å; V4-K67 HydrophobicContact CG2-CG 4.09Å; V4-H68 HydrophobicContact CG2-CB 4.46Å; V4-Y71 HydrophobicContact CG1-CD2 4.33Å; V4-Y71 HydrophobicContact CG1-CG 4.13Å
5	P	83.3	Confident	80.5	Confident	55 Å²	55	85.9 Å²	85.9	36%	0.357	51%	0.512	S	S	.	.			trans	-58.8	163.1	174.9	-26.6	37.8	0	0	0	113.1	D7 G8 Y71	P5-D7 PolarHBondContact O-N 3.5Å; P5-G8 PolarHBondContact O-N 2.99Å; P5-Y71 HydrophobicContact CG-CE1 3.82Å; P5-Y71 HydrophobicContact CG-CE2 4.48Å
6	E	82.7	Confident	80.9	Confident	128 Å²	128	89.1 Å²	89.1	60%	0.598	52%	0.523	S	S	*	.	G	3₁₀ helix	trans	-56.2	-38.6	179	-68.3	-63.5	136.6	0	0	112.2	G8 K9	E6-G8 PolarHBondContact O-N 3.22Å; E6-K9 VanDerWaalsContact O-CB 3.25Å; E6-K9 WeakPolarHBondContact O-CB 3.46Å; E6-K9 WeakPolarHBondContact O-CG 3.47Å; E6-K9 PolarHBondContact O-N 2.92Å; E6-K9 WeakPolarHBondContact OE1-CE 3.27Å; E6-K9 IonicContact OE1-NZ 2.76Å; E6-K9 PolarHBondContact OE1-NZ 3.3Å; E6-K9 WeakPolarHBondContact OE2-CD 3.49Å; E6-K9 WeakPolarHBondContact OE2-CE 3.48Å; E6-K9 IonicContact OE2-NZ 2.61Å; E6-K9 PolarHBondContact OE2-NZ 3.17Å
7	D	78.6	Confident	81.4	Confident	110 Å²	110	90.4 Å²	90.4	59%	0.588	53%	0.532	S	S	*	.	G	3₁₀ helix	trans	-57.5	-32.2	175.3	-58.6	-11.3	0	0	0	112.7	P5 K9 A10 Y71	P5-D7 PolarHBondContact O-N 3.5Å; D7-K9 PolarHBondContact O-N 3.49Å; D7-A10 WeakPolarHBondContact O-CB 3.38Å; D7-A10 PolarHBondContact O-N 3.48Å; D7-Y71 HydrophobicContact CB-CE2 4.41Å
8	G	79	Confident	82	Confident	4 Å²	4	86.4 Å²	86.4	4%	0.041	51%	0.509	C	S	.	.	G	3₁₀ helix	trans	-73.4	-7.1	177.6	0	0	0	0	0	114.1	P5 E6 A10 Y71	P5-G8 PolarHBondContact O-N 2.99Å; E6-G8 PolarHBondContact O-N 3.22Å; G8-A10 VanDerWaalsContact C-N 3.29Å; G8-Y71 VanDerWaalsContact CA-CD2 3.45Å
9	K	82.7	Confident	82.5	Confident	130 Å²	130	93.6 Å²	93.6	57%	0.565	53%	0.526	S	S	*	.	G	3₁₀ helix	trans	-76.2	-18.2	171.3	-61.9	-179.2	-177.1	169.9	0	112.7	E6 D7	E6-K9 VanDerWaalsContact O-CB 3.25Å; E6-K9 WeakPolarHBondContact O-CB 3.46Å; E6-K9 WeakPolarHBondContact O-CG 3.47Å; E6-K9 PolarHBondContact O-N 2.92Å; E6-K9 WeakPolarHBondContact OE1-CE 3.27Å; E6-K9 IonicContact OE1-NZ 2.76Å; E6-K9 PolarHBondContact OE1-NZ 3.3Å; E6-K9 WeakPolarHBondContact OE2-CD 3.49Å; E6-K9 WeakPolarHBondContact OE2-CE 3.48Å; E6-K9 IonicContact OE2-NZ 2.61Å; E6-K9 PolarHBondContact OE2-NZ 3.17Å; D7-K9 PolarHBondContact O-N 3.49Å
10	A	88.4	Confident	82.9	Confident	95 Å²	95	91.7 Å²	91.7	79%	0.785	51%	0.514	S	S	*	.	S	Bend	trans	-73.7	-18.5	174.8	0	0	0	0	0	112.7	D7 G8	D7-A10 WeakPolarHBondContact O-CB 3.38Å; D7-A10 PolarHBondContact O-N 3.48Å; G8-A10 VanDerWaalsContact C-N 3.29Å
11	L	89.4	Confident	83.4	Confident	56 Å²	56	87.3 Å²	87.3	29%	0.293	49%	0.49	S	S	.	.	S	Bend	trans	-77.4	145.6	179.3	-63.2	173.1	0	0	0	111.1	Y71 A74	L11-Y71 HydrophobicContact CD1-CD2 4.05Å; L11-A74 HydrophobicContact CD1-CB 3.73Å; L11-A74 HydrophobicContact CD2-CB 3.69Å; L11-A74 HydrophobicContact CG-CB 4.38Å
12	P	90.6	Very high	85.5	Confident	104 Å²	104	78.9 Å²	78.9	68%	0.675	45%	0.452	S	S	*	.	P	Polyproline II helix	trans	-59.8	129.4	174.8	25.5	-33.3	0	0	0	109.4
13	P	89.3	Confident	87	Confident	95 Å²	95	84.7 Å²	84.7	62%	0.617	46%	0.456	S	S	*	.	P	Polyproline II helix	trans	-64.8	148.8	178.8	27.6	-34	0	0	0	110
14	P	91.3	Very high	88.2	Confident	14 Å²	14	80.9 Å²	80.9	9%	0.091	44%	0.436	C	S	.	.	P	Polyproline II helix	trans	-61.6	147.3	173.3	25.6	-30.6	0	0	0	110.1	Y63 T66 K67	P14-Y63 HydrophobicContact CB-CE2 4.49Å; P14-Y63 HydrophobicContact CG-CD2 3.99Å; P14-Y63 HydrophobicContact CG-CE2 3.69Å; P14-Y63 WeakPolarHBondContact O-CE2 3.29Å; P14-T66 HydrophobicContact CB-CG2 3.72Å; P14-T66 HydrophobicContact CG-CG2 4.32Å; P14-K67 HydrophobicContact CG-CB 4.24Å
15	G	90.1	Very high	89.1	Confident	46 Å²	46	81.1 Å²	81.1	47%	0.474	44%	0.439	S	S	.	.	P	Polyproline II helix	trans	-57	150	172.6	0	0	0	0	0	111.1	V17 N18	G15-V17 PolarHBondContact O-N 3.45Å; G15-N18 PolarHBondContact O-ND2 3.31Å
16	I	87.6	Confident	89.7	Confident	136 Å²	136	80.1 Å²	80.1	70%	0.697	44%	0.438	S	S	*	.	S	Bend	trans	-54.5	-46.1	176.4	-62.7	171.5	0	0	0	109.2	W59	I16-W59 HydrophobicContact CG2-CZ2 4.4Å; I16-W59 VanDerWaalsContact O-CE2 3.32Å; I16-W59 WeakPolarHBondContact O-CZ2 3.46Å; I16-W59 PolarHBondContact O-NE1 3.16Å
17	V	89.4	Confident	90.3	Very high	111 Å²	111	78.8 Å²	78.8	67%	0.673	43%	0.434	S	S	*	.	S	Bend	trans	-94	99.2	171.2	-174.4	0	0	0	0	108.5	G15 V22 W59	G15-V17 PolarHBondContact O-N 3.45Å; V17-V22 HydrophobicContact CG1-CG2 3.88Å; V17-W59 HydrophobicContact CB-CH2 4.32Å; V17-W59 HydrophobicContact CB-CZ2 4.44Å; V17-W59 HydrophobicContact CG1-CH2 4.2Å; V17-W59 HydrophobicContact CG2-CH2 4.04Å; V17-W59 HydrophobicContact CG2-CZ2 4.1Å
18	N	91.7	Very high	91.1	Very high	20 Å²	20	74.2 Å²	74.2	11%	0.107	41%	0.412	C	S	.	.			trans	-119.4	158.9	173.2	72.9	53.7	0	0	0	110.2	G15 N20 S21 V22	G15-N18 PolarHBondContact O-ND2 3.31Å; N18-N20 VanDerWaalsContact C-N 3.32Å; N18-N20 PolarHBondContact O-N 3.23Å; N18-N20 PolarHBondContact OD1-N 3.3Å; N18-N20 VanDerWaalsContact OD1-N 3.13Å; N18-S21 PolarHBondContact ND2-OG 3.07Å; N18-S21 PolarHBondContact O-N 3.27Å; N18-S21 WeakPolarHBondContact OD1-CB 3.42Å; N18-S21 PolarHBondContact OD1-N 3.27Å; N18-S21 PolarHBondContact OD1-OG 3.19Å; N18-V22 VanDerWaalsContact O-CG2 3.28Å; N18-V22 WeakPolarHBondContact O-CG2 3.39Å; N18-V22 PolarHBondContact O-N 3.43Å
19	R	91.1	Very high	91.8	Very high	222 Å²	222	79.2 Å²	79.2	84%	0.838	43%	0.43	S	S	*	.	H	α-helix	trans	-56.5	-44	-176.6	-177.5	-179.3	177.5	-174.4	-1	112.3	W23	R19-W23 VanDerWaalsContact O-CB 3.28Å; R19-W23 WeakPolarHBondContact O-CB 3.43Å; R19-W23 PolarHBondContact O-N 3.07Å
20	N	91.8	Very high	92.4	Very high	55 Å²	55	78.5 Å²	78.5	29%	0.294	43%	0.427	S	S	.	.	H	α-helix	trans	-73	-40.4	-173.7	-61.8	-8.7	0	0	0	111.8	N18 W23 L24 T66 E69	N18-N20 VanDerWaalsContact C-N 3.32Å; N18-N20 PolarHBondContact O-N 3.23Å; N18-N20 PolarHBondContact OD1-N 3.3Å; N18-N20 VanDerWaalsContact OD1-N 3.13Å; N20-W23 PolarHBondContact O-N 3.25Å; N20-L24 VanDerWaalsContact O-CB 3.29Å; N20-L24 WeakPolarHBondContact O-CB 3.48Å; N20-L24 WeakPolarHBondContact O-CG 3.28Å; N20-L24 PolarHBondContact O-N 3.2Å; N20-T66 WeakPolarHBondContact CB-OG1 3.3Å; N20-T66 PolarHBondContact ND2-OG1 3.02Å; N20-T66 VanDerWaalsContact ND2-OG1 3.16Å; N20-E69 PolarHBondContact ND2-OE2 3.33Å
21	S	92.5	Very high	92.7	Very high	0 Å²	0	77.1 Å²	77.1	0%	0	41%	0.412	C	S	.	.	H	α-helix	trans	-62.1	-45.2	173.3	-73.3	0	0	0	0	111.5	N18 S25 W59 G62 Y63	N18-S21 PolarHBondContact ND2-OG 3.07Å; N18-S21 PolarHBondContact O-N 3.27Å; N18-S21 WeakPolarHBondContact OD1-CB 3.42Å; N18-S21 PolarHBondContact OD1-N 3.27Å; N18-S21 PolarHBondContact OD1-OG 3.19Å; S21-S25 WeakPolarHBondContact O-CB 3.28Å; S21-S25 PolarHBondContact O-N 3.04Å; S21-W59 PolarHBondContact OG-O 3.47Å; S21-W59 VanDerWaalsContact OG-O 3.08Å; S21-G62 VanDerWaalsContact OG-C 3.25Å; S21-Y63 WeakPolarHBondContact OG-CA 3.33Å; S21-Y63 PolarHBondContact OG-N 3.24Å
22	V	95.1	Very high	92.8	Very high	70 Å²	70	74.5 Å²	74.5	42%	0.424	40%	0.398	S	S	.	.	H	α-helix	trans	-62.8	-45.4	175.6	172.9	0	0	0	0	110.3	V17 N18 S25 G26 W59	V17-V22 HydrophobicContact CG1-CG2 3.88Å; N18-V22 VanDerWaalsContact O-CG2 3.28Å; N18-V22 WeakPolarHBondContact O-CG2 3.39Å; N18-V22 PolarHBondContact O-N 3.43Å; V22-S25 PolarHBondContact O-N 3.09Å; V22-G26 PolarHBondContact O-N 2.91Å; V22-W59 HydrophobicContact CB-CZ3 4.39Å; V22-W59 HydrophobicContact CG2-CH2 3.81Å; V22-W59 HydrophobicContact CG2-CZ3 3.62Å
23	W	95.4	Very high	92.9	Very high	182 Å²	182	71.1 Å²	71.1	69%	0.689	37%	0.373	S	S	*	.	H	α-helix	trans	-62.8	-49.4	179.2	-175.2	-107.3	0	0	0	112.5	R19 N20 S25 G26 M27	R19-W23 VanDerWaalsContact O-CB 3.28Å; R19-W23 WeakPolarHBondContact O-CB 3.43Å; R19-W23 PolarHBondContact O-N 3.07Å; N20-W23 PolarHBondContact O-N 3.25Å; W23-S25 PolarHBondContact O-N 3.28Å; W23-G26 CarbonylContact O-C 3.57Å; W23-G26 WeakPolarHBondContact O-CA 3.4Å; W23-G26 PolarHBondContact O-N 3.47Å; W23-G26 VanDerWaalsContact O-N 3.12Å; W23-M27 PolarHBondContact NE1-SD 3.45Å; W23-M27 VanDerWaalsContact NE1-SD 3.37Å; W23-M27 WeakPolarHBondContact O-CG 3.32Å; W23-M27 PolarHBondContact O-N 2.92Å
24	L	95	Very high	93.2	Very high	47 Å²	47	69.9 Å²	69.9	25%	0.246	36%	0.361	C	S	.	.	H	α-helix	trans	-68.5	-33.9	179.8	-74	169.2	0	0	0	112.5	N20 G26 M27 G28 G58 L65	N20-L24 VanDerWaalsContact O-CB 3.29Å; N20-L24 WeakPolarHBondContact O-CB 3.48Å; N20-L24 WeakPolarHBondContact O-CG 3.28Å; N20-L24 PolarHBondContact O-N 3.2Å; L24-G26 VanDerWaalsContact C-N 3.34Å; L24-M27 HydrophobicContact CD2-SD 4.17Å; L24-M27 PolarHBondContact O-N 3Å; L24-G28 PolarHBondContact O-N 3.47Å; L24-G58 VanDerWaalsContact CB-O 3.32Å; L24-G58 WeakPolarHBondContact CB-O 3.32Å; L24-L65 HydrophobicContact CD1-CD1 3.9Å
25	S	95.5	Very high	93.2	Very high	24 Å²	24	73.5 Å²	73.5	17%	0.168	38%	0.376	C	S	.	.	H	α-helix	trans	-61.5	-43.5	168.8	178.8	0	0	0	0	111.3	S21 V22 W23 G28 W29 A55	S21-S25 WeakPolarHBondContact O-CB 3.28Å; S21-S25 PolarHBondContact O-N 3.04Å; V22-S25 PolarHBondContact O-N 3.09Å; W23-S25 PolarHBondContact O-N 3.28Å; S25-G28 PolarHBondContact O-N 2.97Å; S25-W29 WeakPolarHBondContact O-CB 3.32Å; S25-W29 PolarHBondContact O-N 3.45Å; S25-A55 WeakPolarHBondContact CA-O 3.22Å; S25-A55 WeakPolarHBondContact CB-O 3.39Å; S25-A55 PolarHBondContact OG-O 3.28Å
26	G	95.7	Very high	93.3	Very high	33 Å²	33	71.3 Å²	71.3	34%	0.34	35%	0.354	S	S	.	.	H	α-helix	trans	-60.9	-44.1	174.2	0	0	0	0	0	112.4	V22 W23 L24 W29 F30	V22-G26 PolarHBondContact O-N 2.91Å; W23-G26 CarbonylContact O-C 3.57Å; W23-G26 WeakPolarHBondContact O-CA 3.4Å; W23-G26 PolarHBondContact O-N 3.47Å; W23-G26 VanDerWaalsContact O-N 3.12Å; L24-G26 VanDerWaalsContact C-N 3.34Å; G26-W29 PolarHBondContact O-N 2.76Å; G26-F30 WeakPolarHBondContact O-CB 3.36Å; G26-F30 PolarHBondContact O-N 2.61Å
27	M	96.4	Very high	93.5	Very high	101 Å²	101	67 Å²	67	50%	0.498	34%	0.339	S	S	.	.	H	α-helix	trans	-63.6	-42	175.1	-69.7	-177.5	67.2	0	0	112.5	W23 L24 F30 S31	W23-M27 PolarHBondContact NE1-SD 3.45Å; W23-M27 VanDerWaalsContact NE1-SD 3.37Å; W23-M27 WeakPolarHBondContact O-CG 3.32Å; W23-M27 PolarHBondContact O-N 2.92Å; L24-M27 HydrophobicContact CD2-SD 4.17Å; L24-M27 PolarHBondContact O-N 3Å; M27-F30 PolarHBondContact O-N 3.23Å; M27-S31 WeakPolarHBondContact O-CB 3.39Å; M27-S31 PolarHBondContact O-N 3.04Å
28	G	94.9	Very high	93.7	Very high	13 Å²	13	69.1 Å²	69.1	13%	0.134	34%	0.339	C	S	.	.	H	α-helix	trans	-62.7	-43.7	176.1	0	0	0	0	0	112.1	L24 S25 S31 A32 L54	L24-G28 PolarHBondContact O-N 3.47Å; S25-G28 PolarHBondContact O-N 2.97Å; G28-S31 PolarHBondContact O-N 3.28Å; G28-A32 PolarHBondContact O-N 2.96Å; G28-A32 VanDerWaalsContact O-N 3.1Å; G28-L54 VanDerWaalsContact O-CB 3.3Å; G28-L54 WeakPolarHBondContact O-CB 3.19Å
29	W	94.3	Very high	93.8	Very high	109 Å²	109	71.9 Å²	71.9	41%	0.413	35%	0.354	S	S	.	.	H	α-helix	trans	-62	-46.4	173.9	-178.7	61.8	0	0	0	112.3	S25 G26 S31 A32 M33 L44 A55	S25-W29 WeakPolarHBondContact O-CB 3.32Å; S25-W29 PolarHBondContact O-N 3.45Å; G26-W29 PolarHBondContact O-N 2.76Å; W29-S31 VanDerWaalsContact C-N 3.33Å; W29-S31 PolarHBondContact O-N 2.94Å; W29-A32 VanDerWaalsContact O-CB 3.3Å; W29-A32 WeakPolarHBondContact O-CB 3.41Å; W29-A32 PolarHBondContact O-N 3.37Å; W29-A32 VanDerWaalsContact O-N 3.11Å; W29-M33 HydrophobicContact CD2-SD 3.84Å; W29-M33 VanDerWaalsContact CE2-SD 3.52Å; W29-M33 HydrophobicContact CE3-SD 3.95Å; W29-M33 HydrophobicContact CH2-CE 4.46Å; W29-M33 HydrophobicContact CH2-SD 3.51Å; W29-M33 VanDerWaalsContact CH2-SD 3.51Å; W29-M33 HydrophobicContact CZ2-CG 4.48Å; W29-M33 HydrophobicContact CZ2-SD 3.36Å; W29-M33 WeakPolarHBondContact CZ2-SD 3.25Å; W29-M33 HydrophobicContact CZ3-SD 3.8Å; W29-M33 PolarHBondContact O-N 3.46Å; W29-L44 HydrophobicContact CH2-CD2 4.4Å; W29-L44 HydrophobicContact CZ2-CD2 3.98Å; W29-A55 HydrophobicContact CB-CB 4.21Å
30	F	94.6	Very high	93.8	Very high	116 Å²	116	70.2 Å²	70.2	51%	0.509	36%	0.355	S	S	.	.	H	α-helix	trans	-62	-40.4	178	-175	-111	0	0	0	112.1	G26 M27 A32 M33 L34	G26-F30 WeakPolarHBondContact O-CB 3.36Å; G26-F30 PolarHBondContact O-N 2.61Å; M27-F30 PolarHBondContact O-N 3.23Å; F30-A32 VanDerWaalsContact C-N 3.31Å; F30-A32 PolarHBondContact O-N 3.28Å; F30-M33 WeakPolarHBondContact O-CB 3.46Å; F30-M33 PolarHBondContact O-N 3.45Å; F30-L34 HydrophobicContact CD1-CD1 3.79Å; F30-L34 HydrophobicContact CD1-CG 4.18Å; F30-L34 HydrophobicContact CE1-CD1 3.39Å; F30-L34 HydrophobicContact CE1-CD2 4.32Å; F30-L34 HydrophobicContact CE1-CG 3.85Å; F30-L34 HydrophobicContact CE2-CG 4.47Å; F30-L34 HydrophobicContact CZ-CD1 4Å; F30-L34 HydrophobicContact CZ-CD2 4.06Å; F30-L34 HydrophobicContact CZ-CG 3.99Å; F30-L34 WeakPolarHBondContact O-CG 3.2Å; F30-L34 PolarHBondContact O-N 3.49Å
31	S	94	Very high	93.6	Very high	66 Å²	66	74.2 Å²	74.2	46%	0.462	37%	0.366	S	S	.	.	H	α-helix	trans	-58.7	-42.2	173.1	-176.5	0	0	0	0	111.9	M27 G28 W29 M33 L34 H35	M27-S31 WeakPolarHBondContact O-CB 3.39Å; M27-S31 PolarHBondContact O-N 3.04Å; G28-S31 PolarHBondContact O-N 3.28Å; W29-S31 VanDerWaalsContact C-N 3.33Å; W29-S31 PolarHBondContact O-N 2.94Å; S31-M33 VanDerWaalsContact C-N 3.33Å; S31-M33 PolarHBondContact O-N 2.98Å; S31-L34 PolarHBondContact O-N 3.19Å; S31-H35 WeakPolarHBondContact O-CB 3.18Å; S31-H35 PolarHBondContact O-N 3.26Å
32	A	93.2	Very high	93.5	Very high	0 Å²	0	77.9 Å²	77.9	0%	0	39%	0.39	C	S	.	.	H	α-helix	trans	-62.6	-40	176.9	0	0	0	0	0	112.8	G28 W29 F30 N36 R50 Q51 L54	G28-A32 PolarHBondContact O-N 2.96Å; G28-A32 VanDerWaalsContact O-N 3.1Å; W29-A32 VanDerWaalsContact O-CB 3.3Å; W29-A32 WeakPolarHBondContact O-CB 3.41Å; W29-A32 PolarHBondContact O-N 3.37Å; W29-A32 VanDerWaalsContact O-N 3.11Å; F30-A32 VanDerWaalsContact C-N 3.31Å; F30-A32 PolarHBondContact O-N 3.28Å; A32-N36 PolarHBondContact O-N 3.26Å; A32-N36 VanDerWaalsContact O-N 3.13Å; A32-N36 PolarHBondContact O-ND2 2.94Å; A32-R50 PolarHBondContact O-NH2 2.94Å; A32-Q51 HydrophobicContact CB-CB 4.25Å; A32-Q51 HydrophobicContact CB-CG 3.88Å; A32-L54 HydrophobicContact CB-CB 4.29Å; A32-L54 HydrophobicContact CB-CD1 3.54Å; A32-L54 HydrophobicContact CB-CG 4.46Å
33	M	93	Very high	92.9	Very high	33 Å²	33	77.1 Å²	77.1	16%	0.163	39%	0.386	C	S	.	.	H	α-helix	trans	-67.8	-44.1	175.8	-70.7	177.3	57	0	0	111.9	W29 F30 S31 H35 N36 A37 L44	W29-M33 HydrophobicContact CD2-SD 3.84Å; W29-M33 VanDerWaalsContact CE2-SD 3.52Å; W29-M33 HydrophobicContact CE3-SD 3.95Å; W29-M33 HydrophobicContact CH2-CE 4.46Å; W29-M33 HydrophobicContact CH2-SD 3.51Å; W29-M33 VanDerWaalsContact CH2-SD 3.51Å; W29-M33 HydrophobicContact CZ2-CG 4.48Å; W29-M33 HydrophobicContact CZ2-SD 3.36Å; W29-M33 WeakPolarHBondContact CZ2-SD 3.25Å; W29-M33 HydrophobicContact CZ3-SD 3.8Å; W29-M33 PolarHBondContact O-N 3.46Å; F30-M33 WeakPolarHBondContact O-CB 3.46Å; F30-M33 PolarHBondContact O-N 3.45Å; S31-M33 VanDerWaalsContact C-N 3.33Å; S31-M33 PolarHBondContact O-N 2.98Å; M33-H35 VanDerWaalsContact C-N 3.31Å; M33-H35 PolarHBondContact O-N 3.4Å; M33-N36 WeakPolarHBondContact O-CB 3.4Å; M33-N36 PolarHBondContact O-N 3.32Å; M33-N36 VanDerWaalsContact O-N 3.1Å; M33-A37 PolarHBondContact O-N 3Å; M33-L44 HydrophobicContact CE-CD2 3.55Å; M33-L44 HydrophobicContact CE-CG 4.25Å; M33-L44 HydrophobicContact SD-CD2 3.93Å
34	L	93.6	Very high	92.4	Very high	69 Å²	69	73.3 Å²	73.3	36%	0.361	38%	0.379	S	S	.	.	H	α-helix	trans	-60.1	-43.3	175	-78	-179.7	0	0	0	111.3	F30 S31 N36 A37 F38	F30-L34 HydrophobicContact CD1-CD1 3.79Å; F30-L34 HydrophobicContact CD1-CG 4.18Å; F30-L34 HydrophobicContact CE1-CD1 3.39Å; F30-L34 HydrophobicContact CE1-CD2 4.32Å; F30-L34 HydrophobicContact CE1-CG 3.85Å; F30-L34 HydrophobicContact CE2-CG 4.47Å; F30-L34 HydrophobicContact CZ-CD1 4Å; F30-L34 HydrophobicContact CZ-CD2 4.06Å; F30-L34 HydrophobicContact CZ-CG 3.99Å; F30-L34 WeakPolarHBondContact O-CG 3.2Å; F30-L34 PolarHBondContact O-N 3.49Å; S31-L34 PolarHBondContact O-N 3.19Å; L34-N36 VanDerWaalsContact C-N 3.26Å; L34-N36 PolarHBondContact O-N 3.27Å; L34-A37 WeakPolarHBondContact O-CB 3.48Å; L34-A37 PolarHBondContact O-N 3.01Å; L34-A37 VanDerWaalsContact O-N 3.09Å; L34-F38 HydrophobicContact CB-CE2 4.34Å; L34-F38 VanDerWaalsContact O-CD2 3.28Å; L34-F38 WeakPolarHBondContact O-CD2 3.46Å; L34-F38 PolarHBondContact O-N 2.92Å
35	H	92.8	Very high	92	Very high	90 Å²	90	79.7 Å²	79.7	42%	0.417	41%	0.405	S	S	.	.	H	α-helix	trans	-62.3	-33.6	175.5	-176.3	-80.1	0	0	0	112.2	S31 M33 N39 R50	S31-H35 WeakPolarHBondContact O-CB 3.18Å; S31-H35 PolarHBondContact O-N 3.26Å; M33-H35 VanDerWaalsContact C-N 3.31Å; M33-H35 PolarHBondContact O-N 3.4Å; H35-N39 PolarHBondContact CE1-ND2 2.81Å; H35-N39 PolarHBondContact ND1-ND2 3.45Å; H35-N39 PolarHBondContact O-N 3.49Å; H35-N39 PolarHBondContact O-ND2 3.28Å; H35-R50 PolarHBondContact CE1-NH1 3.32Å; H35-R50 VanDerWaalsContact CE1-NH1 3.33Å; H35-R50 PolarHBondContact ND1-NH1 3.16Å; H35-R50 PolarHBondContact ND1-NH2 2.97Å
36	N	92.1	Very high	91.6	Very high	1 Å²	1	79.6 Å²	79.6	1%	0.005	40%	0.404	C	S	.	.	H	α-helix	trans	-68.4	-42.7	171.4	-75.3	-33.8	0	0	0	112.1	A32 M33 L34 N39 H40 R41 P43 S46 R50	A32-N36 PolarHBondContact O-N 3.26Å; A32-N36 VanDerWaalsContact O-N 3.13Å; A32-N36 PolarHBondContact O-ND2 2.94Å; M33-N36 WeakPolarHBondContact O-CB 3.4Å; M33-N36 PolarHBondContact O-N 3.32Å; M33-N36 VanDerWaalsContact O-N 3.1Å; L34-N36 VanDerWaalsContact C-N 3.26Å; L34-N36 PolarHBondContact O-N 3.27Å; N36-N39 PolarHBondContact O-N 3.47Å; N36-H40 PolarHBondContact O-N 3.47Å; N36-R41 HydrophobicContact CB-CB 4.45Å; N36-R41 PolarHBondContact O-N 2.97Å; N36-P43 PolarHBondContact ND2-O 3.29Å; N36-P43 VanDerWaalsContact ND2-O 3.07Å; N36-S46 PolarHBondContact ND2-O 2.98Å; N36-S46 PolarHBondContact OD1-OG 3.11Å; N36-R50 VanDerWaalsContact CG-NH2 3.29Å; N36-R50 PolarHBondContact OD1-NH2 2.92Å
37	A	91.5	Very high	91.1	Very high	45 Å²	45	78.8 Å²	78.8	37%	0.372	40%	0.396	S	S	.	.	H	α-helix	trans	-62.1	-44.8	179.9	0	0	0	0	0	112	M33 L34 N39 H40 P43	M33-A37 PolarHBondContact O-N 3Å; L34-A37 WeakPolarHBondContact O-CB 3.48Å; L34-A37 PolarHBondContact O-N 3.01Å; L34-A37 VanDerWaalsContact O-N 3.09Å; A37-N39 PolarHBondContact O-N 2.96Å; A37-H40 PolarHBondContact O-N 3.04Å; A37-H40 VanDerWaalsContact O-N 3.07Å; A37-P43 HydrophobicContact CB-CG 4.13Å
38	F	93.8	Very high	90.8	Very high	156 Å²	156	78.1 Å²	78.1	68%	0.684	40%	0.397	S	S	*	.	H	α-helix	trans	-62.5	-29.7	176.4	-70.5	-45.3	0	0	0	113.4	L34 H40	L34-F38 HydrophobicContact CB-CE2 4.34Å; L34-F38 VanDerWaalsContact O-CD2 3.28Å; L34-F38 WeakPolarHBondContact O-CD2 3.46Å; L34-F38 PolarHBondContact O-N 2.92Å; F38-H40 PolarHBondContact O-N 3.04Å
39	N	92.6	Very high	90.8	Very high	78 Å²	78	84.6 Å²	84.6	42%	0.417	42%	0.423	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.6	14.7	177.4	-72.7	-56.3	0	0	0	113.2	H35 N36 A37 R41	H35-N39 PolarHBondContact CE1-ND2 2.81Å; H35-N39 PolarHBondContact ND1-ND2 3.45Å; H35-N39 PolarHBondContact O-N 3.49Å; H35-N39 PolarHBondContact O-ND2 3.28Å; N36-N39 PolarHBondContact O-N 3.47Å; A37-N39 PolarHBondContact O-N 2.96Å; N39-R41 HydrophobicContact CB-CG 4.17Å; N39-R41 WeakPolarHBondContact O-CG 2.99Å; N39-R41 PolarHBondContact O-N 3.45Å; N39-R41 VanDerWaalsContact O-N 3.09Å
40	H	91.3	Very high	90.6	Very high	187 Å²	187	82.1 Å²	82.1	87%	0.866	41%	0.414	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.7	29.9	-176.4	-58.1	-74.8	0	0	0	113.7	N36 A37 F38	N36-H40 PolarHBondContact O-N 3.47Å; A37-H40 PolarHBondContact O-N 3.04Å; A37-H40 VanDerWaalsContact O-N 3.07Å; F38-H40 PolarHBondContact O-N 3.04Å
41	R	89	Confident	90.4	Very high	139 Å²	139	77.3 Å²	77.3	53%	0.525	39%	0.393	S	S	.	.	S	Bend	trans	-98.2	150.9	175.2	-59.1	-172.7	-172.5	-168.4	1.3	109.5	N36 N39 P43 S46	N36-R41 HydrophobicContact CB-CB 4.45Å; N36-R41 PolarHBondContact O-N 2.97Å; N39-R41 HydrophobicContact CB-CG 4.17Å; N39-R41 WeakPolarHBondContact O-CG 2.99Å; N39-R41 PolarHBondContact O-N 3.45Å; N39-R41 VanDerWaalsContact O-N 3.09Å; R41-P43 WeakPolarHBondContact O-CD 3.43Å; R41-P43 VanDerWaalsContact O-N 3.07Å; R41-S46 WeakPolarHBondContact CD-OG 3.5Å
42	P	89.1	Confident	90.5	Very high	76 Å²	76	81.1 Å²	81.1	49%	0.494	40%	0.402	S	S	.	.			trans	-58.3	115.8	176.7	22.8	-32.8	0	0	0	110.1	L44 K45 S46	P42-L44 VanDerWaalsContact C-N 3.33Å; P42-L44 PolarHBondContact O-N 3.06Å; P42-K45 HydrophobicContact CB-CB 4.18Å; P42-K45 HydrophobicContact CG-CB 4.22Å; P42-K45 PolarHBondContact O-N 3.4Å; P42-S46 VanDerWaalsContact O-CB 3.3Å; P42-S46 WeakPolarHBondContact O-CB 3.45Å; P42-S46 PolarHBondContact O-N 3.32Å
43	P	83.8	Confident	90.5	Very high	54 Å²	54	85.8 Å²	85.8	35%	0.351	43%	0.426	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59	-39.7	-165.3	-29.7	36.3	0	0	0	114.7	N36 A37 R41 Q51	N36-P43 PolarHBondContact ND2-O 3.29Å; N36-P43 VanDerWaalsContact ND2-O 3.07Å; A37-P43 HydrophobicContact CB-CG 4.13Å; R41-P43 WeakPolarHBondContact O-CD 3.43Å; R41-P43 VanDerWaalsContact O-N 3.07Å; P43-Q51 PolarHBondContact O-NE2 2.69Å
44	L	85.4	Confident	90.6	Very high	103 Å²	103	86.4 Å²	86.4	54%	0.539	43%	0.43	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.9	-32.9	-176.9	-66.9	171	0	0	0	113.2	W29 M33 P42 Q51	W29-L44 HydrophobicContact CH2-CD2 4.4Å; W29-L44 HydrophobicContact CZ2-CD2 3.98Å; M33-L44 HydrophobicContact CE-CD2 3.55Å; M33-L44 HydrophobicContact CE-CG 4.25Å; M33-L44 HydrophobicContact SD-CD2 3.93Å; P42-L44 VanDerWaalsContact C-N 3.33Å; P42-L44 PolarHBondContact O-N 3.06Å; L44-Q51 PolarHBondContact O-NE2 2.94Å; L44-Q51 VanDerWaalsContact O-NE2 3.08Å
45	K	86.1	Confident	90.7	Very high	180 Å²	180	83.7 Å²	83.7	78%	0.783	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.2	-31	-172.1	-62	-177.2	178.5	-178.9	0	113.2	P42	P42-K45 HydrophobicContact CB-CB 4.18Å; P42-K45 HydrophobicContact CG-CB 4.22Å; P42-K45 PolarHBondContact O-N 3.4Å
46	S	85.7	Confident	90.8	Very high	23 Å²	23	82.4 Å²	82.4	16%	0.161	42%	0.416	C	S	.	.	T	Hydrogen-bonded Turn	trans	-82.2	135.3	-179.3	172.1	0	0	0	0	111	N36 R41 P42 Q51	N36-S46 PolarHBondContact ND2-O 2.98Å; N36-S46 PolarHBondContact OD1-OG 3.11Å; R41-S46 WeakPolarHBondContact CD-OG 3.5Å; P42-S46 VanDerWaalsContact O-CB 3.3Å; P42-S46 WeakPolarHBondContact O-CB 3.45Å; P42-S46 PolarHBondContact O-N 3.32Å; S46-Q51 PolarHBondContact O-NE2 3.39Å
47	G	85.9	Confident	90.9	Very high	15 Å²	15	86.3 Å²	86.3	16%	0.155	44%	0.436	C	S	.	.	T	Hydrogen-bonded Turn	trans	67.2	39.9	167.2	0	0	0	0	0	114.9	H49 R50 Q51	G47-H49 PolarHBondContact O-N 3.1Å; G47-R50 WeakPolarHBondContact O-CA 3.39Å; G47-R50 WeakPolarHBondContact O-CB 3.18Å; G47-R50 PolarHBondContact O-N 2.94Å; G47-Q51 PolarHBondContact O-N 3.08Å
48	V	91.3	Very high	91.1	Very high	87 Å²	87	84.6 Å²	84.6	53%	0.527	42%	0.424	S	S	.	.	H	α-helix	trans	-55.5	-36.9	177.3	-178.7	0	0	0	0	112	R50 Q51 F52	V48-R50 VanDerWaalsContact C-N 3.29Å; V48-R50 PolarHBondContact O-N 2.95Å; V48-Q51 WeakPolarHBondContact O-CB 3.37Å; V48-Q51 PolarHBondContact O-N 3.14Å; V48-F52 WeakPolarHBondContact O-CB 3.38Å; V48-F52 PolarHBondContact O-N 2.97Å
49	H	93.2	Very high	91.2	Very high	149 Å²	149	80.9 Å²	80.9	69%	0.69	41%	0.405	S	S	*	.	H	α-helix	trans	-58.7	-39.5	173.1	59.1	-90	0	0	0	112.3	G47 L53	G47-H49 PolarHBondContact O-N 3.1Å; H49-L53 VanDerWaalsContact O-CB 3.3Å; H49-L53 WeakPolarHBondContact O-CB 3.4Å; H49-L53 PolarHBondContact O-N 2.94Å
50	R	90.6	Very high	91.3	Very high	58 Å²	58	83 Å²	83	22%	0.219	41%	0.41	C	S	.	.	H	α-helix	trans	-75.5	-36.4	178.6	-165.8	179.9	71.8	-143.1	-6.6	111.8	A32 H35 N36 G47 V48 F52 L53 L54	A32-R50 PolarHBondContact O-NH2 2.94Å; H35-R50 PolarHBondContact CE1-NH1 3.32Å; H35-R50 VanDerWaalsContact CE1-NH1 3.33Å; H35-R50 PolarHBondContact ND1-NH1 3.16Å; H35-R50 PolarHBondContact ND1-NH2 2.97Å; N36-R50 VanDerWaalsContact CG-NH2 3.29Å; N36-R50 PolarHBondContact OD1-NH2 2.92Å; G47-R50 WeakPolarHBondContact O-CA 3.39Å; G47-R50 WeakPolarHBondContact O-CB 3.18Å; G47-R50 PolarHBondContact O-N 2.94Å; V48-R50 VanDerWaalsContact C-N 3.29Å; V48-R50 PolarHBondContact O-N 2.95Å; R50-F52 VanDerWaalsContact C-N 3.35Å; R50-L53 PolarHBondContact O-N 3.33Å; R50-L54 HydrophobicContact CG-CD1 4.18Å; R50-L54 WeakPolarHBondContact O-CB 3.28Å; R50-L54 WeakPolarHBondContact O-CG 3.28Å; R50-L54 PolarHBondContact O-N 2.92Å
51	Q	91.7	Very high	91.4	Very high	14 Å²	14	77.7 Å²	77.7	7%	0.065	39%	0.388	C	S	.	.	H	α-helix	trans	-58.5	-47.9	171.3	-71.3	179.7	32.3	0	0	111.1	A32 P43 L44 S46 G47 V48 A55	A32-Q51 HydrophobicContact CB-CB 4.25Å; A32-Q51 HydrophobicContact CB-CG 3.88Å; P43-Q51 PolarHBondContact O-NE2 2.69Å; L44-Q51 PolarHBondContact O-NE2 2.94Å; L44-Q51 VanDerWaalsContact O-NE2 3.08Å; S46-Q51 PolarHBondContact O-NE2 3.39Å; G47-Q51 PolarHBondContact O-N 3.08Å; V48-Q51 WeakPolarHBondContact O-CB 3.37Å; V48-Q51 PolarHBondContact O-N 3.14Å; Q51-A55 VanDerWaalsContact O-CB 3.31Å; Q51-A55 WeakPolarHBondContact O-CB 3.28Å; Q51-A55 PolarHBondContact O-N 3.13Å
52	F	94.5	Very high	91.6	Very high	147 Å²	147	71 Å²	71	65%	0.645	36%	0.363	S	S	*	.	H	α-helix	trans	-65.2	-44	177.2	-172.4	-102.1	0	0	0	111.9	V48 R50 L54 A55 T56	V48-F52 WeakPolarHBondContact O-CB 3.38Å; V48-F52 PolarHBondContact O-N 2.97Å; R50-F52 VanDerWaalsContact C-N 3.35Å; F52-L54 PolarHBondContact O-N 2.82Å; F52-A55 PolarHBondContact O-N 3.03Å; F52-T56 HydrophobicContact CD1-CG2 4.07Å; F52-T56 HydrophobicContact CD2-CG2 4.45Å; F52-T56 HydrophobicContact CE1-CG2 3.67Å; F52-T56 HydrophobicContact CE2-CG2 4.08Å; F52-T56 HydrophobicContact CG-CG2 4.45Å; F52-T56 HydrophobicContact CZ-CG2 3.68Å; F52-T56 WeakPolarHBondContact O-CG2 3.5Å; F52-T56 PolarHBondContact O-N 3.46Å; F52-T56 PolarHBondContact O-OG1 3.41Å; F52-T56 VanDerWaalsContact O-OG1 3.09Å
53	L	94.8	Very high	91.9	Very high	97 Å²	97	70.6 Å²	70.6	51%	0.508	35%	0.352	S	S	.	.	H	α-helix	trans	-59	-48	177.6	-174.2	161.5	0	0	0	112.1	H49 R50 A55 T56 L57	H49-L53 VanDerWaalsContact O-CB 3.3Å; H49-L53 WeakPolarHBondContact O-CB 3.4Å; H49-L53 PolarHBondContact O-N 2.94Å; R50-L53 PolarHBondContact O-N 3.33Å; L53-A55 VanDerWaalsContact C-N 3.34Å; L53-T56 PolarHBondContact O-N 2.95Å; L53-T56 PolarHBondContact O-OG1 3.35Å; L53-L57 VanDerWaalsContact O-CB 3.3Å; L53-L57 WeakPolarHBondContact O-CB 3.45Å; L53-L57 PolarHBondContact O-N 3.21Å
54	L	94	Very high	92.2	Very high	46 Å²	46	71 Å²	71	24%	0.241	35%	0.349	C	S	.	.	H	α-helix	trans	-70.3	-32.8	-179.1	-72.4	172.8	0	0	0	112.2	G28 A32 R50 F52 G58	G28-L54 VanDerWaalsContact O-CB 3.3Å; G28-L54 WeakPolarHBondContact O-CB 3.19Å; A32-L54 HydrophobicContact CB-CB 4.29Å; A32-L54 HydrophobicContact CB-CD1 3.54Å; A32-L54 HydrophobicContact CB-CG 4.46Å; R50-L54 HydrophobicContact CG-CD1 4.18Å; R50-L54 WeakPolarHBondContact O-CB 3.28Å; R50-L54 WeakPolarHBondContact O-CG 3.28Å; R50-L54 PolarHBondContact O-N 2.92Å; F52-L54 PolarHBondContact O-N 2.82Å; L54-G58 PolarHBondContact O-N 3.06Å
55	A	94.9	Very high	92.6	Very high	13 Å²	13	70.4 Å²	70.4	11%	0.107	35%	0.346	C	S	.	.	H	α-helix	trans	-64.5	-49.5	172.5	0	0	0	0	0	111.8	S25 W29 Q51 F52 L53 L57 G58 W59	S25-A55 WeakPolarHBondContact CA-O 3.22Å; S25-A55 WeakPolarHBondContact CB-O 3.39Å; S25-A55 PolarHBondContact OG-O 3.28Å; W29-A55 HydrophobicContact CB-CB 4.21Å; Q51-A55 VanDerWaalsContact O-CB 3.31Å; Q51-A55 WeakPolarHBondContact O-CB 3.28Å; Q51-A55 PolarHBondContact O-N 3.13Å; F52-A55 PolarHBondContact O-N 3.03Å; L53-A55 VanDerWaalsContact C-N 3.34Å; A55-L57 VanDerWaalsContact C-N 3.34Å; A55-L57 PolarHBondContact O-N 3.26Å; A55-G58 PolarHBondContact O-N 3.36Å; A55-W59 PolarHBondContact O-N 2.96Å
56	T	95.1	Very high	92.9	Very high	63 Å²	63	62.4 Å²	62.4	39%	0.387	31%	0.312	S	S	.	.	H	α-helix	trans	-66.5	-35.4	179.6	55.2	0	0	0	0	112.4	F52 L53 W59 F60	F52-T56 HydrophobicContact CD1-CG2 4.07Å; F52-T56 HydrophobicContact CD2-CG2 4.45Å; F52-T56 HydrophobicContact CE1-CG2 3.67Å; F52-T56 HydrophobicContact CE2-CG2 4.08Å; F52-T56 HydrophobicContact CG-CG2 4.45Å; F52-T56 HydrophobicContact CZ-CG2 3.68Å; F52-T56 WeakPolarHBondContact O-CG2 3.5Å; F52-T56 PolarHBondContact O-N 3.46Å; F52-T56 PolarHBondContact O-OG1 3.41Å; F52-T56 VanDerWaalsContact O-OG1 3.09Å; L53-T56 PolarHBondContact O-N 2.95Å; L53-T56 PolarHBondContact O-OG1 3.35Å; T56-W59 WeakPolarHBondContact O-CB 3.46Å; T56-W59 PolarHBondContact O-N 3.3Å; T56-F60 WeakPolarHBondContact O-CB 3.44Å; T56-F60 PolarHBondContact O-N 2.89Å
57	L	95.9	Very high	93.2	Very high	82 Å²	82	64.5 Å²	64.5	43%	0.429	32%	0.318	S	S	.	.	H	α-helix	trans	-63.3	-45.8	172.5	-176.2	63.6	0	0	0	111.4	L53 A55 W59 F60 I61	L53-L57 VanDerWaalsContact O-CB 3.3Å; L53-L57 WeakPolarHBondContact O-CB 3.45Å; L53-L57 PolarHBondContact O-N 3.21Å; A55-L57 VanDerWaalsContact C-N 3.34Å; A55-L57 PolarHBondContact O-N 3.26Å; L57-W59 VanDerWaalsContact C-N 3.31Å; L57-W59 PolarHBondContact O-N 3.24Å; L57-F60 PolarHBondContact O-N 3.23Å; L57-I61 HydrophobicContact CD1-CD1 4.09Å; L57-I61 HydrophobicContact CD1-CG1 4.41Å; L57-I61 HydrophobicContact CG-CD1 3.89Å; L57-I61 WeakPolarHBondContact O-CB 3.48Å; L57-I61 VanDerWaalsContact O-CG1 3.3Å; L57-I61 WeakPolarHBondContact O-CG1 3.46Å; L57-I61 PolarHBondContact O-N 3.43Å
58	G	94.8	Very high	93.5	Very high	10 Å²	10	67.6 Å²	67.6	10%	0.103	33%	0.328	C	S	.	.	H	α-helix	trans	-59.6	-41.2	174.8	0	0	0	0	0	112.4	L24 L54 A55 G62	L24-G58 VanDerWaalsContact CB-O 3.32Å; L24-G58 WeakPolarHBondContact CB-O 3.32Å; L54-G58 PolarHBondContact O-N 3.06Å; A55-G58 PolarHBondContact O-N 3.36Å; G58-G62 PolarHBondContact O-N 3.46Å
59	W	95.7	Very high	93.5	Very high	78 Å²	78	67 Å²	67	30%	0.295	32%	0.32	S	S	.	.	H	α-helix	trans	-61	-48	175.4	-169.4	-78.4	0	0	0	112.6	I16 V17 S21 V22 A55 T56 L57 G62 Y63	I16-W59 HydrophobicContact CG2-CZ2 4.4Å; I16-W59 VanDerWaalsContact O-CE2 3.32Å; I16-W59 WeakPolarHBondContact O-CZ2 3.46Å; I16-W59 PolarHBondContact O-NE1 3.16Å; V17-W59 HydrophobicContact CB-CH2 4.32Å; V17-W59 HydrophobicContact CB-CZ2 4.44Å; V17-W59 HydrophobicContact CG1-CH2 4.2Å; V17-W59 HydrophobicContact CG2-CH2 4.04Å; V17-W59 HydrophobicContact CG2-CZ2 4.1Å; S21-W59 PolarHBondContact OG-O 3.47Å; S21-W59 VanDerWaalsContact OG-O 3.08Å; V22-W59 HydrophobicContact CB-CZ3 4.39Å; V22-W59 HydrophobicContact CG2-CH2 3.81Å; V22-W59 HydrophobicContact CG2-CZ3 3.62Å; A55-W59 PolarHBondContact O-N 2.96Å; T56-W59 WeakPolarHBondContact O-CB 3.46Å; T56-W59 PolarHBondContact O-N 3.3Å; L57-W59 VanDerWaalsContact C-N 3.31Å; L57-W59 PolarHBondContact O-N 3.24Å; W59-G62 PolarHBondContact O-N 3.22Å; W59-Y63 PolarHBondContact O-N 3.12Å
60	F	94.3	Very high	93.5	Very high	121 Å²	121	63.1 Å²	63.1	53%	0.531	30%	0.304	S	S	.	.	H	α-helix	trans	-62.2	-47.8	179.9	178.2	-100	0	0	0	111.6	T56 L57 G62 Y63 H64	T56-F60 WeakPolarHBondContact O-CB 3.44Å; T56-F60 PolarHBondContact O-N 2.89Å; L57-F60 PolarHBondContact O-N 3.23Å; F60-G62 VanDerWaalsContact C-N 3.32Å; F60-G62 PolarHBondContact O-N 2.91Å; F60-Y63 PolarHBondContact O-N 3.33Å; F60-H64 AromaticContact CD2-CD2 3.99Å; F60-H64 AromaticContact CE1-CD2 3.66Å; F60-H64 AromaticContact CE1-NE2 3.95Å; F60-H64 AromaticContact CE2-CD2 3.58Å; F60-H64 AromaticContact CE2-NE2 3.22Å; F60-H64 WeakPolarHBondContact CE2-NE2 3.37Å; F60-H64 AromaticContact CZ-CD2 3.4Å; F60-H64 VanDerWaalsContact CZ-CD2 3.4Å; F60-H64 WeakPolarHBondContact CZ-CD2 3.44Å; F60-H64 AromaticContact CZ-NE2 3.19Å; F60-H64 WeakPolarHBondContact CZ-NE2 3.45Å; F60-H64 PolarHBondContact O-CD2 2.81Å; F60-H64 PolarHBondContact O-N 3.49Å
61	I	94.2	Very high	93.6	Very high	76 Å²	76	61.8 Å²	61.8	39%	0.39	30%	0.299	S	S	.	.	H	α-helix	trans	-60.3	-45.9	176.4	-68.4	169.6	0	0	0	110	L57 Y63 H64 L65	L57-I61 HydrophobicContact CD1-CD1 4.09Å; L57-I61 HydrophobicContact CD1-CG1 4.41Å; L57-I61 HydrophobicContact CG-CD1 3.89Å; L57-I61 WeakPolarHBondContact O-CB 3.48Å; L57-I61 VanDerWaalsContact O-CG1 3.3Å; L57-I61 WeakPolarHBondContact O-CG1 3.46Å; L57-I61 PolarHBondContact O-N 3.43Å; I61-Y63 VanDerWaalsContact C-N 3.28Å; I61-Y63 PolarHBondContact O-N 2.94Å; I61-H64 PolarHBondContact O-N 2.87Å; I61-L65 HydrophobicContact CG2-CD1 3.67Å; I61-L65 HydrophobicContact CG2-CG 4.17Å; I61-L65 WeakPolarHBondContact O-CB 3.11Å; I61-L65 WeakPolarHBondContact O-CG 3.29Å; I61-L65 PolarHBondContact O-N 2.87Å
62	G	93.7	Very high	93.7	Very high	0 Å²	0	64.1 Å²	64.1	0%	0	31%	0.314	C	S	.	.	H	α-helix	trans	-59.9	-37.1	178.1	0	0	0	0	0	113.5	S21 G58 W59 F60 L65 T66	S21-G62 VanDerWaalsContact OG-C 3.25Å; G58-G62 PolarHBondContact O-N 3.46Å; W59-G62 PolarHBondContact O-N 3.22Å; F60-G62 VanDerWaalsContact C-N 3.32Å; F60-G62 PolarHBondContact O-N 2.91Å; G62-L65 PolarHBondContact O-N 3.37Å; G62-T66 PolarHBondContact O-N 2.91Å; G62-T66 PolarHBondContact O-OG1 3.09Å; G62-T66 VanDerWaalsContact O-OG1 3.1Å
63	Y	94	Very high	93.7	Very high	67 Å²	67	64 Å²	64	26%	0.263	31%	0.311	S	S	.	.	H	α-helix	trans	-65	-45.6	178.5	178.5	-93.8	0	0	0	111.4	P14 S21 W59 F60 I61 K67	P14-Y63 HydrophobicContact CB-CE2 4.49Å; P14-Y63 HydrophobicContact CG-CD2 3.99Å; P14-Y63 HydrophobicContact CG-CE2 3.69Å; P14-Y63 WeakPolarHBondContact O-CE2 3.29Å; S21-Y63 WeakPolarHBondContact OG-CA 3.33Å; S21-Y63 PolarHBondContact OG-N 3.24Å; W59-Y63 PolarHBondContact O-N 3.12Å; F60-Y63 PolarHBondContact O-N 3.33Å; I61-Y63 VanDerWaalsContact C-N 3.28Å; I61-Y63 PolarHBondContact O-N 2.94Å; Y63-K67 WeakPolarHBondContact O-CB 3.3Å; Y63-K67 PolarHBondContact O-N 3.49Å
64	H	91.4	Very high	93.7	Very high	62 Å²	62	61.1 Å²	61.1	29%	0.287	30%	0.301	S	S	.	.	H	α-helix	trans	-69.5	-36	178.2	-77.8	-70.7	0	0	0	112.8	F60 I61 K67 H68	F60-H64 AromaticContact CD2-CD2 3.99Å; F60-H64 AromaticContact CE1-CD2 3.66Å; F60-H64 AromaticContact CE1-NE2 3.95Å; F60-H64 AromaticContact CE2-CD2 3.58Å; F60-H64 AromaticContact CE2-NE2 3.22Å; F60-H64 WeakPolarHBondContact CE2-NE2 3.37Å; F60-H64 AromaticContact CZ-CD2 3.4Å; F60-H64 VanDerWaalsContact CZ-CD2 3.4Å; F60-H64 WeakPolarHBondContact CZ-CD2 3.44Å; F60-H64 AromaticContact CZ-NE2 3.19Å; F60-H64 WeakPolarHBondContact CZ-NE2 3.45Å; F60-H64 PolarHBondContact O-CD2 2.81Å; F60-H64 PolarHBondContact O-N 3.49Å; I61-H64 PolarHBondContact O-N 2.87Å; H64-K67 PolarHBondContact O-N 3.29Å; H64-H68 PolarHBondContact O-N 2.9Å
65	L	92.6	Very high	93.7	Very high	91 Å²	91	65.2 Å²	65.2	48%	0.476	31%	0.313	S	S	.	.	H	α-helix	trans	-64	-48.7	174.1	-76.7	173.5	0	0	0	111.4	L24 I61 G62 K67 H68 E69	L24-L65 HydrophobicContact CD1-CD1 3.9Å; I61-L65 HydrophobicContact CG2-CD1 3.67Å; I61-L65 HydrophobicContact CG2-CG 4.17Å; I61-L65 WeakPolarHBondContact O-CB 3.11Å; I61-L65 WeakPolarHBondContact O-CG 3.29Å; I61-L65 PolarHBondContact O-N 2.87Å; G62-L65 PolarHBondContact O-N 3.37Å; L65-K67 VanDerWaalsContact C-N 3.26Å; L65-K67 PolarHBondContact O-N 3.36Å; L65-H68 WeakPolarHBondContact O-CB 3.46Å; L65-H68 PolarHBondContact O-N 3.44Å; L65-E69 WeakPolarHBondContact O-CB 3.48Å; L65-E69 PolarHBondContact O-N 3.37Å
66	T	93.4	Very high	93.8	Very high	12 Å²	12	69.6 Å²	69.6	7%	0.074	33%	0.334	C	S	.	.	H	α-helix	trans	-60.5	-37.5	176.4	-61.4	0	0	0	0	111.6	P14 N20 G62 H68 E69 N70	P14-T66 HydrophobicContact CB-CG2 3.72Å; P14-T66 HydrophobicContact CG-CG2 4.32Å; N20-T66 WeakPolarHBondContact CB-OG1 3.3Å; N20-T66 PolarHBondContact ND2-OG1 3.02Å; N20-T66 VanDerWaalsContact ND2-OG1 3.16Å; G62-T66 PolarHBondContact O-N 2.91Å; G62-T66 PolarHBondContact O-OG1 3.09Å; G62-T66 VanDerWaalsContact O-OG1 3.1Å; T66-H68 VanDerWaalsContact C-N 3.32Å; T66-H68 PolarHBondContact O-N 2.93Å; T66-E69 PolarHBondContact O-N 2.94Å; T66-N70 WeakPolarHBondContact O-CB 3.49Å; T66-N70 PolarHBondContact O-N 3.45Å; T66-N70 PolarHBondContact O-OD1 3.05Å
67	K	91.4	Very high	93.8	Very high	67 Å²	67	70.5 Å²	70.5	29%	0.291	34%	0.337	S	S	.	.	H	α-helix	trans	-61.9	-41.1	174.8	-167.8	-176.8	176.3	171.8	0	112	V4 P14 Y63 H64 L65 Y71	V4-K67 HydrophobicContact CG2-CD 4.18Å; V4-K67 HydrophobicContact CG2-CG 4.09Å; P14-K67 HydrophobicContact CG-CB 4.24Å; Y63-K67 WeakPolarHBondContact O-CB 3.3Å; Y63-K67 PolarHBondContact O-N 3.49Å; H64-K67 PolarHBondContact O-N 3.29Å; L65-K67 VanDerWaalsContact C-N 3.26Å; L65-K67 PolarHBondContact O-N 3.36Å; K67-Y71 PolarHBondContact O-N 3.45Å
68	H	91.5	Very high	93.8	Very high	79 Å²	79	72.3 Å²	72.3	37%	0.366	34%	0.338	S	S	.	.	H	α-helix	trans	-71.5	-38.1	177.8	-174.6	77.7	0	0	0	112.6	I3 V4 H64 L65 T66 Y71 T72	I3-H68 PolarHBondContact O-ND1 3.08Å; V4-H68 HydrophobicContact CG2-CB 4.46Å; H64-H68 PolarHBondContact O-N 2.9Å; L65-H68 WeakPolarHBondContact O-CB 3.46Å; L65-H68 PolarHBondContact O-N 3.44Å; T66-H68 VanDerWaalsContact C-N 3.32Å; T66-H68 PolarHBondContact O-N 2.93Å; H68-Y71 PolarHBondContact O-N 3Å; H68-T72 PolarHBondContact O-N 3.35Å; H68-T72 PolarHBondContact O-OG1 2.91Å
69	E	92.4	Very high	93.8	Very high	75 Å²	75	74.6 Å²	74.6	35%	0.35	35%	0.348	S	S	.	.	H	α-helix	trans	-59.7	-52.3	174.6	-176.3	-178	-176.9	0	0	110.9	N20 L65 T66 Y71 T72 Y73	N20-E69 PolarHBondContact ND2-OE2 3.33Å; L65-E69 WeakPolarHBondContact O-CB 3.48Å; L65-E69 PolarHBondContact O-N 3.37Å; T66-E69 PolarHBondContact O-N 2.94Å; E69-Y71 VanDerWaalsContact C-N 3.26Å; E69-Y71 PolarHBondContact O-N 2.96Å; E69-T72 PolarHBondContact O-N 2.85Å; E69-T72 VanDerWaalsContact O-N 3.11Å; E69-Y73 HydrophobicContact CG-CD2 3.69Å; E69-Y73 HydrophobicContact CG-CE2 3.46Å; E69-Y73 VanDerWaalsContact CG-CE2 3.46Å; E69-Y73 VanDerWaalsContact O-CD2 3.28Å; E69-Y73 WeakPolarHBondContact O-CD2 3.31Å; E69-Y73 PolarHBondContact O-N 2.87Å
70	N	92.8	Very high	93.8	Very high	67 Å²	67	75.5 Å²	75.5	36%	0.358	36%	0.357	S	S	.	.	H	α-helix	trans	-57	-41.1	177.6	-71.5	-7.2	0	0	0	111.9	T66 A74	T66-N70 WeakPolarHBondContact O-CB 3.49Å; T66-N70 PolarHBondContact O-N 3.45Å; T66-N70 PolarHBondContact O-OD1 3.05Å; N70-A74 WeakPolarHBondContact O-CB 3.41Å; N70-A74 PolarHBondContact O-N 3.49Å
71	Y	93.2	Very high	93.9	Very high	31 Å²	31	73 Å²	73	12%	0.122	35%	0.348	C	S	.	.	H	α-helix	trans	-63.9	-45.9	176.5	173.4	-103.4	0	0	0	112.5	V4 P5 D7 G8 L11 K67 H68 E69 Y73 A74 R75	V4-Y71 HydrophobicContact CG1-CD2 4.33Å; V4-Y71 HydrophobicContact CG1-CG 4.13Å; P5-Y71 HydrophobicContact CG-CE1 3.82Å; P5-Y71 HydrophobicContact CG-CE2 4.48Å; D7-Y71 HydrophobicContact CB-CE2 4.41Å; G8-Y71 VanDerWaalsContact CA-CD2 3.45Å; L11-Y71 HydrophobicContact CD1-CD2 4.05Å; K67-Y71 PolarHBondContact O-N 3.45Å; H68-Y71 PolarHBondContact O-N 3Å; E69-Y71 VanDerWaalsContact C-N 3.26Å; E69-Y71 PolarHBondContact O-N 2.96Å; Y71-Y73 PolarHBondContact O-N 2.91Å; Y71-A74 PolarHBondContact O-N 3.4Å; Y71-R75 WeakPolarHBondContact O-CB 3.4Å; Y71-R75 PolarHBondContact O-N 3.37Å
72	T	93.1	Very high	94	Very high	62 Å²	62	74 Å²	74	38%	0.38	35%	0.352	S	S	.	.	H	α-helix	trans	-61.9	-45.8	-179.1	-59.4	0	0	0	0	111.4	H68 E69 R75 L76	H68-T72 PolarHBondContact O-N 3.35Å; H68-T72 PolarHBondContact O-OG1 2.91Å; E69-T72 PolarHBondContact O-N 2.85Å; E69-T72 VanDerWaalsContact O-N 3.11Å; T72-R75 PolarHBondContact O-N 2.88Å; T72-L76 WeakPolarHBondContact O-CB 3.36Å; T72-L76 PolarHBondContact O-N 3.28Å
73	Y	94.9	Very high	94.1	Very high	146 Å²	146	78.6 Å²	78.6	57%	0.573	37%	0.37	S	S	*	.	H	α-helix	trans	-69.9	-38.5	178.6	-72.3	-59.9	0	0	0	113	E69 Y71 R75 L76 D77	E69-Y73 HydrophobicContact CG-CD2 3.69Å; E69-Y73 HydrophobicContact CG-CE2 3.46Å; E69-Y73 VanDerWaalsContact CG-CE2 3.46Å; E69-Y73 VanDerWaalsContact O-CD2 3.28Å; E69-Y73 WeakPolarHBondContact O-CD2 3.31Å; E69-Y73 PolarHBondContact O-N 2.87Å; Y71-Y73 PolarHBondContact O-N 2.91Å; Y73-R75 VanDerWaalsContact C-N 3.33Å; Y73-R75 PolarHBondContact O-N 3.26Å; Y73-L76 PolarHBondContact O-N 3.08Å; Y73-D77 WeakPolarHBondContact O-CB 3.35Å; Y73-D77 PolarHBondContact O-N 3.06Å
74	A	94.4	Very high	94.1	Very high	36 Å²	36	78 Å²	78	30%	0.298	37%	0.373	S	S	.	.	H	α-helix	trans	-63.2	-40.2	175.4	0	0	0	0	0	112	L11 N70 Y71 R78	L11-A74 HydrophobicContact CD1-CB 3.73Å; L11-A74 HydrophobicContact CD2-CB 3.69Å; L11-A74 HydrophobicContact CG-CB 4.38Å; N70-A74 WeakPolarHBondContact O-CB 3.41Å; N70-A74 PolarHBondContact O-N 3.49Å; Y71-A74 PolarHBondContact O-N 3.4Å; A74-R78 WeakPolarHBondContact O-CB 3.44Å; A74-R78 PolarHBondContact O-N 3.36Å
75	R	94	Very high	94.3	Very high	131 Å²	131	83 Å²	83	49%	0.494	39%	0.394	S	S	.	.	H	α-helix	trans	-63.6	-46.2	174.3	-179.9	-177.1	172.2	-179.9	3.4	111.4	Y71 T72 Y73 D77 R78 D79	Y71-R75 WeakPolarHBondContact O-CB 3.4Å; Y71-R75 PolarHBondContact O-N 3.37Å; T72-R75 PolarHBondContact O-N 2.88Å; Y73-R75 VanDerWaalsContact C-N 3.33Å; Y73-R75 PolarHBondContact O-N 3.26Å; R75-D77 VanDerWaalsContact C-N 3.32Å; R75-D77 PolarHBondContact O-N 2.97Å; R75-R78 PolarHBondContact O-N 2.92Å; R75-D79 IonicContact NE-OD2 3.58Å; R75-D79 WeakPolarHBondContact O-CB 3.48Å; R75-D79 VanDerWaalsContact O-CG 3.23Å; R75-D79 PolarHBondContact O-N 3.07Å
76	L	96.1	Very high	94.4	Very high	106 Å²	106	84.6 Å²	84.6	56%	0.555	40%	0.402	S	S	*	.	H	α-helix	trans	-60.4	-43.5	179.7	-175.4	145.5	0	0	0	111.5	T72 Y73 D79 M80	T72-L76 WeakPolarHBondContact O-CB 3.36Å; T72-L76 PolarHBondContact O-N 3.28Å; Y73-L76 PolarHBondContact O-N 3.08Å; L76-D79 PolarHBondContact O-N 3.27Å; L76-M80 VanDerWaalsContact O-CB 3.28Å; L76-M80 WeakPolarHBondContact O-CB 3.48Å; L76-M80 PolarHBondContact O-N 3.13Å
77	D	96.3	Very high	94.5	Very high	81 Å²	81	88.4 Å²	88.4	43%	0.433	42%	0.416	S	S	.	.	H	α-helix	trans	-66.6	-40.8	177.2	-171.5	56.6	0	0	0	112	Y73 R75 M80 N81	Y73-D77 WeakPolarHBondContact O-CB 3.35Å; Y73-D77 PolarHBondContact O-N 3.06Å; R75-D77 VanDerWaalsContact C-N 3.32Å; R75-D77 PolarHBondContact O-N 2.97Å; D77-M80 PolarHBondContact O-N 2.72Å; D77-M80 VanDerWaalsContact OD1-CE 3.32Å; D77-M80 WeakPolarHBondContact OD1-CE 3.3Å; D77-N81 VanDerWaalsContact CG-ND2 3.32Å; D77-N81 VanDerWaalsContact O-CB 3.28Å; D77-N81 WeakPolarHBondContact O-CB 3.3Å; D77-N81 PolarHBondContact O-N 3.11Å; D77-N81 PolarHBondContact O-ND2 3.1Å; D77-N81 PolarHBondContact OD1-ND2 2.99Å; D77-N81 PolarHBondContact OD2-ND2 3.41Å; D77-N81 VanDerWaalsContact OD2-ND2 3.09Å
78	R	94.6	Very high	94.5	Very high	120 Å²	120	89.1 Å²	89.1	45%	0.453	43%	0.427	S	S	.	.	H	α-helix	trans	-57.8	-53.5	173.6	-174.4	-167.3	71.9	174.6	6.3	111.3	A74 R75 M80 N81 E82	A74-R78 WeakPolarHBondContact O-CB 3.44Å; A74-R78 PolarHBondContact O-N 3.36Å; R75-R78 PolarHBondContact O-N 2.92Å; R78-M80 VanDerWaalsContact C-N 3.31Å; R78-M80 PolarHBondContact O-N 3.07Å; R78-N81 PolarHBondContact O-N 3.21Å; R78-E82 WeakPolarHBondContact O-CG 3.46Å; R78-E82 PolarHBondContact O-N 3.43Å
79	D	95.9	Very high	94.5	Very high	59 Å²	59	91 Å²	91	32%	0.316	44%	0.436	S	S	.	.	H	α-helix	trans	-65	-37.7	-175.5	-64.1	-9.1	0	0	0	110.5	R75 L76 Y83	R75-D79 IonicContact NE-OD2 3.58Å; R75-D79 WeakPolarHBondContact O-CB 3.48Å; R75-D79 VanDerWaalsContact O-CG 3.23Å; R75-D79 PolarHBondContact O-N 3.07Å; L76-D79 PolarHBondContact O-N 3.27Å; D79-Y83 WeakPolarHBondContact O-CB 3.48Å; D79-Y83 PolarHBondContact O-N 3.41Å
80	M	96.2	Very high	94.5	Very high	97 Å²	97	94.8 Å²	94.8	48%	0.478	45%	0.447	S	S	.	.	H	α-helix	trans	-62.9	-48.5	173.1	-179.1	-178.5	68.3	0	0	112	L76 D77 R78 E82 Y83 V84	L76-M80 VanDerWaalsContact O-CB 3.28Å; L76-M80 WeakPolarHBondContact O-CB 3.48Å; L76-M80 PolarHBondContact O-N 3.13Å; D77-M80 PolarHBondContact O-N 2.72Å; D77-M80 VanDerWaalsContact OD1-CE 3.32Å; D77-M80 WeakPolarHBondContact OD1-CE 3.3Å; R78-M80 VanDerWaalsContact C-N 3.31Å; R78-M80 PolarHBondContact O-N 3.07Å; M80-E82 VanDerWaalsContact C-N 3.34Å; M80-E82 PolarHBondContact O-N 3.41Å; M80-Y83 PolarHBondContact O-N 3.32Å; M80-V84 WeakPolarHBondContact O-CG2 3.3Å; M80-V84 PolarHBondContact O-N 2.86Å
81	N	95.4	Very high	94.3	Very high	67 Å²	67	96 Å²	96	36%	0.358	45%	0.449	S	S	.	.	H	α-helix	trans	-66	-36.6	-178.8	-73.9	-37.5	0	0	0	112.2	D77 R78 K85	D77-N81 VanDerWaalsContact CG-ND2 3.32Å; D77-N81 VanDerWaalsContact O-CB 3.28Å; D77-N81 WeakPolarHBondContact O-CB 3.3Å; D77-N81 PolarHBondContact O-N 3.11Å; D77-N81 PolarHBondContact O-ND2 3.1Å; D77-N81 PolarHBondContact OD1-ND2 2.99Å; D77-N81 PolarHBondContact OD2-ND2 3.41Å; D77-N81 VanDerWaalsContact OD2-ND2 3.09Å; R78-N81 PolarHBondContact O-N 3.21Å; N81-K85 VanDerWaalsContact O-CG 3.27Å; N81-K85 WeakPolarHBondContact O-CG 3.49Å; N81-K85 PolarHBondContact O-N 3.09Å; N81-K85 VanDerWaalsContact O-N 3.16Å
82	E	95.8	Very high	94	Very high	98 Å²	98	101.8 Å²	101.8	46%	0.458	48%	0.478	S	S	.	.	H	α-helix	trans	-64.2	-44	172.4	-75.7	177.3	-170.7	0	0	111.4	R78 M80 V84 K85 L86	R78-E82 WeakPolarHBondContact O-CG 3.46Å; R78-E82 PolarHBondContact O-N 3.43Å; M80-E82 VanDerWaalsContact C-N 3.34Å; M80-E82 PolarHBondContact O-N 3.41Å; E82-V84 PolarHBondContact O-N 2.92Å; E82-K85 PolarHBondContact O-N 3.34Å; E82-L86 WeakPolarHBondContact O-CG 3.46Å; E82-L86 PolarHBondContact O-N 3.42Å
83	Y	95.7	Very high	93.6	Very high	97 Å²	97	105.7 Å²	105.7	38%	0.38	50%	0.501	S	S	.	.	H	α-helix	trans	-62.2	-42.1	178.2	-177.5	-100.6	0	0	0	112.8	D79 M80 K85 L86 Y87 R90 F91	D79-Y83 WeakPolarHBondContact O-CB 3.48Å; D79-Y83 PolarHBondContact O-N 3.41Å; M80-Y83 PolarHBondContact O-N 3.32Å; Y83-K85 VanDerWaalsContact C-N 3.31Å; Y83-K85 PolarHBondContact O-N 3.33Å; Y83-L86 PolarHBondContact O-N 3.49Å; Y83-Y87 AromaticContact CD2-CD2 3.83Å; Y83-Y87 HydrophobicContact CD2-CD2 3.83Å; Y83-Y87 AromaticContact CD2-CE2 3.94Å; Y83-Y87 HydrophobicContact CD2-CE2 3.94Å; Y83-Y87 AromaticContact CE2-CD2 3.57Å; Y83-Y87 HydrophobicContact CE2-CD2 3.57Å; Y83-Y87 AromaticContact CE2-CE2 3.64Å; Y83-Y87 HydrophobicContact CE2-CE2 3.64Å; Y83-Y87 HydrophobicContact CG-CD2 4.45Å; Y83-Y87 PolarHBondContact O-N 2.69Å; Y83-R90 PolarHBondContact OH-NH1 3.22Å; Y83-F91 AromaticContact CD1-CE2 3.83Å; Y83-F91 HydrophobicContact CD1-CE2 3.83Å; Y83-F91 AromaticContact CD1-CZ 3.93Å; Y83-F91 HydrophobicContact CD1-CZ 3.93Å; Y83-F91 AromaticContact CE1-CE2 3.78Å; Y83-F91 HydrophobicContact CE1-CE2 3.78Å; Y83-F91 AromaticContact CE1-CZ 3.8Å; Y83-F91 HydrophobicContact CE1-CZ 3.8Å
84	V	95.4	Very high	93.2	Very high	54 Å²	54	107.1 Å²	107.1	33%	0.327	51%	0.511	S	S	.	.	H	α-helix	trans	-62.8	-38.7	175.7	172.8	0	0	0	0	111.5	M80 E82 Y87 F91	M80-V84 WeakPolarHBondContact O-CG2 3.3Å; M80-V84 PolarHBondContact O-N 2.86Å; E82-V84 PolarHBondContact O-N 2.92Å; V84-Y87 CarbonylContact O-C 3.37Å; V84-F91 HydrophobicContact CB-CD2 4.14Å; V84-F91 HydrophobicContact CB-CE2 4.25Å; V84-F91 HydrophobicContact CG1-CB 4.3Å; V84-F91 HydrophobicContact CG1-CD2 4.03Å; V84-F91 HydrophobicContact CG1-CG 4.19Å; V84-F91 HydrophobicContact CG2-CD1 4.39Å; V84-F91 HydrophobicContact CG2-CD2 3.94Å; V84-F91 HydrophobicContact CG2-CE1 4.21Å; V84-F91 HydrophobicContact CG2-CE2 3.75Å; V84-F91 HydrophobicContact CG2-CG 4.25Å; V84-F91 HydrophobicContact CG2-CZ 3.89Å
85	K	94.1	Very high	92.7	Very high	167 Å²	167	114.2 Å²	114.2	73%	0.726	54%	0.538	S	S	*	.	H	α-helix	trans	-67.5	-34.2	177.3	-74.1	171.8	-176.9	177.3	0	113.1	N81 E82 Y83	N81-K85 VanDerWaalsContact O-CG 3.27Å; N81-K85 WeakPolarHBondContact O-CG 3.49Å; N81-K85 PolarHBondContact O-N 3.09Å; N81-K85 VanDerWaalsContact O-N 3.16Å; E82-K85 PolarHBondContact O-N 3.34Å; Y83-K85 VanDerWaalsContact C-N 3.31Å; Y83-K85 PolarHBondContact O-N 3.33Å
86	L	95.9	Very high	92.4	Very high	124 Å²	124	117.6 Å²	117.6	65%	0.649	56%	0.556	S	S	*	*	H	α-helix	trans	-74.2	-30.7	-180	-71.5	172.3	0	0	0	113.1	E82 Y83 P88	E82-L86 WeakPolarHBondContact O-CG 3.46Å; E82-L86 PolarHBondContact O-N 3.42Å; Y83-L86 PolarHBondContact O-N 3.49Å; L86-P88 VanDerWaalsContact C-CD 3.45Å; L86-P88 WeakPolarHBondContact O-CD 3.3Å
87	Y	94.6	Very high	92	Very high	92 Å²	92	119.4 Å²	119.4	36%	0.361	56%	0.559	S	S	.	*			trans	-127.2	62.1	-175	-59.1	-72.3	0	0	0	112.2	Y83 V84 E89 R90 F91	Y83-Y87 AromaticContact CD2-CD2 3.83Å; Y83-Y87 HydrophobicContact CD2-CD2 3.83Å; Y83-Y87 AromaticContact CD2-CE2 3.94Å; Y83-Y87 HydrophobicContact CD2-CE2 3.94Å; Y83-Y87 AromaticContact CE2-CD2 3.57Å; Y83-Y87 HydrophobicContact CE2-CD2 3.57Å; Y83-Y87 AromaticContact CE2-CE2 3.64Å; Y83-Y87 HydrophobicContact CE2-CE2 3.64Å; Y83-Y87 HydrophobicContact CG-CD2 4.45Å; Y83-Y87 PolarHBondContact O-N 2.69Å; V84-Y87 CarbonylContact O-C 3.37Å; Y87-E89 VanDerWaalsContact CD1-OE1 3.32Å; Y87-E89 WeakPolarHBondContact CD1-OE1 3.2Å; Y87-E89 PolarHBondContact O-N 2.91Å; Y87-R90 PolarHBondContact O-N 3.1Å; Y87-F91 WeakPolarHBondContact O-CD2 3.46Å
88	P	91.4	Very high	91.5	Very high	83 Å²	83	119.2 Å²	119.2	54%	0.539	56%	0.561	S	S	.	*	G	3₁₀ helix	trans	-60.2	-28.2	-178.6	26.8	-35.2	0	0	0	112.6	L86 R90 F91	L86-P88 VanDerWaalsContact C-CD 3.45Å; L86-P88 WeakPolarHBondContact O-CD 3.3Å; P88-R90 PolarHBondContact O-N 3.32Å; P88-F91 CarbonylContact O-C 3.59Å; P88-F91 PolarHBondContact O-N 3.31Å
89	E	91.7	Very high	90.9	Very high	117 Å²	117	120.4 Å²	120.4	55%	0.547	58%	0.576	S	S	.	*	G	3₁₀ helix	trans	-65.1	-22.6	177.3	70.7	-72	164.2	0	0	113.8	Y87 F91	Y87-E89 VanDerWaalsContact CD1-OE1 3.32Å; Y87-E89 WeakPolarHBondContact CD1-OE1 3.2Å; Y87-E89 PolarHBondContact O-N 2.91Å; E89-F91 VanDerWaalsContact C-N 3.34Å
90	R	92.1	Very high	90.2	Very high	155 Å²	155	122 Å²	122	59%	0.585	60%	0.598	S	S	*	*	G	3₁₀ helix	trans	-82.3	-16.4	175.1	-64.6	-176.2	178.8	-171.1	-5.8	112.6	Y83 Y87 P88	Y83-R90 PolarHBondContact OH-NH1 3.22Å; Y87-R90 PolarHBondContact O-N 3.1Å; P88-R90 PolarHBondContact O-N 3.32Å
91	F	89.9	Confident	89.5	Confident	93 Å²	93	123.2 Å²	123.2	41%	0.408	60%	0.602	S	S	.	*	S	Bend	trans	-124.7	61.4	-172.8	-61	-75.9	0	0	0	110.7	Y83 V84 Y87 P88 E89 T93	Y83-F91 AromaticContact CD1-CE2 3.83Å; Y83-F91 HydrophobicContact CD1-CE2 3.83Å; Y83-F91 AromaticContact CD1-CZ 3.93Å; Y83-F91 HydrophobicContact CD1-CZ 3.93Å; Y83-F91 AromaticContact CE1-CE2 3.78Å; Y83-F91 HydrophobicContact CE1-CE2 3.78Å; Y83-F91 AromaticContact CE1-CZ 3.8Å; Y83-F91 HydrophobicContact CE1-CZ 3.8Å; V84-F91 HydrophobicContact CB-CD2 4.14Å; V84-F91 HydrophobicContact CB-CE2 4.25Å; V84-F91 HydrophobicContact CG1-CB 4.3Å; V84-F91 HydrophobicContact CG1-CD2 4.03Å; V84-F91 HydrophobicContact CG1-CG 4.19Å; V84-F91 HydrophobicContact CG2-CD1 4.39Å; V84-F91 HydrophobicContact CG2-CD2 3.94Å; V84-F91 HydrophobicContact CG2-CE1 4.21Å; V84-F91 HydrophobicContact CG2-CE2 3.75Å; V84-F91 HydrophobicContact CG2-CG 4.25Å; V84-F91 HydrophobicContact CG2-CZ 3.89Å; Y87-F91 WeakPolarHBondContact O-CD2 3.46Å; P88-F91 CarbonylContact O-C 3.59Å; P88-F91 PolarHBondContact O-N 3.31Å; E89-F91 VanDerWaalsContact C-N 3.34Å; F91-T93 PolarHBondContact O-N 2.81Å
92	E	86.6	Confident	88.8	Confident	153 Å²	153	123.5 Å²	123.5	72%	0.715	60%	0.603	S	S	*	*			trans	-59.4	124.6	177	-64.4	-179.5	173.7	0	0	111.5	K94	E92-K94 PolarHBondContact O-N 2.9Å
93	T	84.4	Confident	88.3	Confident	143 Å²	143	125.4 Å²	125.4	88%	0.877	62%	0.621	S	S	*	*			trans	-74.2	91.9	172.9	52.5	0	0	0	0	109.6	F91 E95	F91-T93 PolarHBondContact O-N 2.81Å; T93-E95 PolarHBondContact O-N 3.45Å
94	K	85.8	Confident	87.9	Confident	177 Å²	177	127.9 Å²	127.9	77%	0.77	64%	0.636	S	S	*	*			trans	-64	133.8	173.3	-64.3	-177.5	-179.3	179.7	0	110.1	E92 K96	E92-K94 PolarHBondContact O-N 2.9Å; K94-K96 PolarHBondContact O-N 3.46Å
95	E	85.3	Confident	87.5	Confident	184 Å²	184	130 Å²	130	86%	0.86	65%	0.65	S	S	*	*			trans	-59.6	127.3	171.9	-68.2	-173.7	166.1	0	0	109.9	T93 K97	T93-E95 PolarHBondContact O-N 3.45Å; E95-K97 PolarHBondContact O-N 3.09Å
96	K	86.4	Confident	87.2	Confident	203 Å²	203	130.3 Å²	130.3	88%	0.883	65%	0.652	S	S	*	*			trans	-79.7	99.6	178.9	-67.2	177.9	-177.5	178.3	0	108.5	K94	K94-K96 PolarHBondContact O-N 3.46Å
97	K	87.4	Confident	86.9	Confident	143 Å²	143	131.7 Å²	131.7	62%	0.622	66%	0.655	S	S	*	*			trans	-64.8	141.3	173.9	-63.5	-172.2	179.1	-174.4	0	110.9	E95 E101 I102	E95-K97 PolarHBondContact O-N 3.09Å; K97-E101 HydrophobicContact CB-CB 4.48Å; K97-E101 WeakPolarHBondContact CB-OE2 3.47Å; K97-E101 WeakPolarHBondContact CG-OE2 3.38Å; K97-I102 HydrophobicContact CB-CD1 4.09Å; K97-I102 HydrophobicContact CB-CG1 4.11Å
98	T	86.8	Confident	86.8	Confident	77 Å²	77	130.1 Å²	130.1	47%	0.472	66%	0.656	S	S	.	*			trans	-77.1	156.3	176.6	64	0	0	0	0	110.8	A100 E101 I102	T98-A100 PolarHBondContact O-N 3.23Å; T98-A100 VanDerWaalsContact O-N 3.08Å; T98-E101 WeakPolarHBondContact O-CB 3.28Å; T98-E101 PolarHBondContact O-N 2.99Å; T98-E101 PolarHBondContact OG1-OE1 2.9Å; T98-I102 PolarHBondContact O-N 3.05Å
99	L	82.8	Confident	86.5	Confident	145 Å²	145	133.4 Å²	133.4	76%	0.759	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.4	-15	175.8	-66.7	177.8	0	0	0	113.1	E101	L99-E101 VanDerWaalsContact C-N 3.26Å; L99-E101 PolarHBondContact O-N 3.45Å
100	A	81.2	Confident	86	Confident	94 Å²	94	141.4 Å²	141.4	78%	0.777	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.9	-25.9	171.2	0	0	0	0	0	112.5	T98	T98-A100 PolarHBondContact O-N 3.23Å; T98-A100 VanDerWaalsContact O-N 3.08Å
101	E	80.8	Confident	85.7	Confident	122 Å²	122	140.8 Å²	140.8	57%	0.57	71%	0.705	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.5	-19.6	179.5	-65.2	162.3	-139.8	0	0	112.7	K97 T98 L99	K97-E101 HydrophobicContact CB-CB 4.48Å; K97-E101 WeakPolarHBondContact CB-OE2 3.47Å; K97-E101 WeakPolarHBondContact CG-OE2 3.38Å; T98-E101 WeakPolarHBondContact O-CB 3.28Å; T98-E101 PolarHBondContact O-N 2.99Å; T98-E101 PolarHBondContact OG1-OE1 2.9Å; L99-E101 VanDerWaalsContact C-N 3.26Å; L99-E101 PolarHBondContact O-N 3.45Å
102	I	81.2	Confident	85.5	Confident	73 Å²	73	143.3 Å²	143.3	37%	0.374	72%	0.721	S	S	.	*			trans	-100.7	104.2	-176.9	-55.2	171.9	0	0	0	108.6	K97 T98 E104	K97-I102 HydrophobicContact CB-CD1 4.09Å; K97-I102 HydrophobicContact CB-CG1 4.11Å; T98-I102 PolarHBondContact O-N 3.05Å; I102-E104 HydrophobicContact CG2-CG 4.04Å; I102-E104 PolarHBondContact O-N 3.09Å
103	V	85.2	Confident	85.4	Confident	138 Å²	138	142.7 Å²	142.7	84%	0.836	72%	0.721	S	S	*	*			trans	-90.9	102.5	173.5	-177.3	0	0	0	0	109
104	E	86.3	Confident	85.5	Confident	149 Å²	149	142.7 Å²	142.7	70%	0.696	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-87.5	141.5	170.6	-65.1	-174.4	174.1	0	0	110.7	I102 F106	I102-E104 HydrophobicContact CG2-CG 4.04Å; I102-E104 PolarHBondContact O-N 3.09Å; E104-F106 PolarHBondContact O-N 3.42Å
105	P	86.9	Confident	85.5	Confident	97 Å²	97	140.6 Å²	140.6	63%	0.63	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-67.3	123.2	175.3	27.7	-32.7	0	0	0	110.4	H107	P105-H107 PolarHBondContact O-N 3.07Å
106	F	89.1	Confident	85.5	Confident	174 Å²	174	137.7 Å²	137.7	76%	0.763	70%	0.699	S	S	*	*	P	Polyproline II helix	trans	-79.8	118.3	174.6	-179.8	-109.1	0	0	0	110.8	E104 P108	E104-F106 PolarHBondContact O-N 3.42Å; F106-P108 HydrophobicContact CD1-CB 4.4Å; F106-P108 HydrophobicContact CE1-CB 3.75Å; F106-P108 HydrophobicContact CE1-CG 4.39Å; F106-P108 HydrophobicContact CZ-CB 4.36Å; F106-P108 VanDerWaalsContact O-CD 3.29Å; F106-P108 WeakPolarHBondContact O-CD 3.44Å
107	H	89.9	Confident	85.4	Confident	153 Å²	153	133 Å²	133	71%	0.708	69%	0.685	S	S	*	*			trans	-102.2	99.3	174.1	-65	-60	0	0	0	110.3	P105	P105-H107 PolarHBondContact O-N 3.07Å
108	P	91.2	Very high	85.3	Confident	60 Å²	60	132.2 Å²	132.2	39%	0.39	69%	0.69	S	S	.	*			trans	-68.6	138	179.4	26.1	-32.9	0	0	0	111.3	F106 R110	F106-P108 HydrophobicContact CD1-CB 4.4Å; F106-P108 HydrophobicContact CE1-CB 3.75Å; F106-P108 HydrophobicContact CE1-CG 4.39Å; F106-P108 HydrophobicContact CZ-CB 4.36Å; F106-P108 VanDerWaalsContact O-CD 3.29Å; F106-P108 WeakPolarHBondContact O-CD 3.44Å; P108-R110 PolarHBondContact O-N 3.29Å
109	V	86	Confident	85.1	Confident	152 Å²	152	136.8 Å²	136.8	92%	0.921	71%	0.708	S	S	*	*			trans	-76	117.9	168.4	-176	0	0	0	0	107.9
110	R	80.9	Confident	85.3	Confident	285 Å²	285	136.1 Å²	136.1	100%	1.075	70%	0.704	S	S	*	*			trans	-118.4	0	179.4	-52.4	-176.1	-171.1	-173.7	1.9	109.8	P108	P108-R110 PolarHBondContact O-N 3.29Å

Retrieved 110 of 110 residues in 184.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).