A0A087XJK6_POEFO Loading...

Dolichol phosphate-mannose biosynthesis regulatory protein

Regulates the biosynthesis of dolichol phosphate-mannose. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1. Part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol and participates in the first step of GPI biosynthesis. May act by regulating the GPI-GNT complex. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization.

AlphaFold DB , UniProt , Accession A0A087XJK6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 83 aa.

						>A0A087XJK6_POEFO|A0A087XJK6
MATGADQAVGMSLVLFSLLLFSYYTVWVIVLPFVDGRHVLHRYFLPREYSVILPGVAAVLLLLCVGTFTAVILWKNRKPKKTD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.7	Low	87.8	Confident	240 Å²	240	94.5 Å²	94.5	100%	1.182	59%	0.591	S	S	*	*				0	131.3	0	-64.9	176	-174.8	0	0	106.3	T3	M1-T3 PolarHBondContact O-N 3.08Å
2	A	66.8	Low	88.6	Confident	80 Å²	80	92 Å²	92	66%	0.661	58%	0.58	S	S	*	*			trans	-59.5	132.6	173.2	0	0	0	0	0	108.3	D6	A2-D6 HydrophobicContact CB-CB 4.12Å
3	T	86.6	Confident	89.2	Confident	79 Å²	79	93.2 Å²	93.2	49%	0.485	58%	0.578	S	S	.	*			trans	-68.7	157.4	178.2	64.4	0	0	0	0	109.5	M1 A5 D6 Q7	M1-T3 PolarHBondContact O-N 3.08Å; T3-A5 PolarHBondContact O-N 3.32Å; T3-A5 VanDerWaalsContact O-N 3.09Å; T3-D6 WeakPolarHBondContact CB-OD2 3.41Å; T3-D6 PolarHBondContact N-OD2 3.34Å; T3-D6 WeakPolarHBondContact O-CB 3.28Å; T3-D6 PolarHBondContact O-N 3.26Å; T3-D6 PolarHBondContact OG1-N 3.11Å; T3-D6 PolarHBondContact OG1-OD2 3.14Å; T3-Q7 PolarHBondContact O-N 2.92Å; T3-Q7 VanDerWaalsContact O-N 3.15Å
4	G	88.8	Confident	89.8	Confident	61 Å²	61	92.3 Å²	92.3	63%	0.629	57%	0.572	S	S	*	*	H	α-helix	trans	-56	-28.6	177.1	0	0	0	0	0	113.1	A8	G4-A8 PolarHBondContact O-N 3.46Å; G4-A8 VanDerWaalsContact O-N 3.1Å
5	A	91.1	Very high	90.4	Very high	65 Å²	65	92.8 Å²	92.8	54%	0.537	57%	0.569	S	S	.	*	H	α-helix	trans	-66.7	-46	172.7	0	0	0	0	0	112.3	T3 Q7 A8 V9	T3-A5 PolarHBondContact O-N 3.32Å; T3-A5 VanDerWaalsContact O-N 3.09Å; A5-Q7 VanDerWaalsContact C-N 3.26Å; A5-Q7 PolarHBondContact O-N 3.29Å; A5-A8 PolarHBondContact O-N 3.23Å; A5-V9 WeakPolarHBondContact O-CG2 3.3Å; A5-V9 PolarHBondContact O-N 2.92Å
6	D	93.2	Very high	90.8	Very high	93 Å²	93	94.9 Å²	94.9	50%	0.497	57%	0.568	S	S	.	*	H	α-helix	trans	-58.8	-40.4	177	-59.1	-44.3	0	0	0	111.3	A2 T3 V9 G10	A2-D6 HydrophobicContact CB-CB 4.12Å; T3-D6 WeakPolarHBondContact CB-OD2 3.41Å; T3-D6 PolarHBondContact N-OD2 3.34Å; T3-D6 WeakPolarHBondContact O-CB 3.28Å; T3-D6 PolarHBondContact O-N 3.26Å; T3-D6 PolarHBondContact OG1-N 3.11Å; T3-D6 PolarHBondContact OG1-OD2 3.14Å; D6-V9 PolarHBondContact O-N 3.46Å; D6-G10 PolarHBondContact O-N 2.93Å
7	Q	92.2	Very high	91.2	Very high	135 Å²	135	93.5 Å²	93.5	63%	0.631	56%	0.564	S	S	*	*	H	α-helix	trans	-67.6	-40.2	177.8	-172.4	176.2	-13.6	0	0	112.3	T3 A5 G10 M11	T3-Q7 PolarHBondContact O-N 2.92Å; T3-Q7 VanDerWaalsContact O-N 3.15Å; A5-Q7 VanDerWaalsContact C-N 3.26Å; A5-Q7 PolarHBondContact O-N 3.29Å; Q7-G10 PolarHBondContact O-N 3Å; Q7-M11 WeakPolarHBondContact O-CB 3.39Å; Q7-M11 PolarHBondContact O-N 3.39Å
8	A	96.1	Very high	91.5	Very high	60 Å²	60	93.7 Å²	93.7	50%	0.496	56%	0.561	S	S	.	*	H	α-helix	trans	-64.9	-41.3	176.7	0	0	0	0	0	112	G4 A5 M11 S12	G4-A8 PolarHBondContact O-N 3.46Å; G4-A8 VanDerWaalsContact O-N 3.1Å; A5-A8 PolarHBondContact O-N 3.23Å; A8-M11 PolarHBondContact O-N 3.38Å; A8-S12 PolarHBondContact O-N 3.08Å; A8-S12 PolarHBondContact O-OG 3.04Å
9	V	96.2	Very high	91.9	Very high	84 Å²	84	95.2 Å²	95.2	51%	0.509	57%	0.565	S	S	.	*	H	α-helix	trans	-66.1	-43	175.5	175.5	0	0	0	0	111	A5 D6 M11 S12 L13	A5-V9 WeakPolarHBondContact O-CG2 3.3Å; A5-V9 PolarHBondContact O-N 2.92Å; D6-V9 PolarHBondContact O-N 3.46Å; V9-M11 VanDerWaalsContact C-N 3.32Å; V9-M11 PolarHBondContact O-N 3.29Å; V9-S12 PolarHBondContact O-N 3.39Å; V9-S12 PolarHBondContact O-OG 3.41Å; V9-L13 HydrophobicContact CG1-CD1 4.04Å; V9-L13 HydrophobicContact CG1-CG 4.43Å; V9-L13 WeakPolarHBondContact O-CB 3.41Å; V9-L13 VanDerWaalsContact O-CG 3.3Å; V9-L13 WeakPolarHBondContact O-CG 3.3Å; V9-L13 PolarHBondContact O-N 2.87Å
10	G	96	Very high	92	Very high	33 Å²	33	95.1 Å²	95.1	34%	0.34	56%	0.561	S	S	.	*	H	α-helix	trans	-58.6	-45.4	174.7	0	0	0	0	0	112	D6 Q7 L13 V14	D6-G10 PolarHBondContact O-N 2.93Å; Q7-G10 PolarHBondContact O-N 3Å; G10-L13 PolarHBondContact O-N 3.48Å; G10-V14 WeakPolarHBondContact O-CG2 3.47Å; G10-V14 PolarHBondContact O-N 2.76Å
11	M	96.5	Very high	92.2	Very high	109 Å²	109	97 Å²	97	54%	0.537	56%	0.563	S	S	.	*	H	α-helix	trans	-65	-41	179	-167.3	65.5	72.1	0	0	112.3	Q7 A8 V9 V14 L15	Q7-M11 WeakPolarHBondContact O-CB 3.39Å; Q7-M11 PolarHBondContact O-N 3.39Å; A8-M11 PolarHBondContact O-N 3.38Å; V9-M11 VanDerWaalsContact C-N 3.32Å; V9-M11 PolarHBondContact O-N 3.29Å; M11-V14 PolarHBondContact O-N 3.42Å; M11-L15 HydrophobicContact CG-CD1 4.25Å; M11-L15 WeakPolarHBondContact O-CG 3.45Å; M11-L15 PolarHBondContact O-N 2.99Å
12	S	96.8	Very high	93.8	Very high	65 Å²	65	88.7 Å²	88.7	46%	0.455	53%	0.528	S	S	.	.	H	α-helix	trans	-65.8	-40.9	178.3	67.8	0	0	0	0	111.7	A8 V9 V14 L15 F16	A8-S12 PolarHBondContact O-N 3.08Å; A8-S12 PolarHBondContact O-OG 3.04Å; V9-S12 PolarHBondContact O-N 3.39Å; V9-S12 PolarHBondContact O-OG 3.41Å; S12-V14 PolarHBondContact O-N 2.91Å; S12-L15 PolarHBondContact O-N 2.86Å; S12-F16 WeakPolarHBondContact O-CB 3.24Å; S12-F16 PolarHBondContact O-N 3.48Å
13	L	97.3	Very high	95.1	Very high	107 Å²	107	89.6 Å²	89.6	56%	0.56	52%	0.515	S	S	*	.	H	α-helix	trans	-62.2	-41.5	174.5	-72.6	172.4	0	0	0	112.1	V9 G10 S17	V9-L13 HydrophobicContact CG1-CD1 4.04Å; V9-L13 HydrophobicContact CG1-CG 4.43Å; V9-L13 WeakPolarHBondContact O-CB 3.41Å; V9-L13 VanDerWaalsContact O-CG 3.3Å; V9-L13 WeakPolarHBondContact O-CG 3.3Å; V9-L13 PolarHBondContact O-N 2.87Å; G10-L13 PolarHBondContact O-N 3.48Å; L13-S17 WeakPolarHBondContact O-CB 3.4Å; L13-S17 PolarHBondContact O-N 3.06Å
14	V	97.6	Very high	95.4	Very high	81 Å²	81	89.8 Å²	89.8	49%	0.491	51%	0.507	S	S	.	.	H	α-helix	trans	-64.7	-48.5	176.9	169.9	0	0	0	0	111.1	G10 M11 S12 F16 S17 L18	G10-V14 WeakPolarHBondContact O-CG2 3.47Å; G10-V14 PolarHBondContact O-N 2.76Å; M11-V14 PolarHBondContact O-N 3.42Å; S12-V14 PolarHBondContact O-N 2.91Å; V14-F16 VanDerWaalsContact C-N 3.35Å; V14-F16 PolarHBondContact O-N 3.45Å; V14-S17 WeakPolarHBondContact O-CB 3.34Å; V14-S17 PolarHBondContact O-N 2.98Å; V14-L18 HydrophobicContact CG1-CD1 3.99Å; V14-L18 HydrophobicContact CG1-CG 4.47Å; V14-L18 WeakPolarHBondContact O-CG 3.46Å; V14-L18 PolarHBondContact O-N 3.47Å
15	L	97.6	Very high	95.6	Very high	100 Å²	100	88.8 Å²	88.8	52%	0.524	49%	0.489	S	S	.	.	H	α-helix	trans	-60.8	-45.2	178	-76.4	169.3	0	0	0	111.6	M11 S12 S17 L18 L19	M11-L15 HydrophobicContact CG-CD1 4.25Å; M11-L15 WeakPolarHBondContact O-CG 3.45Å; M11-L15 PolarHBondContact O-N 2.99Å; S12-L15 PolarHBondContact O-N 2.86Å; L15-S17 VanDerWaalsContact C-N 3.34Å; L15-S17 PolarHBondContact O-N 3.32Å; L15-L18 PolarHBondContact O-N 3.49Å; L15-L19 WeakPolarHBondContact O-CG 3.34Å; L15-L19 PolarHBondContact O-N 3.46Å
16	F	97.7	Very high	95.7	Very high	127 Å²	127	88.2 Å²	88.2	56%	0.557	48%	0.479	S	S	*	.	H	α-helix	trans	-61	-43.8	176.4	179.6	-109.2	0	0	0	112	S12 V14 L19 L20	S12-F16 WeakPolarHBondContact O-CB 3.24Å; S12-F16 PolarHBondContact O-N 3.48Å; V14-F16 VanDerWaalsContact C-N 3.35Å; V14-F16 PolarHBondContact O-N 3.45Å; F16-L19 PolarHBondContact O-N 2.83Å; F16-L20 HydrophobicContact CD1-CD1 3.77Å; F16-L20 HydrophobicContact CE1-CD1 3.23Å; F16-L20 HydrophobicContact CE1-CG 4.22Å; F16-L20 HydrophobicContact CE2-CD1 4.19Å; F16-L20 HydrophobicContact CE2-CG 4.37Å; F16-L20 HydrophobicContact CG-CD1 4.46Å; F16-L20 HydrophobicContact CZ-CD1 3.48Å; F16-L20 VanDerWaalsContact CZ-CD1 3.48Å; F16-L20 HydrophobicContact CZ-CG 4.08Å; F16-L20 PolarHBondContact O-N 2.9Å
17	S	97.1	Very high	95.7	Very high	71 Å²	71	84.2 Å²	84.2	50%	0.497	46%	0.457	S	S	.	.	H	α-helix	trans	-61.4	-44.1	176	-175.7	0	0	0	0	111.8	L13 V14 L15 L19 L20 F21	L13-S17 WeakPolarHBondContact O-CB 3.4Å; L13-S17 PolarHBondContact O-N 3.06Å; V14-S17 WeakPolarHBondContact O-CB 3.34Å; V14-S17 PolarHBondContact O-N 2.98Å; L15-S17 VanDerWaalsContact C-N 3.34Å; L15-S17 PolarHBondContact O-N 3.32Å; S17-L19 VanDerWaalsContact C-N 3.34Å; S17-L19 PolarHBondContact O-N 3.07Å; S17-L20 PolarHBondContact O-N 3.4Å; S17-F21 WeakPolarHBondContact O-CB 3.23Å; S17-F21 PolarHBondContact O-N 2.81Å
18	L	97.6	Very high	95.7	Very high	96 Å²	96	80.7 Å²	80.7	50%	0.503	44%	0.444	S	S	.	.	H	α-helix	trans	-61.9	-40.4	177	-74.8	169.3	0	0	0	112.3	V14 L15 S22	V14-L18 HydrophobicContact CG1-CD1 3.99Å; V14-L18 HydrophobicContact CG1-CG 4.47Å; V14-L18 WeakPolarHBondContact O-CG 3.46Å; V14-L18 PolarHBondContact O-N 3.47Å; L15-L18 PolarHBondContact O-N 3.49Å; L18-S22 VanDerWaalsContact O-CB 3.3Å; L18-S22 WeakPolarHBondContact O-CB 3.27Å; L18-S22 PolarHBondContact O-N 2.97Å; L18-S22 PolarHBondContact O-OG 3.32Å
19	L	97.4	Very high	95.6	Very high	123 Å²	123	82.7 Å²	82.7	64%	0.644	45%	0.445	S	S	*	.	H	α-helix	trans	-64.6	-49.4	176.3	-71.6	173.6	0	0	0	111.5	L15 F16 S17 F21 S22 Y23	L15-L19 WeakPolarHBondContact O-CG 3.34Å; L15-L19 PolarHBondContact O-N 3.46Å; F16-L19 PolarHBondContact O-N 2.83Å; S17-L19 VanDerWaalsContact C-N 3.34Å; S17-L19 PolarHBondContact O-N 3.07Å; L19-F21 PolarHBondContact O-N 3.3Å; L19-S22 PolarHBondContact O-N 2.87Å; L19-Y23 WeakPolarHBondContact O-CB 3.34Å; L19-Y23 PolarHBondContact O-N 3.26Å
20	L	95.4	Very high	95.3	Very high	93 Å²	93	81.9 Å²	81.9	49%	0.487	44%	0.441	S	S	.	.	H	α-helix	trans	-58.9	-46.7	176.2	-81.9	172	0	0	0	111.8	F16 S17 S22 Y23 Y24	F16-L20 HydrophobicContact CD1-CD1 3.77Å; F16-L20 HydrophobicContact CE1-CD1 3.23Å; F16-L20 HydrophobicContact CE1-CG 4.22Å; F16-L20 HydrophobicContact CE2-CD1 4.19Å; F16-L20 HydrophobicContact CE2-CG 4.37Å; F16-L20 HydrophobicContact CG-CD1 4.46Å; F16-L20 HydrophobicContact CZ-CD1 3.48Å; F16-L20 VanDerWaalsContact CZ-CD1 3.48Å; F16-L20 HydrophobicContact CZ-CG 4.08Å; F16-L20 PolarHBondContact O-N 2.9Å; S17-L20 PolarHBondContact O-N 3.4Å; L20-S22 PolarHBondContact O-N 3.45Å; L20-Y23 PolarHBondContact O-N 3.41Å; L20-Y24 VanDerWaalsContact O-CB 3.31Å; L20-Y24 WeakPolarHBondContact O-CB 3.35Å; L20-Y24 PolarHBondContact O-N 3.22Å
21	F	95.1	Very high	95	Very high	136 Å²	136	80.4 Å²	80.4	60%	0.596	43%	0.425	S	S	*	.	H	α-helix	trans	-61	-45.6	179.3	176.7	-100.3	0	0	0	111.3	S17 L19 Y24 T25	S17-F21 WeakPolarHBondContact O-CB 3.23Å; S17-F21 PolarHBondContact O-N 2.81Å; L19-F21 PolarHBondContact O-N 3.3Å; F21-Y24 PolarHBondContact O-N 3.44Å; F21-T25 VanDerWaalsContact O-CB 3.24Å; F21-T25 WeakPolarHBondContact O-CB 3.36Å; F21-T25 PolarHBondContact O-N 3.32Å; F21-T25 PolarHBondContact O-OG1 2.92Å
22	S	96	Very high	94.6	Very high	64 Å²	64	77 Å²	77	45%	0.448	41%	0.411	S	S	.	.	H	α-helix	trans	-64.6	-45.8	178.9	-57.6	0	0	0	0	111.3	L18 L19 L20 Y24 T25 V26	L18-S22 VanDerWaalsContact O-CB 3.3Å; L18-S22 WeakPolarHBondContact O-CB 3.27Å; L18-S22 PolarHBondContact O-N 2.97Å; L18-S22 PolarHBondContact O-OG 3.32Å; L19-S22 PolarHBondContact O-N 2.87Å; L20-S22 PolarHBondContact O-N 3.45Å; S22-Y24 VanDerWaalsContact C-N 3.35Å; S22-Y24 PolarHBondContact O-N 2.95Å; S22-T25 PolarHBondContact O-N 3.26Å; S22-V26 WeakPolarHBondContact O-CG2 3.28Å; S22-V26 PolarHBondContact O-N 2.9Å
23	Y	94.2	Very high	94.3	Very high	100 Å²	100	82.3 Å²	82.3	39%	0.392	43%	0.426	S	S	.	.	H	α-helix	trans	-56.6	-49.2	175.8	177.6	-92.4	0	0	0	111.3	L19 L20 V26 W27 Y43 F44	L19-Y23 WeakPolarHBondContact O-CB 3.34Å; L19-Y23 PolarHBondContact O-N 3.26Å; L20-Y23 PolarHBondContact O-N 3.41Å; Y23-V26 PolarHBondContact O-N 2.86Å; Y23-W27 HydrophobicContact CE1-CE3 4.24Å; Y23-W27 WeakPolarHBondContact O-CB 3.45Å; Y23-W27 PolarHBondContact O-N 3.04Å; Y23-Y43 PolarHBondContact OH-O 3.27Å; Y23-F44 HydrophobicContact CD2-CD1 4.5Å; Y23-F44 AromaticContact CD2-CE1 3.82Å; Y23-F44 HydrophobicContact CD2-CE1 3.82Å; Y23-F44 HydrophobicContact CE1-CD1 4.29Å; Y23-F44 HydrophobicContact CE1-CE1 4.38Å; Y23-F44 AromaticContact CE2-CD1 3.85Å; Y23-F44 HydrophobicContact CE2-CD1 3.85Å; Y23-F44 AromaticContact CE2-CE1 3.57Å; Y23-F44 HydrophobicContact CE2-CE1 3.57Å; Y23-F44 HydrophobicContact CE2-CZ 4.39Å; Y23-F44 HydrophobicContact CG-CE1 4.32Å; Y23-F44 AromaticContact CZ-CD1 3.73Å; Y23-F44 AromaticContact CZ-CE1 3.88Å
24	Y	94.1	Very high	93.8	Very high	82 Å²	82	78.7 Å²	78.7	32%	0.322	41%	0.408	S	S	.	.	H	α-helix	trans	-68.4	-36.4	-178.9	-168.1	-98.2	0	0	0	112.7	L20 F21 S22 W27 V28 S50 P54	L20-Y24 VanDerWaalsContact O-CB 3.31Å; L20-Y24 WeakPolarHBondContact O-CB 3.35Å; L20-Y24 PolarHBondContact O-N 3.22Å; F21-Y24 PolarHBondContact O-N 3.44Å; S22-Y24 VanDerWaalsContact C-N 3.35Å; S22-Y24 PolarHBondContact O-N 2.95Å; Y24-W27 AromaticContact CD2-CE3 3.83Å; Y24-W27 HydrophobicContact CD2-CE3 3.83Å; Y24-W27 HydrophobicContact CD2-CZ3 4.26Å; Y24-W27 HydrophobicContact CE2-CE3 4.04Å; Y24-W27 HydrophobicContact CE2-CZ3 4.2Å; Y24-W27 WeakPolarHBondContact O-CB 3.42Å; Y24-W27 PolarHBondContact O-N 3.11Å; Y24-V28 HydrophobicContact CD1-CG2 4.03Å; Y24-V28 HydrophobicContact CE1-CG2 3.55Å; Y24-V28 HydrophobicContact CE2-CG2 4.23Å; Y24-V28 WeakPolarHBondContact O-CG2 3.37Å; Y24-V28 PolarHBondContact O-N 3.18Å; Y24-S50 PolarHBondContact OH-O 3.41Å; Y24-P54 WeakPolarHBondContact OH-CG 3.37Å
25	T	92.9	Very high	93.3	Very high	41 Å²	41	80.9 Å²	80.9	25%	0.252	42%	0.417	S	S	.	.	H	α-helix	trans	-63.8	-47	176	-61.7	0	0	0	0	111.1	F21 S22 W27 V28 I29	F21-T25 VanDerWaalsContact O-CB 3.24Å; F21-T25 WeakPolarHBondContact O-CB 3.36Å; F21-T25 PolarHBondContact O-N 3.32Å; F21-T25 PolarHBondContact O-OG1 2.92Å; S22-T25 PolarHBondContact O-N 3.26Å; T25-W27 VanDerWaalsContact C-N 3.26Å; T25-W27 PolarHBondContact O-N 3.47Å; T25-V28 PolarHBondContact O-N 3.35Å; T25-I29 HydrophobicContact CG2-CD1 3.81Å; T25-I29 HydrophobicContact CG2-CG1 4.36Å; T25-I29 VanDerWaalsContact O-CB 3.31Å; T25-I29 WeakPolarHBondContact O-CB 3.47Å; T25-I29 PolarHBondContact O-N 3.16Å
26	V	93.3	Very high	92.5	Very high	53 Å²	53	79.1 Å²	79.1	32%	0.321	42%	0.423	S	S	.	.	I	π-helix	trans	-60.9	-41.4	174.9	174.7	0	0	0	0	110.2	S22 Y23 V30 L31 F44	S22-V26 WeakPolarHBondContact O-CG2 3.28Å; S22-V26 PolarHBondContact O-N 2.9Å; Y23-V26 PolarHBondContact O-N 2.86Å; V26-V30 HydrophobicContact CG1-CB 4.01Å; V26-V30 HydrophobicContact CG1-CG1 4.45Å; V26-V30 HydrophobicContact CG1-CG2 4.4Å; V26-V30 WeakPolarHBondContact O-CA 3.3Å; V26-V30 VanDerWaalsContact O-CB 3.31Å; V26-V30 WeakPolarHBondContact O-CB 3.45Å; V26-V30 PolarHBondContact O-N 2.92Å; V26-L31 PolarHBondContact O-N 2.98Å; V26-F44 HydrophobicContact CB-CE1 4.46Å; V26-F44 HydrophobicContact CB-CZ 4.03Å; V26-F44 HydrophobicContact CG1-CE1 4.29Å; V26-F44 HydrophobicContact CG1-CE2 3.96Å; V26-F44 HydrophobicContact CG1-CZ 3.46Å; V26-F44 VanDerWaalsContact CG1-CZ 3.46Å
27	W	92.9	Very high	91.7	Very high	9 Å²	9	84.7 Å²	84.7	3%	0.034	44%	0.441	C	S	.	.	I	π-helix	trans	-62.5	-45.2	179.9	-169.2	15.9	0	0	0	113.3	Y23 Y24 T25 L31 F44 L45 L53	Y23-W27 HydrophobicContact CE1-CE3 4.24Å; Y23-W27 WeakPolarHBondContact O-CB 3.45Å; Y23-W27 PolarHBondContact O-N 3.04Å; Y24-W27 AromaticContact CD2-CE3 3.83Å; Y24-W27 HydrophobicContact CD2-CE3 3.83Å; Y24-W27 HydrophobicContact CD2-CZ3 4.26Å; Y24-W27 HydrophobicContact CE2-CE3 4.04Å; Y24-W27 HydrophobicContact CE2-CZ3 4.2Å; Y24-W27 WeakPolarHBondContact O-CB 3.42Å; Y24-W27 PolarHBondContact O-N 3.11Å; T25-W27 VanDerWaalsContact C-N 3.26Å; T25-W27 PolarHBondContact O-N 3.47Å; W27-L31 VanDerWaalsContact O-CB 3.22Å; W27-L31 WeakPolarHBondContact O-CB 3.27Å; W27-F44 HydrophobicContact CB-CD1 3.54Å; W27-F44 HydrophobicContact CB-CE1 3.76Å; W27-F44 HydrophobicContact CB-CG 4.45Å; W27-F44 AromaticContact CD1-CD1 3.73Å; W27-F44 AromaticContact CD1-CG 3.91Å; W27-F44 HydrophobicContact CD2-CD1 4.34Å; W27-F44 HydrophobicContact CG-CB 4.33Å; W27-F44 AromaticContact CG-CD1 3.59Å; W27-F44 HydrophobicContact CG-CD1 3.59Å; W27-F44 HydrophobicContact CG-CE1 4.32Å; W27-F44 HydrophobicContact CG-CG 4.24Å; W27-L45 HydrophobicContact CH2-CB 3.81Å; W27-L45 HydrophobicContact CH2-CD2 4.49Å; W27-L45 HydrophobicContact CZ2-CB 3.36Å; W27-L45 PolarHBondContact NE1-O 3.35Å; W27-L53 HydrophobicContact CH2-CD1 3.79Å; W27-L53 HydrophobicContact CZ3-CD1 3.86Å
28	V	92.3	Very high	91.2	Very high	60 Å²	60	85.8 Å²	85.8	36%	0.364	44%	0.438	S	S	.	.	I	π-helix	trans	-81.4	-42.3	-176.7	173.2	0	0	0	0	112.3	Y24 T25 P32	Y24-V28 HydrophobicContact CD1-CG2 4.03Å; Y24-V28 HydrophobicContact CE1-CG2 3.55Å; Y24-V28 HydrophobicContact CE2-CG2 4.23Å; Y24-V28 WeakPolarHBondContact O-CG2 3.37Å; Y24-V28 PolarHBondContact O-N 3.18Å; T25-V28 PolarHBondContact O-N 3.35Å; V28-P32 VanDerWaalsContact O-CD 3.31Å; V28-P32 WeakPolarHBondContact O-CD 3.45Å; V28-P32 WeakPolarHBondContact O-CG 3.49Å
29	I	92.7	Very high	90.6	Very high	102 Å²	102	86 Å²	86	52%	0.523	44%	0.442	S	S	.	.	I	π-helix	trans	-96.2	-41.5	-169.5	-54.4	-174.8	0	0	0	111.8	T25 P32 F33	T25-I29 HydrophobicContact CG2-CD1 3.81Å; T25-I29 HydrophobicContact CG2-CG1 4.36Å; T25-I29 VanDerWaalsContact O-CB 3.31Å; T25-I29 WeakPolarHBondContact O-CB 3.47Å; T25-I29 PolarHBondContact O-N 3.16Å; I29-P32 WeakPolarHBondContact O-CD 3.21Å; I29-P32 VanDerWaalsContact O-CG 3.22Å; I29-P32 WeakPolarHBondContact O-CG 3.39Å; I29-F33 WeakPolarHBondContact O-CD2 2.98Å; I29-F33 WeakPolarHBondContact O-CE2 3.49Å
30	V	90.6	Very high	90	Very high	67 Å²	67	82.8 Å²	82.8	41%	0.406	43%	0.426	S	S	.	.	I	π-helix	trans	-90	-47.8	-172.4	-180	0	0	0	0	112.2	V26 P32 F33 V34	V26-V30 HydrophobicContact CG1-CB 4.01Å; V26-V30 HydrophobicContact CG1-CG1 4.45Å; V26-V30 HydrophobicContact CG1-CG2 4.4Å; V26-V30 WeakPolarHBondContact O-CA 3.3Å; V26-V30 VanDerWaalsContact O-CB 3.31Å; V26-V30 WeakPolarHBondContact O-CB 3.45Å; V26-V30 PolarHBondContact O-N 2.92Å; V30-P32 VanDerWaalsContact O-N 3.08Å; V30-F33 PolarHBondContact O-N 3.27Å; V30-V34 HydrophobicContact CG1-CG2 4.19Å
31	L	89.7	Confident	89.5	Confident	3 Å²	3	81.7 Å²	81.7	2%	0.016	42%	0.418	C	S	.	.	G	3₁₀ helix	trans	-49.6	-35.1	179.8	-161.5	68.5	0	0	0	114.2	V26 W27 F33 V34 L40 F44	V26-L31 PolarHBondContact O-N 2.98Å; W27-L31 VanDerWaalsContact O-CB 3.22Å; W27-L31 WeakPolarHBondContact O-CB 3.27Å; L31-F33 PolarHBondContact O-N 3.4Å; L31-V34 PolarHBondContact O-N 3.01Å; L31-V34 VanDerWaalsContact O-N 3.16Å; L31-L40 HydrophobicContact CD1-CB 4.28Å; L31-F44 HydrophobicContact CD1-CB 4.5Å; L31-F44 HydrophobicContact CD1-CD2 3.9Å; L31-F44 HydrophobicContact CD1-CG 4.45Å; L31-F44 HydrophobicContact CD2-CB 3.78Å; L31-F44 HydrophobicContact CD2-CG 4.25Å
32	P	87.9	Confident	89.1	Confident	36 Å²	36	86.2 Å²	86.2	23%	0.234	43%	0.431	C	S	.	.	G	3₁₀ helix	trans	-66.3	-19.5	-179	27.3	-40.1	0	0	0	116.4	V28 I29 V30 R47	V28-P32 VanDerWaalsContact O-CD 3.31Å; V28-P32 WeakPolarHBondContact O-CD 3.45Å; V28-P32 WeakPolarHBondContact O-CG 3.49Å; I29-P32 WeakPolarHBondContact O-CD 3.21Å; I29-P32 VanDerWaalsContact O-CG 3.22Å; I29-P32 WeakPolarHBondContact O-CG 3.39Å; V30-P32 VanDerWaalsContact O-N 3.08Å; P32-R47 PolarHBondContact O-NH2 3.2Å
33	F	90.1	Very high	88.8	Confident	178 Å²	178	91.1 Å²	91.1	78%	0.781	44%	0.441	S	S	*	.	G	3₁₀ helix	trans	-99.7	-0.1	178.7	-55.9	-76	0	0	0	112.7	I29 V30 L31	I29-F33 WeakPolarHBondContact O-CD2 2.98Å; I29-F33 WeakPolarHBondContact O-CE2 3.49Å; V30-F33 PolarHBondContact O-N 3.27Å; L31-F33 PolarHBondContact O-N 3.4Å
34	V	87.8	Confident	88.5	Confident	31 Å²	31	87.4 Å²	87.4	19%	0.188	43%	0.427	C	S	.	.	S	Bend	trans	-95.2	138.9	-179.7	170.3	0	0	0	0	109.8	V30 L31 H38 L40 H41	V30-V34 HydrophobicContact CG1-CG2 4.19Å; L31-V34 PolarHBondContact O-N 3.01Å; L31-V34 VanDerWaalsContact O-N 3.16Å; V34-H38 HydrophobicContact CG1-CB 3.49Å; V34-H38 VanDerWaalsContact CG1-CB 3.49Å; V34-H38 VanDerWaalsContact CG1-CD2 3.44Å; V34-H38 WeakPolarHBondContact CG1-CD2 3.39Å; V34-L40 HydrophobicContact CG1-CB 4.42Å; V34-L40 HydrophobicContact CG1-CD1 4.26Å; V34-L40 HydrophobicContact CG2-CD1 4.09Å; V34-H41 PolarHBondContact O-CE1 2.92Å
35	D	86.1	Confident	88.2	Confident	126 Å²	126	87.5 Å²	87.5	67%	0.674	43%	0.432	S	S	*	.			trans	-59.7	141.4	176.2	-85.1	-26.9	0	0	0	112.6	R37 H38 H41	D35-R37 PolarHBondContact O-N 3.26Å; D35-R37 VanDerWaalsContact O-N 3.1Å; D35-H38 WeakPolarHBondContact O-CB 3.47Å; D35-H38 PolarHBondContact O-N 3.02Å; D35-H41 PolarHBondContact O-CE1 3.35Å; D35-H41 PolarHBondContact O-ND1 3.17Å; D35-H41 VanDerWaalsContact O-ND1 3.17Å
36	G	81.1	Confident	88	Confident	63 Å²	63	89.4 Å²	89.4	65%	0.649	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.2	-18	-179.2	0	0	0	0	0	115.1	H38	G36-H38 VanDerWaalsContact C-N 3.35Å
37	R	81.8	Confident	87.7	Confident	245 Å²	245	93.7 Å²	93.7	93%	0.925	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.9	-3.2	175	-67.1	-178	-74.5	-170.6	-3.1	113	D35	D35-R37 PolarHBondContact O-N 3.26Å; D35-R37 VanDerWaalsContact O-N 3.1Å
38	H	85.6	Confident	87.5	Confident	94 Å²	94	100.1 Å²	100.1	44%	0.435	49%	0.486	S	S	.	.	S	Bend	trans	-76.9	143.6	-177.9	-160.1	34.9	0	0	0	111.3	V34 D35 G36 L40 H41	V34-H38 HydrophobicContact CG1-CB 3.49Å; V34-H38 VanDerWaalsContact CG1-CB 3.49Å; V34-H38 VanDerWaalsContact CG1-CD2 3.44Å; V34-H38 WeakPolarHBondContact CG1-CD2 3.39Å; D35-H38 WeakPolarHBondContact O-CB 3.47Å; D35-H38 PolarHBondContact O-N 3.02Å; G36-H38 VanDerWaalsContact C-N 3.35Å; H38-L40 PolarHBondContact O-N 2.85Å; H38-H41 PolarHBondContact O-N 2.98Å
39	V	86.4	Confident	87.4	Confident	99 Å²	99	102.3 Å²	102.3	60%	0.6	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58	-24.3	-175.9	-63	0	0	0	0	113.6	H41 R42 Y43	V39-H41 PolarHBondContact O-N 3.48Å; V39-R42 WeakPolarHBondContact O-CB 3.22Å; V39-R42 PolarHBondContact O-N 3.2Å; V39-Y43 WeakPolarHBondContact O-CD2 3.38Å
40	L	84.3	Confident	87.2	Confident	56 Å²	56	97.9 Å²	97.9	29%	0.293	47%	0.467	S	S	.	.	H	α-helix	trans	-55.8	-36.9	175.3	-71.6	177.6	0	0	0	112.1	L31 V34 H38 R42 Y43 F44	L31-L40 HydrophobicContact CD1-CB 4.28Å; V34-L40 HydrophobicContact CG1-CB 4.42Å; V34-L40 HydrophobicContact CG1-CD1 4.26Å; V34-L40 HydrophobicContact CG2-CD1 4.09Å; H38-L40 PolarHBondContact O-N 2.85Å; L40-R42 PolarHBondContact O-N 2.73Å; L40-Y43 PolarHBondContact O-N 3.1Å; L40-F44 HydrophobicContact CB-CD2 4.46Å; L40-F44 HydrophobicContact CB-CE2 4.46Å; L40-F44 HydrophobicContact CD2-CE2 4.27Å; L40-F44 WeakPolarHBondContact O-CD2 3.35Å; L40-F44 PolarHBondContact O-N 2.93Å
41	H	85.4	Confident	87.3	Confident	70 Å²	70	100 Å²	100	32%	0.324	48%	0.48	S	S	.	.	H	α-helix	trans	-62.7	-15.5	177.9	-79.7	83.6	0	0	0	113.8	V34 D35 H38 V39 F44	V34-H41 PolarHBondContact O-CE1 2.92Å; D35-H41 PolarHBondContact O-CE1 3.35Å; D35-H41 PolarHBondContact O-ND1 3.17Å; D35-H41 VanDerWaalsContact O-ND1 3.17Å; H38-H41 PolarHBondContact O-N 2.98Å; V39-H41 PolarHBondContact O-N 3.48Å; H41-F44 VanDerWaalsContact O-O 3.1Å
42	R	85.9	Confident	87.5	Confident	231 Å²	231	103.7 Å²	103.7	87%	0.872	50%	0.499	S	S	*	.	H	α-helix	trans	-82.7	-24.7	173.1	-172.7	174.4	179.3	172.8	-0.2	113	V39 L40	V39-R42 WeakPolarHBondContact O-CB 3.22Å; V39-R42 PolarHBondContact O-N 3.2Å; L40-R42 PolarHBondContact O-N 2.73Å
43	Y	89.4	Confident	87.7	Confident	167 Å²	167	106.3 Å²	106.3	66%	0.655	51%	0.51	S	S	*	.	H	α-helix	trans	-88.8	-20.9	179.9	-66.8	-79.4	0	0	0	112.7	Y23 V39 L40	Y23-Y43 PolarHBondContact OH-O 3.27Å; V39-Y43 WeakPolarHBondContact O-CD2 3.38Å; L40-Y43 PolarHBondContact O-N 3.1Å
44	F	88.3	Confident	87.8	Confident	23 Å²	23	100.6 Å²	100.6	10%	0.101	49%	0.491	C	S	.	.	S	Bend	trans	-107.7	149.5	178.5	-65.3	-76	0	0	0	111.3	Y23 V26 W27 L31 L40 H41	Y23-F44 HydrophobicContact CD2-CD1 4.5Å; Y23-F44 AromaticContact CD2-CE1 3.82Å; Y23-F44 HydrophobicContact CD2-CE1 3.82Å; Y23-F44 HydrophobicContact CE1-CD1 4.29Å; Y23-F44 HydrophobicContact CE1-CE1 4.38Å; Y23-F44 AromaticContact CE2-CD1 3.85Å; Y23-F44 HydrophobicContact CE2-CD1 3.85Å; Y23-F44 AromaticContact CE2-CE1 3.57Å; Y23-F44 HydrophobicContact CE2-CE1 3.57Å; Y23-F44 HydrophobicContact CE2-CZ 4.39Å; Y23-F44 HydrophobicContact CG-CE1 4.32Å; Y23-F44 AromaticContact CZ-CD1 3.73Å; Y23-F44 AromaticContact CZ-CE1 3.88Å; V26-F44 HydrophobicContact CB-CE1 4.46Å; V26-F44 HydrophobicContact CB-CZ 4.03Å; V26-F44 HydrophobicContact CG1-CE1 4.29Å; V26-F44 HydrophobicContact CG1-CE2 3.96Å; V26-F44 HydrophobicContact CG1-CZ 3.46Å; V26-F44 VanDerWaalsContact CG1-CZ 3.46Å; W27-F44 HydrophobicContact CB-CD1 3.54Å; W27-F44 HydrophobicContact CB-CE1 3.76Å; W27-F44 HydrophobicContact CB-CG 4.45Å; W27-F44 AromaticContact CD1-CD1 3.73Å; W27-F44 AromaticContact CD1-CG 3.91Å; W27-F44 HydrophobicContact CD2-CD1 4.34Å; W27-F44 HydrophobicContact CG-CB 4.33Å; W27-F44 AromaticContact CG-CD1 3.59Å; W27-F44 HydrophobicContact CG-CD1 3.59Å; W27-F44 HydrophobicContact CG-CE1 4.32Å; W27-F44 HydrophobicContact CG-CG 4.24Å; L31-F44 HydrophobicContact CD1-CB 4.5Å; L31-F44 HydrophobicContact CD1-CD2 3.9Å; L31-F44 HydrophobicContact CD1-CG 4.45Å; L31-F44 HydrophobicContact CD2-CB 3.78Å; L31-F44 HydrophobicContact CD2-CG 4.25Å; L40-F44 HydrophobicContact CB-CD2 4.46Å; L40-F44 HydrophobicContact CB-CE2 4.46Å; L40-F44 HydrophobicContact CD2-CE2 4.27Å; L40-F44 WeakPolarHBondContact O-CD2 3.35Å; L40-F44 PolarHBondContact O-N 2.93Å; H41-F44 VanDerWaalsContact O-O 3.1Å
45	L	88.3	Confident	88.1	Confident	83 Å²	83	100.9 Å²	100.9	44%	0.435	50%	0.5	S	S	.	.			trans	-66.6	159.4	169	-93.7	67.8	0	0	0	110.1	W27 R47 Y49	W27-L45 HydrophobicContact CH2-CB 3.81Å; W27-L45 HydrophobicContact CH2-CD2 4.49Å; W27-L45 HydrophobicContact CZ2-CB 3.36Å; W27-L45 PolarHBondContact NE1-O 3.35Å; L45-R47 PolarHBondContact O-N 3.17Å; L45-Y49 HydrophobicContact CB-CD2 4.24Å; L45-Y49 HydrophobicContact CB-CG 4.44Å; L45-Y49 HydrophobicContact CD2-CD1 4.45Å; L45-Y49 HydrophobicContact CD2-CD2 4.29Å; L45-Y49 HydrophobicContact CD2-CG 4.04Å
46	P	88.6	Confident	88.6	Confident	81 Å²	81	98.6 Å²	98.6	53%	0.526	49%	0.491	S	S	.	.			trans	-49.4	143.2	172.3	-26	33	0	0	0	111.5	E48 Y49	P46-E48 PolarHBondContact O-N 3.04Å; P46-Y49 HydrophobicContact CB-CD2 3.88Å; P46-Y49 HydrophobicContact CB-CE2 4.11Å; P46-Y49 HydrophobicContact CG-CD2 4.02Å; P46-Y49 HydrophobicContact CG-CE2 3.95Å; P46-Y49 WeakPolarHBondContact O-CB 3.17Å; P46-Y49 WeakPolarHBondContact O-CD2 3.31Å; P46-Y49 PolarHBondContact O-N 3.42Å
47	R	86.1	Confident	89.2	Confident	143 Å²	143	98.4 Å²	98.4	54%	0.54	48%	0.483	S	S	.	.	T	Hydrogen-bonded Turn	trans	-51.2	-36.9	-171.9	-176	-169.4	-70.3	-145.4	13.1	113.3	P32 L45 Y49 S50	P32-R47 PolarHBondContact O-NH2 3.2Å; L45-R47 PolarHBondContact O-N 3.17Å; R47-Y49 PolarHBondContact O-N 2.92Å; R47-Y49 VanDerWaalsContact O-N 3.16Å; R47-S50 WeakPolarHBondContact O-CB 3.46Å; R47-S50 PolarHBondContact O-N 3.43Å; R47-S50 PolarHBondContact O-OG 3.16Å
48	E	89.3	Confident	89.9	Confident	144 Å²	144	89.3 Å²	89.3	67%	0.673	46%	0.46	S	S	*	.	H	α-helix	trans	-55	-35.6	-179	-60.1	176.3	176.5	0	0	112.3	P46 S50 V51 I52	P46-E48 PolarHBondContact O-N 3.04Å; E48-S50 PolarHBondContact O-N 2.97Å; E48-V51 PolarHBondContact O-N 3.27Å; E48-I52 HydrophobicContact CB-CD1 4.12Å; E48-I52 WeakPolarHBondContact O-CD1 3.42Å; E48-I52 VanDerWaalsContact O-CG1 3.27Å; E48-I52 WeakPolarHBondContact O-CG1 3.31Å; E48-I52 PolarHBondContact O-N 3.31Å; E48-I52 VanDerWaalsContact O-N 3.11Å
49	Y	90.6	Very high	90.5	Very high	107 Å²	107	88.7 Å²	88.7	42%	0.42	46%	0.463	S	S	.	.	H	α-helix	trans	-68.1	-21.4	179.6	-68.5	-78.5	0	0	0	113.5	L45 P46 R47 V51 I52 L53	L45-Y49 HydrophobicContact CB-CD2 4.24Å; L45-Y49 HydrophobicContact CB-CG 4.44Å; L45-Y49 HydrophobicContact CD2-CD1 4.45Å; L45-Y49 HydrophobicContact CD2-CD2 4.29Å; L45-Y49 HydrophobicContact CD2-CG 4.04Å; P46-Y49 HydrophobicContact CB-CD2 3.88Å; P46-Y49 HydrophobicContact CB-CE2 4.11Å; P46-Y49 HydrophobicContact CG-CD2 4.02Å; P46-Y49 HydrophobicContact CG-CE2 3.95Å; P46-Y49 WeakPolarHBondContact O-CB 3.17Å; P46-Y49 WeakPolarHBondContact O-CD2 3.31Å; P46-Y49 PolarHBondContact O-N 3.42Å; R47-Y49 PolarHBondContact O-N 2.92Å; R47-Y49 VanDerWaalsContact O-N 3.16Å; Y49-V51 PolarHBondContact O-N 2.98Å; Y49-I52 PolarHBondContact O-N 2.83Å; Y49-L53 WeakPolarHBondContact O-CB 3.43Å; Y49-L53 PolarHBondContact O-N 2.9Å
50	S	88.9	Confident	91.1	Very high	9 Å²	9	89.2 Å²	89.2	6%	0.063	46%	0.461	C	S	.	.	H	α-helix	trans	-67.2	-25.6	176.1	79.1	0	0	0	0	111.9	Y24 R47 E48 P54	Y24-S50 PolarHBondContact OH-O 3.41Å; R47-S50 WeakPolarHBondContact O-CB 3.46Å; R47-S50 PolarHBondContact O-N 3.43Å; R47-S50 PolarHBondContact O-OG 3.16Å; E48-S50 PolarHBondContact O-N 2.97Å; S50-P54 WeakPolarHBondContact O-CD 3.31Å
51	V	92	Very high	91.7	Very high	111 Å²	111	91.8 Å²	91.8	67%	0.673	48%	0.475	S	S	*	.	H	α-helix	trans	-94.8	-36.2	175.2	-175.7	0	0	0	0	111.2	E48 Y49 P54 G55	E48-V51 PolarHBondContact O-N 3.27Å; Y49-V51 PolarHBondContact O-N 2.98Å; V51-P54 WeakPolarHBondContact O-CD 3.22Å; V51-G55 PolarHBondContact O-N 2.97Å
52	I	93.7	Very high	92.3	Very high	80 Å²	80	94.2 Å²	94.2	41%	0.41	49%	0.49	S	S	.	.	H	α-helix	trans	-66.3	-40.8	-178.4	-64.2	163.8	0	0	0	111.5	E48 Y49 G55 V56	E48-I52 HydrophobicContact CB-CD1 4.12Å; E48-I52 WeakPolarHBondContact O-CD1 3.42Å; E48-I52 VanDerWaalsContact O-CG1 3.27Å; E48-I52 WeakPolarHBondContact O-CG1 3.31Å; E48-I52 PolarHBondContact O-N 3.31Å; E48-I52 VanDerWaalsContact O-N 3.11Å; Y49-I52 PolarHBondContact O-N 2.83Å; I52-G55 PolarHBondContact O-N 3.44Å; I52-G55 VanDerWaalsContact O-N 3.17Å; I52-V56 HydrophobicContact CG2-CG2 3.86Å; I52-V56 WeakPolarHBondContact O-CG2 3.31Å; I52-V56 PolarHBondContact O-N 3.01Å
53	L	92	Very high	92.8	Very high	91 Å²	91	88.1 Å²	88.1	48%	0.476	47%	0.474	S	S	.	.	H	α-helix	trans	-58	-54.5	-178.1	-105.1	149	0	0	0	113.1	W27 Y49 G55 V56 A57	W27-L53 HydrophobicContact CH2-CD1 3.79Å; W27-L53 HydrophobicContact CZ3-CD1 3.86Å; Y49-L53 WeakPolarHBondContact O-CB 3.43Å; Y49-L53 PolarHBondContact O-N 2.9Å; L53-G55 VanDerWaalsContact C-N 3.28Å; L53-G55 PolarHBondContact O-N 3.41Å; L53-V56 PolarHBondContact O-N 3.05Å; L53-A57 WeakPolarHBondContact O-CB 3.44Å; L53-A57 PolarHBondContact O-N 3.45Å
54	P	91.5	Very high	93.2	Very high	59 Å²	59	84.1 Å²	84.1	38%	0.383	47%	0.469	S	S	.	.	H	α-helix	trans	-59.8	-38.1	173.4	-22.6	31.4	0	0	0	112.9	Y24 S50 V51 A57 A58	Y24-P54 WeakPolarHBondContact OH-CG 3.37Å; S50-P54 WeakPolarHBondContact O-CD 3.31Å; V51-P54 WeakPolarHBondContact O-CD 3.22Å; P54-A57 PolarHBondContact O-N 3.04Å; P54-A58 WeakPolarHBondContact O-CB 3.36Å; P54-A58 PolarHBondContact O-N 3.04Å
55	G	94.9	Very high	93.6	Very high	36 Å²	36	86.9 Å²	86.9	37%	0.371	49%	0.488	S	S	.	.	H	α-helix	trans	-60.8	-48.4	178.2	0	0	0	0	0	112.3	V51 I52 L53 A58 V59	V51-G55 PolarHBondContact O-N 2.97Å; I52-G55 PolarHBondContact O-N 3.44Å; I52-G55 VanDerWaalsContact O-N 3.17Å; L53-G55 VanDerWaalsContact C-N 3.28Å; L53-G55 PolarHBondContact O-N 3.41Å; G55-A58 PolarHBondContact O-N 2.87Å; G55-V59 WeakPolarHBondContact O-CG2 3.11Å; G55-V59 PolarHBondContact O-N 2.7Å
56	V	96.1	Very high	94.1	Very high	79 Å²	79	84.9 Å²	84.9	48%	0.479	49%	0.487	S	S	.	.	H	α-helix	trans	-63.2	-43.3	176.4	172.5	0	0	0	0	110.7	I52 L53 A58 V59 L60	I52-V56 HydrophobicContact CG2-CG2 3.86Å; I52-V56 WeakPolarHBondContact O-CG2 3.31Å; I52-V56 PolarHBondContact O-N 3.01Å; L53-V56 PolarHBondContact O-N 3.05Å; V56-A58 VanDerWaalsContact C-N 3.32Å; V56-A58 PolarHBondContact O-N 3.27Å; V56-V59 PolarHBondContact O-N 3.16Å; V56-L60 HydrophobicContact CG1-CD1 3.92Å; V56-L60 HydrophobicContact CG1-CG 4.23Å; V56-L60 WeakPolarHBondContact O-CB 3.09Å; V56-L60 VanDerWaalsContact O-CG 3.3Å; V56-L60 WeakPolarHBondContact O-CG 3.44Å; V56-L60 PolarHBondContact O-N 3.39Å
57	A	95.1	Very high	94.4	Very high	59 Å²	59	85 Å²	85	49%	0.488	49%	0.486	S	S	.	.	H	α-helix	trans	-59.4	-42.7	176.6	0	0	0	0	0	112.1	L53 P54 L60 L61	L53-A57 WeakPolarHBondContact O-CB 3.44Å; L53-A57 PolarHBondContact O-N 3.45Å; P54-A57 PolarHBondContact O-N 3.04Å; A57-L60 PolarHBondContact O-N 2.92Å; A57-L61 WeakPolarHBondContact O-CB 3.24Å; A57-L61 PolarHBondContact O-N 3.48Å
58	A	96.5	Very high	94.9	Very high	53 Å²	53	84.8 Å²	84.8	44%	0.438	49%	0.49	S	S	.	.	H	α-helix	trans	-63.9	-44.8	176.1	0	0	0	0	0	112	P54 G55 V56 L61 L62	P54-A58 WeakPolarHBondContact O-CB 3.36Å; P54-A58 PolarHBondContact O-N 3.04Å; G55-A58 PolarHBondContact O-N 2.87Å; V56-A58 VanDerWaalsContact C-N 3.32Å; V56-A58 PolarHBondContact O-N 3.27Å; A58-L61 PolarHBondContact O-N 3.36Å; A58-L62 WeakPolarHBondContact O-CG 3.36Å; A58-L62 PolarHBondContact O-N 2.94Å
59	V	97.8	Very high	95.2	Very high	82 Å²	82	81.8 Å²	81.8	50%	0.497	48%	0.481	S	S	.	.	H	α-helix	trans	-61.6	-45.8	176.6	171.4	0	0	0	0	111	G55 V56 L61 L62 L63	G55-V59 WeakPolarHBondContact O-CG2 3.11Å; G55-V59 PolarHBondContact O-N 2.7Å; V56-V59 PolarHBondContact O-N 3.16Å; V59-L61 VanDerWaalsContact C-N 3.33Å; V59-L61 PolarHBondContact O-N 2.92Å; V59-L62 PolarHBondContact O-N 2.96Å; V59-L63 HydrophobicContact CG1-CD1 3.98Å; V59-L63 HydrophobicContact CG1-CG 4.32Å; V59-L63 WeakPolarHBondContact O-CB 3.37Å; V59-L63 VanDerWaalsContact O-CG 3.3Å; V59-L63 WeakPolarHBondContact O-CG 3.3Å; V59-L63 PolarHBondContact O-N 2.99Å
60	L	97.9	Very high	95.5	Very high	109 Å²	109	79.5 Å²	79.5	57%	0.571	48%	0.484	S	S	*	.	H	α-helix	trans	-61.2	-41.9	177.4	-72.1	175.1	0	0	0	111.9	V56 A57 L63 C64	V56-L60 HydrophobicContact CG1-CD1 3.92Å; V56-L60 HydrophobicContact CG1-CG 4.23Å; V56-L60 WeakPolarHBondContact O-CB 3.09Å; V56-L60 VanDerWaalsContact O-CG 3.3Å; V56-L60 WeakPolarHBondContact O-CG 3.44Å; V56-L60 PolarHBondContact O-N 3.39Å; A57-L60 PolarHBondContact O-N 2.92Å; L60-L63 PolarHBondContact O-N 3.02Å; L60-C64 VanDerWaalsContact O-CB 3.28Å; L60-C64 WeakPolarHBondContact O-CB 3.33Å; L60-C64 PolarHBondContact O-N 2.73Å
61	L	96.7	Very high	95.8	Very high	111 Å²	111	83.4 Å²	83.4	58%	0.581	51%	0.508	S	S	*	.	H	α-helix	trans	-62.7	-45.7	175.9	-174.6	148.8	0	0	0	111.2	A57 A58 V59 L63 C64 V65	A57-L61 WeakPolarHBondContact O-CB 3.24Å; A57-L61 PolarHBondContact O-N 3.48Å; A58-L61 PolarHBondContact O-N 3.36Å; V59-L61 VanDerWaalsContact C-N 3.33Å; V59-L61 PolarHBondContact O-N 2.92Å; L61-L63 PolarHBondContact O-N 3.43Å; L61-C64 WeakPolarHBondContact O-CB 3.22Å; L61-C64 PolarHBondContact O-N 3.47Å; L61-V65 HydrophobicContact CD2-CG2 4.19Å; L61-V65 WeakPolarHBondContact O-CG2 3.21Å; L61-V65 PolarHBondContact O-N 3.48Å
62	L	97.8	Very high	96	Very high	121 Å²	121	81.7 Å²	81.7	63%	0.634	49%	0.494	S	S	*	.	H	α-helix	trans	-61.5	-43.1	176.8	-73.5	174.9	0	0	0	112.1	A58 V59 C64 V65 G66	A58-L62 WeakPolarHBondContact O-CG 3.36Å; A58-L62 PolarHBondContact O-N 2.94Å; V59-L62 PolarHBondContact O-N 2.96Å; L62-C64 VanDerWaalsContact C-N 3.34Å; L62-V65 PolarHBondContact O-N 2.82Å; L62-G66 PolarHBondContact O-N 3.36Å
63	L	97.8	Very high	96.1	Very high	103 Å²	103	83.4 Å²	83.4	54%	0.539	50%	0.504	S	S	.	.	H	α-helix	trans	-63.8	-40.5	175.2	-71.2	175.6	0	0	0	111.5	V59 L60 L61 G66 T67	V59-L63 HydrophobicContact CG1-CD1 3.98Å; V59-L63 HydrophobicContact CG1-CG 4.32Å; V59-L63 WeakPolarHBondContact O-CB 3.37Å; V59-L63 VanDerWaalsContact O-CG 3.3Å; V59-L63 WeakPolarHBondContact O-CG 3.3Å; V59-L63 PolarHBondContact O-N 2.99Å; L60-L63 PolarHBondContact O-N 3.02Å; L61-L63 PolarHBondContact O-N 3.43Å; L63-G66 PolarHBondContact O-N 3.32Å; L63-T67 WeakPolarHBondContact O-CB 3.2Å; L63-T67 VanDerWaalsContact O-CG2 3.24Å; L63-T67 WeakPolarHBondContact O-CG2 3.2Å; L63-T67 PolarHBondContact O-N 3.47Å; L63-T67 PolarHBondContact O-OG1 3.43Å
64	C	97.4	Very high	96.2	Very high	83 Å²	83	88.7 Å²	88.7	56%	0.561	52%	0.517	S	S	*	.	H	α-helix	trans	-62.5	-48.8	177.4	-170	0	0	0	0	111.1	L60 L61 L62 T67 F68	L60-C64 VanDerWaalsContact O-CB 3.28Å; L60-C64 WeakPolarHBondContact O-CB 3.33Å; L60-C64 PolarHBondContact O-N 2.73Å; L61-C64 WeakPolarHBondContact O-CB 3.22Å; L61-C64 PolarHBondContact O-N 3.47Å; L62-C64 VanDerWaalsContact C-N 3.34Å; C64-T67 PolarHBondContact O-OG1 2.95Å; C64-F68 VanDerWaalsContact O-CB 3.27Å; C64-F68 WeakPolarHBondContact O-CB 3.47Å; C64-F68 PolarHBondContact O-N 3.41Å
65	V	97.4	Very high	96.1	Very high	81 Å²	81	94.1 Å²	94.1	49%	0.491	54%	0.535	S	S	.	.	H	α-helix	trans	-63.5	-46.3	176.7	175.5	0	0	0	0	110.9	L61 L62 T67 F68 T69	L61-V65 HydrophobicContact CD2-CG2 4.19Å; L61-V65 WeakPolarHBondContact O-CG2 3.21Å; L61-V65 PolarHBondContact O-N 3.48Å; L62-V65 PolarHBondContact O-N 2.82Å; V65-T67 PolarHBondContact O-N 2.88Å; V65-F68 PolarHBondContact O-N 3Å; V65-T69 PolarHBondContact O-N 3.26Å; V65-T69 PolarHBondContact O-OG1 2.87Å; V65-T69 VanDerWaalsContact O-OG1 3.07Å
66	G	97.1	Very high	95.7	Very high	40 Å²	40	97.8 Å²	97.8	41%	0.412	55%	0.546	S	S	.	.	H	α-helix	trans	-61.7	-45.1	-179.2	0	0	0	0	0	113	L62 L63 T69 A70	L62-G66 PolarHBondContact O-N 3.36Å; L63-G66 PolarHBondContact O-N 3.32Å; G66-T69 PolarHBondContact O-N 2.88Å; G66-A70 VanDerWaalsContact O-CB 3.3Å; G66-A70 WeakPolarHBondContact O-CB 3.49Å; G66-A70 PolarHBondContact O-N 3.34Å
67	T	97	Very high	95	Very high	84 Å²	84	103 Å²	103	52%	0.515	56%	0.557	S	S	.	*	H	α-helix	trans	-65.7	-43.6	176.2	52.5	0	0	0	0	111.3	L63 C64 V65 T69 A70 V71	L63-T67 WeakPolarHBondContact O-CB 3.2Å; L63-T67 VanDerWaalsContact O-CG2 3.24Å; L63-T67 WeakPolarHBondContact O-CG2 3.2Å; L63-T67 PolarHBondContact O-N 3.47Å; L63-T67 PolarHBondContact O-OG1 3.43Å; C64-T67 PolarHBondContact O-OG1 2.95Å; V65-T67 PolarHBondContact O-N 2.88Å; T67-T69 PolarHBondContact O-N 3.3Å; T67-A70 PolarHBondContact O-N 3.34Å; T67-V71 WeakPolarHBondContact O-CB 3.45Å; T67-V71 VanDerWaalsContact O-CG2 3.23Å; T67-V71 WeakPolarHBondContact O-CG2 3.4Å; T67-V71 PolarHBondContact O-N 2.94Å
68	F	96.3	Very high	93.7	Very high	139 Å²	139	109.3 Å²	109.3	61%	0.61	57%	0.573	S	S	*	*	H	α-helix	trans	-56.7	-50.5	175	177.6	-101.9	0	0	0	111.9	C64 V65 A70 V71 I72	C64-F68 VanDerWaalsContact O-CB 3.27Å; C64-F68 WeakPolarHBondContact O-CB 3.47Å; C64-F68 PolarHBondContact O-N 3.41Å; V65-F68 PolarHBondContact O-N 3Å; F68-A70 PolarHBondContact O-N 2.89Å; F68-V71 PolarHBondContact O-N 3.43Å; F68-I72 HydrophobicContact CE1-CG1 4.25Å; F68-I72 HydrophobicContact CE2-CD1 4.45Å; F68-I72 HydrophobicContact CE2-CG1 4.24Å; F68-I72 HydrophobicContact CZ-CD1 4.4Å; F68-I72 HydrophobicContact CZ-CG1 4.06Å; F68-I72 WeakPolarHBondContact O-CG1 3.3Å; F68-I72 PolarHBondContact O-N 3.5Å
69	T	95.7	Very high	92.3	Very high	80 Å²	80	112.7 Å²	112.7	49%	0.491	59%	0.591	S	S	.	*	H	α-helix	trans	-62	-43.3	177.9	-57.3	0	0	0	0	112	V65 G66 T67 V71 I72 L73	V65-T69 PolarHBondContact O-N 3.26Å; V65-T69 PolarHBondContact O-OG1 2.87Å; V65-T69 VanDerWaalsContact O-OG1 3.07Å; G66-T69 PolarHBondContact O-N 2.88Å; T67-T69 PolarHBondContact O-N 3.3Å; T69-V71 PolarHBondContact O-N 3.49Å; T69-I72 PolarHBondContact O-N 3Å; T69-L73 WeakPolarHBondContact O-CB 3.33Å; T69-L73 PolarHBondContact O-N 2.95Å
70	A	95.7	Very high	90.5	Very high	59 Å²	59	118.2 Å²	118.2	49%	0.488	61%	0.608	S	S	.	*	H	α-helix	trans	-61.2	-43.2	178.4	0	0	0	0	0	112.1	G66 T67 F68 L73 W74	G66-A70 VanDerWaalsContact O-CB 3.3Å; G66-A70 WeakPolarHBondContact O-CB 3.49Å; G66-A70 PolarHBondContact O-N 3.34Å; T67-A70 PolarHBondContact O-N 3.34Å; F68-A70 PolarHBondContact O-N 2.89Å; A70-L73 PolarHBondContact O-N 3.41Å; A70-W74 WeakPolarHBondContact O-CB 3.37Å; A70-W74 PolarHBondContact O-N 3.42Å
71	V	96.4	Very high	88.3	Confident	92 Å²	92	122 Å²	122	56%	0.558	62%	0.62	S	S	*	*	H	α-helix	trans	-62.3	-45.1	177.2	168.7	0	0	0	0	111	T67 F68 T69 W74 K75	T67-V71 WeakPolarHBondContact O-CB 3.45Å; T67-V71 VanDerWaalsContact O-CG2 3.23Å; T67-V71 WeakPolarHBondContact O-CG2 3.4Å; T67-V71 PolarHBondContact O-N 2.94Å; F68-V71 PolarHBondContact O-N 3.43Å; T69-V71 PolarHBondContact O-N 3.49Å; V71-W74 PolarHBondContact O-N 3.34Å; V71-K75 WeakPolarHBondContact O-CB 3.43Å; V71-K75 PolarHBondContact O-N 2.95Å
72	I	95.3	Very high	86.3	Confident	74 Å²	74	123 Å²	123	38%	0.379	63%	0.631	S	S	.	*	H	α-helix	trans	-64.8	-42.9	178.3	-66.7	-64.5	0	0	0	111.2	F68 T69 K75 N76	F68-I72 HydrophobicContact CE1-CG1 4.25Å; F68-I72 HydrophobicContact CE2-CD1 4.45Å; F68-I72 HydrophobicContact CE2-CG1 4.24Å; F68-I72 HydrophobicContact CZ-CD1 4.4Å; F68-I72 HydrophobicContact CZ-CG1 4.06Å; F68-I72 WeakPolarHBondContact O-CG1 3.3Å; F68-I72 PolarHBondContact O-N 3.5Å; T69-I72 PolarHBondContact O-N 3Å; I72-K75 PolarHBondContact O-N 3.15Å; I72-N76 WeakPolarHBondContact CG2-ND2 3.44Å; I72-N76 WeakPolarHBondContact O-CB 3.35Å; I72-N76 PolarHBondContact O-N 2.83Å; I72-N76 VanDerWaalsContact O-N 3.08Å; I72-N76 PolarHBondContact O-ND2 2.97Å
73	L	95.1	Very high	84	Confident	117 Å²	117	128.1 Å²	128.1	61%	0.613	66%	0.659	S	S	*	*	H	α-helix	trans	-64.4	-42.1	178	-177.2	62.4	0	0	0	111.7	T69 A70 N76 R77	T69-L73 WeakPolarHBondContact O-CB 3.33Å; T69-L73 PolarHBondContact O-N 2.95Å; A70-L73 PolarHBondContact O-N 3.41Å; L73-N76 PolarHBondContact O-N 3.41Å; L73-R77 VanDerWaalsContact O-CG 3.28Å; L73-R77 WeakPolarHBondContact O-CG 3.44Å; L73-R77 PolarHBondContact O-N 3.4Å
74	W	94.9	Very high	83.3	Confident	202 Å²	202	129.4 Å²	129.4	77%	0.765	67%	0.665	S	S	*	*	H	α-helix	trans	-60	-49	176.2	-168	-57.9	0	0	0	111	A70 V71 N76 R77	A70-W74 WeakPolarHBondContact O-CB 3.37Å; A70-W74 PolarHBondContact O-N 3.42Å; V71-W74 PolarHBondContact O-N 3.34Å; W74-N76 PolarHBondContact O-N 3.19Å; W74-R77 PolarHBondContact O-N 3.03Å
75	K	90.1	Very high	82.6	Confident	173 Å²	173	131.8 Å²	131.8	75%	0.752	67%	0.67	S	S	*	*	H	α-helix	trans	-64.9	-28.5	-177.1	-164.7	174.2	177.3	-175.5	0	112.8	V71 I72	V71-K75 WeakPolarHBondContact O-CB 3.43Å; V71-K75 PolarHBondContact O-N 2.95Å; I72-K75 PolarHBondContact O-N 3.15Å
76	N	85.6	Confident	81.8	Confident	113 Å²	113	134.6 Å²	134.6	60%	0.604	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.2	0.9	-179.9	-69.7	-37.7	0	0	0	114.3	I72 L73 W74 K78	I72-N76 WeakPolarHBondContact CG2-ND2 3.44Å; I72-N76 WeakPolarHBondContact O-CB 3.35Å; I72-N76 PolarHBondContact O-N 2.83Å; I72-N76 VanDerWaalsContact O-N 3.08Å; I72-N76 PolarHBondContact O-ND2 2.97Å; L73-N76 PolarHBondContact O-N 3.41Å; W74-N76 PolarHBondContact O-N 3.19Å; N76-K78 PolarHBondContact O-N 3.4Å; N76-K78 VanDerWaalsContact O-N 3.11Å
77	R	81.2	Confident	80.9	Confident	189 Å²	189	140.2 Å²	140.2	71%	0.713	70%	0.696	S	S	*	*			trans	-66.6	110.7	175.2	-72.9	-129.1	-119.7	-163.2	-0.7	110.5	L73 W74	L73-R77 VanDerWaalsContact O-CG 3.28Å; L73-R77 WeakPolarHBondContact O-CG 3.44Å; L73-R77 PolarHBondContact O-N 3.4Å; W74-R77 PolarHBondContact O-N 3.03Å
78	K	68.7	Low	79.9	Confident	190 Å²	190	143.7 Å²	143.7	83%	0.826	71%	0.707	S	S	*	*			trans	-74	138.2	166.4	-66.3	-165.1	180	-163.5	0	109.8	N76 K80	N76-K78 PolarHBondContact O-N 3.4Å; N76-K78 VanDerWaalsContact O-N 3.11Å; K78-K80 PolarHBondContact O-N 3.1Å
79	P	67.1	Low	78.8	Confident	124 Å²	124	144 Å²	144	81%	0.805	71%	0.714	S	S	*	*			trans	-60.1	130.5	172.2	25.2	-31.7	0	0	0	108.7	K81	P79-K81 PolarHBondContact O-N 2.66Å; P79-K81 VanDerWaalsContact O-N 3.14Å
80	K	58.9	Low	77.6	Confident	198 Å²	198	148.6 Å²	148.6	86%	0.861	73%	0.73	S	S	*	*			trans	-65.2	113.4	174.6	-165.7	173.7	-176.1	179.3	0	106.8	K78 T82	K78-K80 PolarHBondContact O-N 3.1Å; K80-T82 PolarHBondContact O-N 3.09Å; K80-T82 VanDerWaalsContact O-N 3.08Å
81	K	51.8	Low	76.2	Confident	189 Å²	189	155.5 Å²	155.5	82%	0.822	75%	0.748	S	S	*	*			trans	-61.5	110.9	166	-99.8	-174.7	172.3	-171	0	106.6	P79	P79-K81 PolarHBondContact O-N 2.66Å; P79-K81 VanDerWaalsContact O-N 3.14Å
82	T	55.3	Low	74.5	Confident	133 Å²	133	160.8 Å²	160.8	82%	0.816	76%	0.764	S	S	*	*			trans	-76.6	107.2	159.1	35	0	0	0	0	106.4	K80	K80-T82 PolarHBondContact O-N 3.09Å; K80-T82 VanDerWaalsContact O-N 3.08Å
83	D	49.8	Very low	72.6	Confident	227 Å²	227	168.6 Å²	168.6	100%	1.214	80%	0.799	S	S	*	*			trans	-66.3	0	160.2	-74.1	-60.9	0	0	0	110.4

Retrieved 83 of 83 residues in 175.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).