A0A087XKM8_POEFO Loading...

TAFA chemokine like family member 1

AlphaFold DB , UniProt , Accession A0A087XKM8, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 138 aa.

						>A0A087XKM8_POEFO|A0A087XKM8
MCPVMSWLLCLCLWVSITAIQLCQATFYDTIQQHPGTRPGRTTIHTIEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCYAGNKIKTTRVS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.9	Low	65.7	Low	222 Å²	222	121.9 Å²	121.9	100%	1.094	66%	0.657	S	S	*	*				0	76.2	0	-66.3	161.8	124.6	0	0	108.9
2	C	53.8	Low	67	Low	107 Å²	107	118.2 Å²	118.2	72%	0.723	65%	0.646	S	S	*	*			trans	-140.7	0.9	178.7	-62.4	0	0	0	0	117.1
3	P	56.7	Low	68.2	Low	91 Å²	91	117.6 Å²	117.6	59%	0.591	64%	0.641	S	S	*	*	S	Bend	trans	-88.1	-23.4	-179.4	32.5	-32.5	0	0	0	114.2
4	V	59.7	Low	69.3	Low	105 Å²	105	122.6 Å²	122.6	64%	0.636	65%	0.646	S	S	*	*	H	α-helix	trans	-76.6	-33	-174.5	-89.5	0	0	0	0	114	S6 W7 L8	V4-S6 VanDerWaalsContact C-N 3.3Å; V4-S6 PolarHBondContact O-N 3.07Å; V4-W7 PolarHBondContact O-N 3.47Å; V4-L8 PolarHBondContact O-N 2.93Å
5	M	59.6	Low	70.6	Confident	136 Å²	136	120.9 Å²	120.9	67%	0.67	64%	0.642	S	S	*	*	H	α-helix	trans	-70.5	-28.1	177.6	-71	159.7	67.4	0	0	112.3	L9	M5-L9 WeakPolarHBondContact O-CG 3.43Å; M5-L9 PolarHBondContact O-N 3.49Å
6	S	66.7	Low	71.6	Confident	76 Å²	76	117.5 Å²	117.5	53%	0.531	63%	0.631	S	S	.	*	H	α-helix	trans	-71.6	-37.3	177.4	-178.9	0	0	0	0	112.1	V4 C10	V4-S6 VanDerWaalsContact C-N 3.3Å; V4-S6 PolarHBondContact O-N 3.07Å; S6-C10 WeakPolarHBondContact O-CB 3.37Å; S6-C10 PolarHBondContact O-N 3.03Å; S6-C10 VanDerWaalsContact O-N 3.09Å
7	W	66.6	Low	72.3	Confident	198 Å²	198	116.2 Å²	116.2	75%	0.75	62%	0.623	S	S	*	*	H	α-helix	trans	-69.2	-39.7	178	-82.5	53.1	0	0	0	112.6	V4 C10 L11	V4-W7 PolarHBondContact O-N 3.47Å; W7-C10 PolarHBondContact O-N 3.39Å; W7-L11 WeakPolarHBondContact O-CG 3.37Å; W7-L11 PolarHBondContact O-N 3.5Å
8	L	74.3	Confident	72.9	Confident	111 Å²	111	113.8 Å²	113.8	58%	0.581	61%	0.613	S	S	*	*	H	α-helix	trans	-64.3	-42.1	177	-71.4	167.3	0	0	0	111.8	V4 C10 L11 C12	V4-L8 PolarHBondContact O-N 2.93Å; L8-C10 VanDerWaalsContact C-N 3.34Å; L8-C10 PolarHBondContact O-N 2.97Å; L8-L11 PolarHBondContact O-N 3.36Å; L8-C12 PolarHBondContact O-N 2.88Å; L8-C12 PolarHBondContact O-SG 3.41Å
9	L	74.1	Confident	73.5	Confident	117 Å²	117	110.5 Å²	110.5	61%	0.613	60%	0.603	S	S	*	*	H	α-helix	trans	-64.7	-38.9	175.6	-70.2	170.9	0	0	0	112	M5 C12 L13	M5-L9 WeakPolarHBondContact O-CG 3.43Å; M5-L9 PolarHBondContact O-N 3.49Å; L9-C12 PolarHBondContact O-N 3.32Å; L9-L13 WeakPolarHBondContact O-CG 3.31Å; L9-L13 PolarHBondContact O-N 2.95Å
10	C	77.8	Confident	74	Confident	72 Å²	72	110.2 Å²	110.2	49%	0.486	60%	0.599	S	S	.	*	H	α-helix	trans	-66.7	-41.4	177.9	-145.9	0	0	0	0	111.8	S6 W7 L8 L13 W14	S6-C10 WeakPolarHBondContact O-CB 3.37Å; S6-C10 PolarHBondContact O-N 3.03Å; S6-C10 VanDerWaalsContact O-N 3.09Å; W7-C10 PolarHBondContact O-N 3.39Å; L8-C10 VanDerWaalsContact C-N 3.34Å; L8-C10 PolarHBondContact O-N 2.97Å; C10-L13 PolarHBondContact O-N 3.41Å; C10-W14 WeakPolarHBondContact O-CB 3.48Å; C10-W14 PolarHBondContact O-N 3.33Å
11	L	80.1	Confident	74.1	Confident	106 Å²	106	111 Å²	111	56%	0.555	60%	0.599	S	S	*	*	H	α-helix	trans	-62.4	-44.7	173.8	-75.4	168.2	0	0	0	111.8	W7 L8 L13 W14 V15	W7-L11 WeakPolarHBondContact O-CG 3.37Å; W7-L11 PolarHBondContact O-N 3.5Å; L8-L11 PolarHBondContact O-N 3.36Å; L11-L13 PolarHBondContact O-N 2.94Å; L11-W14 PolarHBondContact O-N 3.41Å; L11-V15 VanDerWaalsContact O-CG2 3.3Å; L11-V15 WeakPolarHBondContact O-CG2 3.49Å; L11-V15 PolarHBondContact O-N 2.98Å
12	C	80.4	Confident	75.3	Confident	77 Å²	77	106.1 Å²	106.1	52%	0.52	58%	0.577	S	S	.	*	H	α-helix	trans	-60.8	-45.7	177.3	-68.9	0	0	0	0	111.9	L8 L9 W14 V15 S16	L8-C12 PolarHBondContact O-N 2.88Å; L8-C12 PolarHBondContact O-SG 3.41Å; L9-C12 PolarHBondContact O-N 3.32Å; C12-W14 PolarHBondContact O-N 2.99Å; C12-V15 PolarHBondContact O-N 3.46Å; C12-S16 PolarHBondContact O-N 3.43Å; C12-S16 PolarHBondContact O-OG 3.39Å
13	L	82.6	Confident	76.3	Confident	111 Å²	111	105.1 Å²	105.1	58%	0.581	57%	0.57	S	S	*	*	H	α-helix	trans	-63.5	-40.3	178.2	-71.1	169.2	0	0	0	112	L9 C10 L11 S16 I17	L9-L13 WeakPolarHBondContact O-CG 3.31Å; L9-L13 PolarHBondContact O-N 2.95Å; C10-L13 PolarHBondContact O-N 3.41Å; L11-L13 PolarHBondContact O-N 2.94Å; L13-S16 PolarHBondContact O-N 3.48Å; L13-I17 WeakPolarHBondContact O-CB 3.46Å; L13-I17 WeakPolarHBondContact O-CD1 3.38Å; L13-I17 WeakPolarHBondContact O-CG1 3.3Å; L13-I17 PolarHBondContact O-N 3.21Å
14	W	83.4	Confident	77.1	Confident	188 Å²	188	105.7 Å²	105.7	71%	0.712	57%	0.565	S	S	*	*	H	α-helix	trans	-62.7	-43.4	174.5	-100	48.4	0	0	0	112.7	C10 L11 C12 I17 T18	C10-W14 WeakPolarHBondContact O-CB 3.48Å; C10-W14 PolarHBondContact O-N 3.33Å; L11-W14 PolarHBondContact O-N 3.41Å; C12-W14 PolarHBondContact O-N 2.99Å; W14-I17 PolarHBondContact O-N 3.5Å; W14-T18 WeakPolarHBondContact O-CB 3.28Å; W14-T18 VanDerWaalsContact O-CG2 3.31Å; W14-T18 WeakPolarHBondContact O-CG2 3.46Å; W14-T18 PolarHBondContact O-N 3.07Å; W14-T18 PolarHBondContact O-OG1 3.46Å
15	V	88.8	Confident	77.6	Confident	96 Å²	96	103.5 Å²	103.5	58%	0.582	56%	0.558	S	S	*	*	H	α-helix	trans	-64.7	-41	177.2	173.9	0	0	0	0	111	L11 C12 T18 A19	L11-V15 VanDerWaalsContact O-CG2 3.3Å; L11-V15 WeakPolarHBondContact O-CG2 3.49Å; L11-V15 PolarHBondContact O-N 2.98Å; C12-V15 PolarHBondContact O-N 3.46Å; V15-T18 WeakPolarHBondContact CA-OG1 3.48Å; V15-T18 PolarHBondContact O-OG1 3.4Å; V15-A19 WeakPolarHBondContact O-CB 3.42Å; V15-A19 PolarHBondContact O-N 2.94Å
16	S	86.6	Confident	77.9	Confident	67 Å²	67	101 Å²	101	47%	0.469	55%	0.55	S	S	.	*	H	α-helix	trans	-64.5	-43.5	176.3	-56.9	0	0	0	0	112.4	C12 L13 A19 I20	C12-S16 PolarHBondContact O-N 3.43Å; C12-S16 PolarHBondContact O-OG 3.39Å; L13-S16 PolarHBondContact O-N 3.48Å; S16-A19 PolarHBondContact O-N 3.48Å; S16-I20 WeakPolarHBondContact O-CD1 3.47Å; S16-I20 VanDerWaalsContact O-CG1 3.27Å; S16-I20 WeakPolarHBondContact O-CG1 3.47Å; S16-I20 PolarHBondContact O-N 3.32Å
17	I	84.9	Confident	77.8	Confident	96 Å²	96	103.8 Å²	103.8	49%	0.492	55%	0.553	S	S	.	*	H	α-helix	trans	-66	-43.1	179.8	-69.5	166.5	0	0	0	111	L13 W14 A19 I20 Q21	L13-I17 WeakPolarHBondContact O-CB 3.46Å; L13-I17 WeakPolarHBondContact O-CD1 3.38Å; L13-I17 WeakPolarHBondContact O-CG1 3.3Å; L13-I17 PolarHBondContact O-N 3.21Å; W14-I17 PolarHBondContact O-N 3.5Å; I17-A19 PolarHBondContact O-N 3.31Å; I17-I20 PolarHBondContact O-N 3.24Å; I17-Q21 WeakPolarHBondContact O-CG 3.22Å; I17-Q21 PolarHBondContact O-N 3.2Å
18	T	82.5	Confident	77.6	Confident	72 Å²	72	101.7 Å²	101.7	44%	0.442	55%	0.546	S	S	.	.	H	α-helix	trans	-64.4	-39.2	177.5	50.1	0	0	0	0	111.9	W14 V15 Q21 L22	W14-T18 WeakPolarHBondContact O-CB 3.28Å; W14-T18 VanDerWaalsContact O-CG2 3.31Å; W14-T18 WeakPolarHBondContact O-CG2 3.46Å; W14-T18 PolarHBondContact O-N 3.07Å; W14-T18 PolarHBondContact O-OG1 3.46Å; V15-T18 WeakPolarHBondContact CA-OG1 3.48Å; V15-T18 PolarHBondContact O-OG1 3.4Å; T18-Q21 PolarHBondContact O-N 3.37Å; T18-L22 WeakPolarHBondContact O-CB 3.38Å; T18-L22 WeakPolarHBondContact O-CG 3.18Å; T18-L22 PolarHBondContact O-N 3.46Å
19	A	83.8	Confident	76.8	Confident	52 Å²	52	101.6 Å²	101.6	43%	0.43	55%	0.546	S	S	.	.	H	α-helix	trans	-62.9	-41.5	173.9	0	0	0	0	0	112.6	V15 S16 I17 L22 C23	V15-A19 WeakPolarHBondContact O-CB 3.42Å; V15-A19 PolarHBondContact O-N 2.94Å; S16-A19 PolarHBondContact O-N 3.48Å; I17-A19 PolarHBondContact O-N 3.31Å; A19-L22 PolarHBondContact O-N 3Å; A19-C23 PolarHBondContact O-N 3.09Å
20	I	83	Confident	76	Confident	103 Å²	103	100.6 Å²	100.6	53%	0.528	55%	0.545	S	S	.	.	H	α-helix	trans	-65.6	-42.2	177.2	-67	164.1	0	0	0	110.9	S16 I17 C23 Q24	S16-I20 WeakPolarHBondContact O-CD1 3.47Å; S16-I20 VanDerWaalsContact O-CG1 3.27Å; S16-I20 WeakPolarHBondContact O-CG1 3.47Å; S16-I20 PolarHBondContact O-N 3.32Å; I17-I20 PolarHBondContact O-N 3.24Å; I20-C23 PolarHBondContact O-N 3.42Å; I20-Q24 HydrophobicContact CG2-CG 4.37Å; I20-Q24 WeakPolarHBondContact O-CG 3.44Å; I20-Q24 PolarHBondContact O-N 2.95Å
21	Q	77.9	Confident	75	Confident	129 Å²	129	102.4 Å²	102.4	60%	0.603	55%	0.549	S	S	*	.	H	α-helix	trans	-64.4	-40	177	-73.4	-70.5	-18.4	0	0	112.2	I17 T18 Q24 A25	I17-Q21 WeakPolarHBondContact O-CG 3.22Å; I17-Q21 PolarHBondContact O-N 3.2Å; T18-Q21 PolarHBondContact O-N 3.37Å; Q21-Q24 PolarHBondContact O-N 2.98Å; Q21-A25 WeakPolarHBondContact O-CB 3.38Å; Q21-A25 PolarHBondContact O-N 3.32Å
22	L	78.3	Confident	73.5	Confident	119 Å²	119	104.6 Å²	104.6	62%	0.623	56%	0.556	S	S	*	*	H	α-helix	trans	-64.1	-43.3	174.1	-77.7	160.1	0	0	0	111.8	T18 A19 Q24 A25 T26	T18-L22 WeakPolarHBondContact O-CB 3.38Å; T18-L22 WeakPolarHBondContact O-CG 3.18Å; T18-L22 PolarHBondContact O-N 3.46Å; A19-L22 PolarHBondContact O-N 3Å; L22-Q24 PolarHBondContact O-N 3.47Å; L22-A25 PolarHBondContact O-N 3.48Å; L22-T26 WeakPolarHBondContact O-CG2 3.49Å; L22-T26 PolarHBondContact O-N 3.43Å; L22-T26 PolarHBondContact O-OG1 3.02Å
23	C	74.1	Confident	71.9	Confident	86 Å²	86	107.9 Å²	107.9	58%	0.581	56%	0.564	S	S	*	*	H	α-helix	trans	-60.2	-45.7	174	-96.4	0	0	0	0	112.1	A19 I20 A25 T26 F27	A19-C23 PolarHBondContact O-N 3.09Å; I20-C23 PolarHBondContact O-N 3.42Å; C23-A25 VanDerWaalsContact C-N 3.34Å; C23-A25 PolarHBondContact O-N 3.4Å; C23-T26 WeakPolarHBondContact CA-OG1 3.37Å; C23-T26 PolarHBondContact O-N 3.4Å; C23-T26 PolarHBondContact O-OG1 3.29Å; C23-F27 WeakPolarHBondContact O-CB 3.5Å; C23-F27 PolarHBondContact O-N 3.37Å
24	Q	74.4	Confident	70.4	Confident	102 Å²	102	111.5 Å²	111.5	48%	0.477	58%	0.578	S	S	.	*	H	α-helix	trans	-60.2	-45	177.2	-68.2	-106.2	-18.3	0	0	110.9	I20 Q21 L22 T26 F27 Y28	I20-Q24 HydrophobicContact CG2-CG 4.37Å; I20-Q24 WeakPolarHBondContact O-CG 3.44Å; I20-Q24 PolarHBondContact O-N 2.95Å; Q21-Q24 PolarHBondContact O-N 2.98Å; L22-Q24 PolarHBondContact O-N 3.47Å; Q24-T26 PolarHBondContact O-N 2.98Å; Q24-F27 PolarHBondContact O-N 2.97Å; Q24-Y28 VanDerWaalsContact O-CD2 3.28Å; Q24-Y28 WeakPolarHBondContact O-CD2 3.33Å; Q24-Y28 PolarHBondContact O-N 2.76Å
25	A	69.7	Low	68.5	Low	59 Å²	59	107.2 Å²	107.2	49%	0.488	57%	0.574	S	S	.	*	H	α-helix	trans	-61	-44.2	177.1	0	0	0	0	0	112.5	Q21 L22 C23 F27 Y28 D29	Q21-A25 WeakPolarHBondContact O-CB 3.38Å; Q21-A25 PolarHBondContact O-N 3.32Å; L22-A25 PolarHBondContact O-N 3.48Å; C23-A25 VanDerWaalsContact C-N 3.34Å; C23-A25 PolarHBondContact O-N 3.4Å; A25-F27 VanDerWaalsContact C-N 3.31Å; A25-F27 PolarHBondContact O-N 2.97Å; A25-Y28 PolarHBondContact O-N 2.83Å; A25-D29 WeakPolarHBondContact O-CB 3.36Å; A25-D29 PolarHBondContact O-N 3.29Å
26	T	66.8	Low	66.6	Low	84 Å²	84	106.5 Å²	106.5	52%	0.515	59%	0.586	S	S	.	*	H	α-helix	trans	-63.5	-35.7	175.5	56.4	0	0	0	0	112.9	L22 C23 Q24 T30	L22-T26 WeakPolarHBondContact O-CG2 3.49Å; L22-T26 PolarHBondContact O-N 3.43Å; L22-T26 PolarHBondContact O-OG1 3.02Å; C23-T26 WeakPolarHBondContact CA-OG1 3.37Å; C23-T26 PolarHBondContact O-N 3.4Å; C23-T26 PolarHBondContact O-OG1 3.29Å; Q24-T26 PolarHBondContact O-N 2.98Å; T26-T30 PolarHBondContact O-N 3.04Å; T26-T30 PolarHBondContact O-OG1 3.35Å
27	F	64.1	Low	64.3	Low	134 Å²	134	109.9 Å²	109.9	59%	0.588	60%	0.604	S	S	*	*	H	α-helix	trans	-71	-42.4	179	-170.5	-98.5	0	0	0	111.6	C23 Q24 A25 D29 T30 I31	C23-F27 WeakPolarHBondContact O-CB 3.5Å; C23-F27 PolarHBondContact O-N 3.37Å; Q24-F27 PolarHBondContact O-N 2.97Å; A25-F27 VanDerWaalsContact C-N 3.31Å; A25-F27 PolarHBondContact O-N 2.97Å; F27-D29 VanDerWaalsContact C-N 3.35Å; F27-D29 PolarHBondContact O-N 3.45Å; F27-T30 PolarHBondContact O-N 3Å; F27-I31 HydrophobicContact CD1-CG1 4.23Å; F27-I31 HydrophobicContact CE1-CD1 4.25Å; F27-I31 HydrophobicContact CE1-CG1 3.94Å; F27-I31 HydrophobicContact CZ-CD1 4.26Å; F27-I31 HydrophobicContact CZ-CG1 4.34Å; F27-I31 WeakPolarHBondContact O-CG1 3.49Å; F27-I31 PolarHBondContact O-N 2.99Å
28	Y	61.6	Low	62.4	Low	155 Å²	155	117 Å²	117	61%	0.608	62%	0.624	S	S	*	*	H	α-helix	trans	-63.2	-39.6	174.1	-87.1	-73.6	0	0	0	112.3	Q24 A25 T30 I31 Q32	Q24-Y28 VanDerWaalsContact O-CD2 3.28Å; Q24-Y28 WeakPolarHBondContact O-CD2 3.33Å; Q24-Y28 PolarHBondContact O-N 2.76Å; A25-Y28 PolarHBondContact O-N 2.83Å; Y28-T30 VanDerWaalsContact C-N 3.3Å; Y28-T30 PolarHBondContact O-N 2.94Å; Y28-I31 PolarHBondContact O-N 2.73Å; Y28-Q32 PolarHBondContact O-N 3.26Å
29	D	57.2	Low	60.4	Low	109 Å²	109	119.5 Å²	119.5	58%	0.583	64%	0.642	S	S	*	*	H	α-helix	trans	-66.3	-33.3	176.5	-154.9	26.6	0	0	0	111.8	A25 F27	A25-D29 WeakPolarHBondContact O-CB 3.36Å; A25-D29 PolarHBondContact O-N 3.29Å; F27-D29 VanDerWaalsContact C-N 3.35Å; F27-D29 PolarHBondContact O-N 3.45Å
30	T	57.3	Low	58.5	Low	96 Å²	96	120.9 Å²	120.9	59%	0.589	66%	0.661	S	S	*	*	H	α-helix	trans	-69.3	-36	174	-49.7	0	0	0	0	112.2	T26 F27 Y28	T26-T30 PolarHBondContact O-N 3.04Å; T26-T30 PolarHBondContact O-OG1 3.35Å; F27-T30 PolarHBondContact O-N 3Å; Y28-T30 VanDerWaalsContact C-N 3.3Å; Y28-T30 PolarHBondContact O-N 2.94Å
31	I	57.3	Low	56.5	Low	109 Å²	109	127 Å²	127	56%	0.559	68%	0.678	S	S	*	*	H	α-helix	trans	-75.1	-30	179.2	-65.7	-77.3	0	0	0	111.7	F27 Y28 Q33	F27-I31 HydrophobicContact CD1-CG1 4.23Å; F27-I31 HydrophobicContact CE1-CD1 4.25Å; F27-I31 HydrophobicContact CE1-CG1 3.94Å; F27-I31 HydrophobicContact CZ-CD1 4.26Å; F27-I31 HydrophobicContact CZ-CG1 4.34Å; F27-I31 WeakPolarHBondContact O-CG1 3.49Å; F27-I31 PolarHBondContact O-N 2.99Å; Y28-I31 PolarHBondContact O-N 2.73Å; I31-Q33 VanDerWaalsContact C-N 3.34Å; I31-Q33 PolarHBondContact O-N 2.77Å
32	Q	48.2	Very low	54.6	Low	153 Å²	153	126.9 Å²	126.9	72%	0.715	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	-2.3	179.5	-74.9	-154.6	-33.9	0	0	115	Y28 H34 P35	Y28-Q32 PolarHBondContact O-N 3.26Å; Q32-H34 PolarHBondContact O-N 3.06Å; Q32-H34 VanDerWaalsContact O-N 3.07Å; Q32-P35 WeakPolarHBondContact O-CD 3.27Å
33	Q	46.8	Very low	52.7	Low	145 Å²	145	127 Å²	127	68%	0.678	69%	0.692	S	S	*	*			trans	-76.1	19	177.3	-82.4	-175.6	-12.9	0	0	115.8	I31	I31-Q33 VanDerWaalsContact C-N 3.34Å; I31-Q33 PolarHBondContact O-N 2.77Å
34	H	52	Low	51.2	Low	188 Å²	188	128.9 Å²	128.9	87%	0.87	70%	0.695	S	S	*	*			trans	-100.7	76.1	159.2	-73.8	-51	0	0	0	112.5	Q32	Q32-H34 PolarHBondContact O-N 3.06Å; Q32-H34 VanDerWaalsContact O-N 3.07Å
35	P	43.6	Very low	49.7	Very low	98 Å²	98	130.3 Å²	130.3	64%	0.636	70%	0.701	S	S	*	*	S	Bend	trans	-126.5	128	142.3	14.9	7.3	0	0	0	109.7	Q32	Q32-P35 WeakPolarHBondContact O-CD 3.27Å
36	G	49	Very low	48.4	Very low	80 Å²	80	132.7 Å²	132.7	83%	0.825	71%	0.71	S	S	*	*			trans	-53.6	142.9	-174.5	0	0	0	0	0	114.9
37	T	38.8	Very low	47.6	Very low	138 Å²	138	132.3 Å²	132.3	85%	0.847	70%	0.704	S	S	*	*			trans	-156.8	128.8	151.6	4.6	0	0	0	0	109.8
38	R	43.7	Very low	47.7	Very low	246 Å²	246	134.7 Å²	134.7	93%	0.928	72%	0.717	S	S	*	*			trans	-61	145.9	172.4	-68.6	174.5	176.8	-177.2	-0.8	110.6
39	P	41.3	Very low	48.3	Very low	124 Å²	124	127.5 Å²	127.5	81%	0.805	69%	0.69	S	S	*	*				-131.8	129.7	125.1	20.3	-1.5	0	0	0	111	R41	P39-R41 PolarHBondContact O-N 3.02Å
40	G	42.6	Very low	49.7	Very low	82 Å²	82	123.1 Å²	123.1	85%	0.845	67%	0.671	S	S	*	*			trans	-71.9	119.8	176.7	0	0	0	0	0	111.8
41	R	41.2	Very low	51.3	Low	231 Å²	231	122.5 Å²	122.5	87%	0.872	67%	0.667	S	S	*	*	S	Bend	trans	-172.6	111.9	142.6	-155.3	152.3	-178.9	144.5	-1.7	108.3	P39	P39-R41 PolarHBondContact O-N 3.02Å
42	T	39.3	Very low	53	Low	126 Å²	126	119 Å²	119	77%	0.773	65%	0.652	S	S	*	*			trans	47.5	81.9	172.2	24.2	0	0	0	0	114.3	I44	T42-I44 PolarHBondContact O-N 3.38Å
43	T	38	Very low	55.1	Low	122 Å²	122	118.2 Å²	118.2	75%	0.748	65%	0.648	S	S	*	*			trans	-63.6	85.6	157.8	50.1	0	0	0	0	108.5	H45	T43-H45 PolarHBondContact O-N 3.48Å
44	I	43	Very low	57.2	Low	125 Å²	125	113.9 Å²	113.9	64%	0.641	63%	0.631	S	S	*	*			trans	-67.2	88.1	145.4	-60	-179.4	0	0	0	103.1	T42 T46	T42-I44 PolarHBondContact O-N 3.38Å; I44-T46 PolarHBondContact O-N 2.84Å
45	H	42.9	Very low	59.3	Low	133 Å²	133	109.7 Å²	109.7	62%	0.616	61%	0.614	S	S	*	*			trans	-64.1	91.4	157.2	-93.9	-96.2	0	0	0	104.4	T43 I47	T43-H45 PolarHBondContact O-N 3.48Å; H45-I47 HydrophobicContact CB-CG1 4.09Å; H45-I47 PolarHBondContact O-N 3.08Å
46	T	42.1	Very low	61.6	Low	109 Å²	109	106.5 Å²	106.5	67%	0.669	60%	0.597	S	S	*	*			trans	-67	76.8	160.4	-23.2	0	0	0	0	105.2	I44 E48	I44-T46 PolarHBondContact O-N 2.84Å; T46-E48 PolarHBondContact O-N 3.12Å
47	I	49.3	Very low	63.6	Low	76 Å²	76	105.8 Å²	105.8	39%	0.39	58%	0.582	S	S	.	*			trans	-66.4	112.9	160.6	-54.5	178.9	0	0	0	102.6	H45 G49	H45-I47 HydrophobicContact CB-CG1 4.09Å; H45-I47 PolarHBondContact O-N 3.08Å; I47-G49 PolarHBondContact O-N 3.03Å
48	E	65.8	Low	66	Low	183 Å²	183	105.1 Å²	105.1	86%	0.855	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	-41.4	100.4	-179.3	-63	-172.7	145.3	0	0	110.7	T46	T46-E48 PolarHBondContact O-N 3.12Å
49	G	74.8	Confident	68.2	Low	4 Å²	4	101.8 Å²	101.8	4%	0.041	56%	0.557	C	S	.	*	T	Hydrogen-bonded Turn	trans	151.4	-14.8	-174	0	0	0	0	0	117.4	I47 C77 L78 C92	I47-G49 PolarHBondContact O-N 3.03Å; G49-C77 CarbonylContact O-C 3.55Å; G49-C77 WeakPolarHBondContact O-CA 3.42Å; G49-L78 PolarHBondContact O-N 2.95Å; G49-C92 WeakPolarHBondContact O-CB 3.47Å
50	G	86.4	Confident	70.3	Confident	18 Å²	18	99 Å²	99	19%	0.186	54%	0.54	C	S	.	.	E	Extended strand (participates in β ladder)	trans	145.7	-165.3	174.2	0	0	0	0	0	114.8	S76	G50-S76 CarbonylContact C-O 3.57Å; G50-S76 WeakPolarHBondContact CA-O 3.45Å
51	T	91.1	Very high	72.4	Confident	82 Å²	82	99.8 Å²	99.8	50%	0.503	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	136.2	179.1	58.3	0	0	0	0	111.3	C75 S76	T51-C75 CarbonylContact O-C 3.57Å; T51-C75 VanDerWaalsContact O-CA 3.26Å; T51-C75 WeakPolarHBondContact O-CA 3.45Å; T51-S76 PolarHBondContact N-O 2.79Å; T51-S76 PolarHBondContact O-N 2.79Å
52	C	92.6	Very high	74.4	Confident	36 Å²	36	93 Å²	93	24%	0.243	51%	0.512	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	136.8	172.4	-70.4	0	0	0	0	111.1	V73 K74 C75 P90	C52-V73 HydrophobicContact CB-CG1 4.28Å; C52-K74 CarbonylContact C-O 3.58Å; C52-K74 WeakPolarHBondContact CA-O 3.47Å; C52-C75 HydrophobicContact CB-CB 4.19Å; C52-C75 WeakPolarHBondContact CB-SG 3.46Å; C52-C75 WeakPolarHBondContact SG-CB 3.39Å; C52-C75 CovalentContact SG-SG 2.05Å; C52-C75 PolarHBondContact SG-SG 2.89Å; C52-P90 HydrophobicContact CB-CB 3.93Å; C52-P90 HydrophobicContact CB-CG 4.32Å
53	E	92.4	Very high	76.4	Confident	136 Å²	136	96.7 Å²	96.7	64%	0.636	52%	0.518	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.6	135.6	-179.7	-174.9	177.1	-166.8	0	0	110.6	I55 V73 K74	E53-I55 PolarHBondContact O-N 2.79Å; E53-V73 CarbonylContact O-C 3.54Å; E53-V73 WeakPolarHBondContact O-CA 3.4Å; E53-K74 PolarHBondContact N-O 3.04Å; E53-K74 PolarHBondContact O-N 2.65Å
54	V	91.9	Very high	78.7	Confident	54 Å²	54	96.9 Å²	96.9	33%	0.327	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	108.6	171.1	-178.6	0	0	0	0	108	A56 A57 Q71 T72 V73 P90	V54-A56 WeakPolarHBondContact CG1-O 3.36Å; V54-A57 HydrophobicContact CG1-CB 4.29Å; V54-Q71 HydrophobicContact CG1-CB 4.18Å; V54-Q71 HydrophobicContact CG1-CG 4.34Å; V54-T72 CarbonylContact C-O 3.52Å; V54-V73 HydrophobicContact CG2-CG2 4.25Å; V54-P90 HydrophobicContact CG2-CG 3.84Å
55	I	94.8	Very high	80.4	Confident	100 Å²	100	102.2 Å²	102.2	51%	0.513	53%	0.526	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	-21.3	-176.7	60.7	168.4	0	0	0	113.1	E53 T72 K74	E53-I55 PolarHBondContact O-N 2.79Å; I55-T72 HydrophobicContact CD1-CG2 3.79Å; I55-T72 HydrophobicContact CG1-CG2 3.79Å; I55-T72 WeakPolarHBondContact CG1-O 3.26Å; I55-T72 PolarHBondContact N-O 2.87Å; I55-K74 HydrophobicContact CD1-CB 4.36Å; I55-K74 HydrophobicContact CG2-CB 3.75Å
56	A	91.9	Very high	82.2	Confident	32 Å²	32	100.6 Å²	100.6	26%	0.264	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.4	147.4	172.4	0	0	0	0	0	110.1	V54 Q71 T72	V54-A56 WeakPolarHBondContact CG1-O 3.36Å; A56-Q71 CarbonylContact O-C 3.55Å; A56-Q71 WeakPolarHBondContact O-CA 3.21Å; A56-T72 PolarHBondContact N-O 2.97Å; A56-T72 PolarHBondContact O-N 2.84Å
57	A	90.8	Very high	84.2	Confident	64 Å²	64	100.4 Å²	100.4	53%	0.529	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.2	128.3	175	0	0	0	0	0	109.9	V54 S70 Q71	V54-A57 HydrophobicContact CG1-CB 4.29Å; A57-S70 CarbonylContact C-O 3.53Å; A57-S70 WeakPolarHBondContact CA-O 3.03Å; A57-Q71 HydrophobicContact CB-CG 4.23Å
58	H	90.4	Very high	85.8	Confident	125 Å²	125	102.2 Å²	102.2	58%	0.579	52%	0.519	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.8	139.5	174.6	-66.9	-77	0	0	0	109.4	S70	H58-S70 PolarHBondContact N-O 2.94Å; H58-S70 PolarHBondContact O-N 2.84Å; H58-S70 VanDerWaalsContact O-O 3.14Å
59	R	89.3	Confident	86.6	Confident	176 Å²	176	100.7 Å²	100.7	66%	0.664	51%	0.506	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.6	117.2	175.6	-170.4	-179.9	-173.7	-174.2	0.2	107.3	E67 E68	R59-E67 HydrophobicContact CG-CG 4.25Å; R59-E67 IonicContact CZ-OE1 2.65Å; R59-E67 IonicContact CZ-OE2 3.71Å; R59-E67 IonicContact NE-OE1 3.94Å; R59-E67 PolarHBondContact NE-OE1 2.88Å; R59-E67 IonicContact NE-OE2 3.03Å; R59-E67 IonicContact NH2-OE1 2.83Å; R59-E67 PolarHBondContact NH2-OE1 3.27Å; R59-E67 IonicContact NH2-OE2 2.76Å; R59-E67 PolarHBondContact NH2-OE2 3.02Å; R59-E68 WeakPolarHBondContact CA-O 3.01Å
60	C	86.4	Confident	87.1	Confident	66 Å²	66	103.1 Å²	103.1	45%	0.446	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	155.2	179.4	-68.3	0	0	0	0	109.1	E68	C60-E68 HydrophobicContact CB-CB 4.41Å; C60-E68 PolarHBondContact N-O 3.19Å; C60-E68 PolarHBondContact O-N 2.83Å
61	C	86.4	Confident	87.2	Confident	98 Å²	98	105.8 Å²	105.8	66%	0.662	53%	0.529	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.1	125.4	171.3	-66.1	0	0	0	0	108.1	I66	C61-I66 WeakPolarHBondContact CA-O 3.47Å
62	N	83.4	Confident	87.1	Confident	88 Å²	88	105.5 Å²	105.5	47%	0.471	53%	0.528	S	S	.	.			trans	-77.3	161.4	172.3	-169.2	-4.1	0	0	0	110.3	N64 R65 I66	N62-N64 PolarHBondContact O-N 3.46Å; N62-R65 WeakPolarHBondContact O-CA 3.39Å; N62-R65 PolarHBondContact O-N 3.17Å; N62-I66 HydrophobicContact CB-CB 4.41Å; N62-I66 PolarHBondContact N-O 2.96Å
63	K	81.4	Confident	87	Confident	204 Å²	204	106.6 Å²	106.6	89%	0.887	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.2	-28.7	176.1	-69.6	-177.1	179.3	178.1	0	113.4	R65	K63-R65 PolarHBondContact O-N 2.93Å
64	N	85.5	Confident	87.1	Confident	125 Å²	125	106.5 Å²	106.5	67%	0.668	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.5	12.2	176.1	-64.4	-15	0	0	0	114	N62 I66	N62-N64 PolarHBondContact O-N 3.46Å; N64-I66 HydrophobicContact CB-CD1 3.99Å; N64-I66 HydrophobicContact CB-CG1 4.01Å; N64-I66 PolarHBondContact O-N 2.68Å; N64-I66 VanDerWaalsContact O-N 3.17Å
65	R	79.7	Confident	87.2	Confident	237 Å²	237	105.7 Å²	105.7	89%	0.894	53%	0.527	S	S	*	.			trans	55.4	26.3	-172.4	-56.2	-176.8	-177.9	153.5	0.4	113.7	N62 K63 E67	N62-R65 WeakPolarHBondContact O-CA 3.39Å; N62-R65 PolarHBondContact O-N 3.17Å; K63-R65 PolarHBondContact O-N 2.93Å; R65-E67 PolarHBondContact O-N 2.99Å
66	I	79.4	Confident	87.2	Confident	100 Å²	100	104.3 Å²	104.3	51%	0.513	53%	0.526	S	S	.	.			trans	-79.7	118.8	170.6	-59.1	171.4	0	0	0	106.6	C61 N62 N64	C61-I66 WeakPolarHBondContact CA-O 3.47Å; N62-I66 HydrophobicContact CB-CB 4.41Å; N62-I66 PolarHBondContact N-O 2.96Å; N64-I66 HydrophobicContact CB-CD1 3.99Å; N64-I66 HydrophobicContact CB-CG1 4.01Å; N64-I66 PolarHBondContact O-N 2.68Å; N64-I66 VanDerWaalsContact O-N 3.17Å
67	E	83.5	Confident	87.3	Confident	104 Å²	104	104.8 Å²	104.8	49%	0.486	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	119.5	173.1	-174.5	-175.7	152.8	0	0	109.3	R59 R65	R59-E67 HydrophobicContact CG-CG 4.25Å; R59-E67 IonicContact CZ-OE1 2.65Å; R59-E67 IonicContact CZ-OE2 3.71Å; R59-E67 IonicContact NE-OE1 3.94Å; R59-E67 PolarHBondContact NE-OE1 2.88Å; R59-E67 IonicContact NE-OE2 3.03Å; R59-E67 IonicContact NH2-OE1 2.83Å; R59-E67 PolarHBondContact NH2-OE1 3.27Å; R59-E67 IonicContact NH2-OE2 2.76Å; R59-E67 PolarHBondContact NH2-OE2 3.02Å; R65-E67 PolarHBondContact O-N 2.99Å
68	E	83.8	Confident	87.4	Confident	115 Å²	115	106.7 Å²	106.7	54%	0.537	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	125.3	175.9	-172.8	173.1	-178.1	0	0	109.2	R59 C60	R59-E68 WeakPolarHBondContact CA-O 3.01Å; C60-E68 HydrophobicContact CB-CB 4.41Å; C60-E68 PolarHBondContact N-O 3.19Å; C60-E68 PolarHBondContact O-N 2.83Å
69	R	82.8	Confident	87.6	Confident	150 Å²	150	107 Å²	107	57%	0.566	54%	0.541	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.5	108.2	179.3	-171.2	-176.3	-168.7	-164.9	4.7	108.8	Q71	R69-Q71 HydrophobicContact CG-CG 4.39Å
70	S	85.4	Confident	87.7	Confident	55 Å²	55	101.1 Å²	101.1	39%	0.385	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	130.8	175.3	-45.5	0	0	0	0	108.8	A57 H58	A57-S70 CarbonylContact C-O 3.53Å; A57-S70 WeakPolarHBondContact CA-O 3.03Å; H58-S70 PolarHBondContact N-O 2.94Å; H58-S70 PolarHBondContact O-N 2.84Å; H58-S70 VanDerWaalsContact O-O 3.14Å
71	Q	88.2	Confident	88	Confident	74 Å²	74	101.1 Å²	101.1	35%	0.346	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	134.4	175	-65.1	-172.3	-46.5	0	0	108.8	V54 A56 A57 R69 V73	V54-Q71 HydrophobicContact CG1-CB 4.18Å; V54-Q71 HydrophobicContact CG1-CG 4.34Å; A56-Q71 CarbonylContact O-C 3.55Å; A56-Q71 WeakPolarHBondContact O-CA 3.21Å; A57-Q71 HydrophobicContact CB-CG 4.23Å; R69-Q71 HydrophobicContact CG-CG 4.39Å; Q71-V73 HydrophobicContact CB-CG2 4.44Å
72	T	89.6	Confident	88.3	Confident	77 Å²	77	99 Å²	99	47%	0.472	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	125.5	167.7	-49.7	0	0	0	0	107.5	V54 I55 A56	V54-T72 CarbonylContact C-O 3.52Å; I55-T72 HydrophobicContact CD1-CG2 3.79Å; I55-T72 HydrophobicContact CG1-CG2 3.79Å; I55-T72 WeakPolarHBondContact CG1-O 3.26Å; I55-T72 PolarHBondContact N-O 2.87Å; A56-T72 PolarHBondContact N-O 2.97Å; A56-T72 PolarHBondContact O-N 2.84Å
73	V	91.1	Very high	88.8	Confident	58 Å²	58	97.8 Å²	97.8	35%	0.352	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	134.6	-174.1	179.3	0	0	0	0	108.9	C52 E53 V54 Q71 P90	C52-V73 HydrophobicContact CB-CG1 4.28Å; E53-V73 CarbonylContact O-C 3.54Å; E53-V73 WeakPolarHBondContact O-CA 3.4Å; V54-V73 HydrophobicContact CG2-CG2 4.25Å; Q71-V73 HydrophobicContact CB-CG2 4.44Å; V73-P90 HydrophobicContact CB-CB 4.32Å; V73-P90 HydrophobicContact CG1-CB 3.39Å; V73-P90 HydrophobicContact CG1-CG 3.91Å; V73-P90 HydrophobicContact CG2-CB 4Å; V73-P90 HydrophobicContact CG2-CG 4.21Å
74	K	93.6	Very high	89.3	Confident	134 Å²	134	89.2 Å²	89.2	58%	0.583	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.8	123	169	-176.7	175.6	179.5	-179.5	0	108.8	C52 E53 I55	C52-K74 CarbonylContact C-O 3.58Å; C52-K74 WeakPolarHBondContact CA-O 3.47Å; E53-K74 PolarHBondContact N-O 3.04Å; E53-K74 PolarHBondContact O-N 2.65Å; I55-K74 HydrophobicContact CD1-CB 4.36Å; I55-K74 HydrophobicContact CG2-CB 3.75Å
75	C	93.7	Very high	89.6	Confident	37 Å²	37	84.2 Å²	84.2	25%	0.25	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	147.3	176	-68.8	0	0	0	0	111.3	T51 C52 A83	T51-C75 CarbonylContact O-C 3.57Å; T51-C75 VanDerWaalsContact O-CA 3.26Å; T51-C75 WeakPolarHBondContact O-CA 3.45Å; C52-C75 HydrophobicContact CB-CB 4.19Å; C52-C75 WeakPolarHBondContact CB-SG 3.46Å; C52-C75 WeakPolarHBondContact SG-CB 3.39Å; C52-C75 CovalentContact SG-SG 2.05Å; C52-C75 PolarHBondContact SG-SG 2.89Å; C75-A83 HydrophobicContact CB-CB 3.99Å
76	S	94.6	Very high	90.3	Very high	71 Å²	71	74.3 Å²	74.3	50%	0.497	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	93.2	169.1	-60.7	0	0	0	0	107.1	G50 T51	G50-S76 CarbonylContact C-O 3.57Å; G50-S76 WeakPolarHBondContact CA-O 3.45Å; T51-S76 PolarHBondContact N-O 2.79Å; T51-S76 PolarHBondContact O-N 2.79Å
77	C	94.4	Very high	90.9	Very high	42 Å²	42	76.1 Å²	76.1	28%	0.284	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	147.4	-176.7	-58.3	0	0	0	0	111.6	G49 K81 V82 C92	G49-C77 CarbonylContact O-C 3.55Å; G49-C77 WeakPolarHBondContact O-CA 3.42Å; C77-K81 HydrophobicContact CB-CB 4.02Å; C77-V82 VanDerWaalsContact SG-C 3.57Å; C77-C92 WeakPolarHBondContact CA-SG 3.23Å; C77-C92 HydrophobicContact CB-CB 3.81Å; C77-C92 WeakPolarHBondContact CB-SG 3.34Å; C77-C92 WeakPolarHBondContact SG-CB 3.29Å; C77-C92 CovalentContact SG-SG 2.05Å; C77-C92 PolarHBondContact SG-SG 3.39Å
78	L	93.4	Very high	91.2	Very high	104 Å²	104	74.6 Å²	74.6	55%	0.545	42%	0.419	S	S	.	.	P	Polyproline II helix	trans	-70.4	160.9	173.8	-66	177.1	0	0	0	111	G49 G80 K81	G49-L78 PolarHBondContact O-N 2.95Å; L78-G80 PolarHBondContact O-N 3.5Å; L78-K81 WeakPolarHBondContact O-CB 3.27Å; L78-K81 PolarHBondContact O-N 2.88Å
79	P	93.9	Very high	91.5	Very high	131 Å²	131	77.1 Å²	77.1	85%	0.851	42%	0.423	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.5	135.2	176.4	-27.2	35.7	0	0	0	112.7	K81	P79-K81 VanDerWaalsContact C-N 3.28Å
80	G	90.9	Very high	92	Very high	53 Å²	53	71.6 Å²	71.6	55%	0.546	41%	0.407	S	S	.	.	T	Hydrogen-bonded Turn	trans	84.2	-5.5	-175.8	0	0	0	0	0	114.8	L78 A95	L78-G80 PolarHBondContact O-N 3.5Å; G80-A95 WeakPolarHBondContact O-CB 3.45Å; G80-A95 PolarHBondContact O-N 3.08Å; G80-A95 VanDerWaalsContact O-N 3.08Å
81	K	93.4	Very high	92.3	Very high	67 Å²	67	69.2 Å²	69.2	29%	0.291	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	152.7	175.4	-57.8	-63.1	-175.2	-168.1	0	111.4	C77 L78 P79 C92 V93 D94	C77-K81 HydrophobicContact CB-CB 4.02Å; L78-K81 WeakPolarHBondContact O-CB 3.27Å; L78-K81 PolarHBondContact O-N 2.88Å; P79-K81 VanDerWaalsContact C-N 3.28Å; K81-C92 HydrophobicContact CB-CB 4.24Å; K81-V93 CarbonylContact C-O 3.47Å; K81-V93 WeakPolarHBondContact CA-O 3.33Å; K81-V93 WeakPolarHBondContact CB-O 3.38Å; K81-V93 WeakPolarHBondContact CD-O 3.37Å; K81-D94 IonicContact NZ-OD2 2.89Å; K81-D94 PolarHBondContact NZ-OD2 2.83Å
82	V	93.4	Very high	92.6	Very high	53 Å²	53	66.1 Å²	66.1	32%	0.321	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	163.7	177.1	-62.8	0	0	0	0	110.7	C77 G84 C92 V93 A95 V98	C77-V82 VanDerWaalsContact SG-C 3.57Å; V82-G84 PolarHBondContact O-N 3.11Å; V82-C92 CarbonylContact O-C 3.57Å; V82-C92 WeakPolarHBondContact O-CA 3.41Å; V82-V93 HydrophobicContact CG2-CG2 4.35Å; V82-V93 PolarHBondContact N-O 2.81Å; V82-V93 PolarHBondContact O-N 2.84Å; V82-A95 HydrophobicContact CG1-CB 4.03Å; V82-A95 HydrophobicContact CG2-CB 4.48Å; V82-V98 HydrophobicContact CG2-CB 4.04Å; V82-V98 HydrophobicContact CG2-CG2 3.59Å
83	A	93.2	Very high	92.8	Very high	63 Å²	63	63 Å²	63	52%	0.521	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.6	133.1	175.5	0	0	0	0	0	110.5	C75	C75-A83 HydrophobicContact CB-CB 3.99Å
84	G	92.9	Very high	92.9	Very high	23 Å²	23	62.8 Å²	62.8	24%	0.237	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.6	-157.3	177.2	0	0	0	0	0	110.2	V82 S91	V82-G84 PolarHBondContact O-N 3.11Å; G84-S91 CarbonylContact C-O 3.53Å; G84-S91 PolarHBondContact N-O 2.03Å; G84-S91 PolarHBondContact O-N 2.06Å
85	T	91.6	Very high	92.9	Very high	20 Å²	20	57.5 Å²	57.5	12%	0.123	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141	144.2	177.4	-177.4	0	0	0	0	110.5	R89 S91 M106 P108 W124	T85-R89 CarbonylContact C-O 3.58Å; T85-R89 VanDerWaalsContact CA-O 3.27Å; T85-R89 WeakPolarHBondContact CA-O 3.11Å; T85-R89 PolarHBondContact OG1-O 2.86Å; T85-R89 VanDerWaalsContact OG1-O 3.08Å; T85-S91 VanDerWaalsContact C-OG 3.29Å; T85-S91 WeakPolarHBondContact CA-OG 3.38Å; T85-M106 HydrophobicContact CG2-CE 3.52Å; T85-M106 HydrophobicContact CG2-SD 3.76Å; T85-M106 WeakPolarHBondContact O-CG 3.24Å; T85-P108 HydrophobicContact CG2-CB 3.7Å; T85-W124 HydrophobicContact CG2-CH2 3.53Å; T85-W124 HydrophobicContact CG2-CZ2 3.32Å
86	T	92.8	Very high	92.9	Very high	30 Å²	30	58.1 Å²	58.1	18%	0.184	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.3	126.7	176.2	-56.4	0	0	0	0	107.2	N88 R89 S91 M106	T86-N88 VanDerWaalsContact C-N 3.34Å; T86-N88 PolarHBondContact O-N 2.82Å; T86-R89 PolarHBondContact N-O 3.31Å; T86-R89 PolarHBondContact O-N 2.83Å; T86-R89 VanDerWaalsContact O-N 3.11Å; T86-S91 WeakPolarHBondContact CB-OG 3.05Å; T86-S91 PolarHBondContact N-OG 2.97Å; T86-S91 PolarHBondContact OG1-OG 2.83Å; T86-M106 PolarHBondContact OG1-O 3.39Å
87	R	93.1	Very high	92.8	Very high	138 Å²	138	55.7 Å²	55.7	52%	0.521	32%	0.321	S	S	.	.	T	Hydrogen-bonded Turn	trans	49.9	51.8	-179.3	-59.4	178.1	-174.6	-169.5	0.2	112.9	R89 E107 C109 L110	R87-R89 PolarHBondContact O-N 3.34Å; R87-E107 PolarHBondContact N-O 2.91Å; R87-C109 WeakPolarHBondContact CA-O 3.06Å; R87-L110 HydrophobicContact CB-CD2 4.44Å; R87-L110 WeakPolarHBondContact O-CD2 3.41Å
88	N	90.1	Very high	92.7	Very high	71 Å²	71	55.9 Å²	55.9	38%	0.38	32%	0.321	S	S	.	.	T	Hydrogen-bonded Turn	trans	56.9	29.6	178.6	-166	38.8	0	0	0	113.9	T86 P108 L110	T86-N88 VanDerWaalsContact C-N 3.34Å; T86-N88 PolarHBondContact O-N 2.82Å; N88-P108 PolarHBondContact N-O 2.77Å; N88-L110 HydrophobicContact CB-CD2 4.01Å; N88-L110 HydrophobicContact CB-CG 4.05Å
89	R	90.1	Very high	92.6	Very high	168 Å²	168	57.7 Å²	57.7	63%	0.634	33%	0.33	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-134.9	145	176.2	-69.5	-174.1	175.6	118.3	-1.5	110.3	T85 T86 R87 S91	T85-R89 CarbonylContact C-O 3.58Å; T85-R89 VanDerWaalsContact CA-O 3.27Å; T85-R89 WeakPolarHBondContact CA-O 3.11Å; T85-R89 PolarHBondContact OG1-O 2.86Å; T85-R89 VanDerWaalsContact OG1-O 3.08Å; T86-R89 PolarHBondContact N-O 3.31Å; T86-R89 PolarHBondContact O-N 2.83Å; T86-R89 VanDerWaalsContact O-N 3.11Å; R87-R89 PolarHBondContact O-N 3.34Å; R89-S91 PolarHBondContact O-N 3.14Å
90	P	92.6	Very high	92.6	Very high	34 Å²	34	52.9 Å²	52.9	22%	0.221	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.5	138	175.9	28.8	-34.9	0	0	0	111.1	C52 V54 V73	C52-P90 HydrophobicContact CB-CB 3.93Å; C52-P90 HydrophobicContact CB-CG 4.32Å; V54-P90 HydrophobicContact CG2-CG 3.84Å; V73-P90 HydrophobicContact CB-CB 4.32Å; V73-P90 HydrophobicContact CG1-CB 3.39Å; V73-P90 HydrophobicContact CG1-CG 3.91Å; V73-P90 HydrophobicContact CG2-CB 4Å; V73-P90 HydrophobicContact CG2-CG 4.21Å
91	S	92.8	Very high	92.8	Very high	5 Å²	5	55.2 Å²	55.2	4%	0.035	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.6	166	-177.2	59.9	0	0	0	0	110.7	G84 T85 T86 R89	G84-S91 CarbonylContact C-O 3.53Å; G84-S91 PolarHBondContact N-O 2.03Å; G84-S91 PolarHBondContact O-N 2.06Å; T85-S91 VanDerWaalsContact C-OG 3.29Å; T85-S91 WeakPolarHBondContact CA-OG 3.38Å; T86-S91 WeakPolarHBondContact CB-OG 3.05Å; T86-S91 PolarHBondContact N-OG 2.97Å; T86-S91 PolarHBondContact OG1-OG 2.83Å; R89-S91 PolarHBondContact O-N 3.14Å
92	C	94	Very high	92.8	Very high	10 Å²	10	57.8 Å²	57.8	7%	0.068	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.4	123.3	165.9	-68.5	0	0	0	0	108.5	G49 C77 K81 V82	G49-C92 WeakPolarHBondContact O-CB 3.47Å; C77-C92 WeakPolarHBondContact CA-SG 3.23Å; C77-C92 HydrophobicContact CB-CB 3.81Å; C77-C92 WeakPolarHBondContact CB-SG 3.34Å; C77-C92 WeakPolarHBondContact SG-CB 3.29Å; C77-C92 CovalentContact SG-SG 2.05Å; C77-C92 PolarHBondContact SG-SG 3.39Å; K81-C92 HydrophobicContact CB-CB 4.24Å; V82-C92 CarbonylContact O-C 3.57Å; V82-C92 WeakPolarHBondContact O-CA 3.41Å
93	V	93.6	Very high	92.9	Very high	10 Å²	10	56 Å²	56	6%	0.061	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	168.7	-178	-58.3	0	0	0	0	110.2	K81 V82 A95 V98 M106	K81-V93 CarbonylContact C-O 3.47Å; K81-V93 WeakPolarHBondContact CA-O 3.33Å; K81-V93 WeakPolarHBondContact CB-O 3.38Å; K81-V93 WeakPolarHBondContact CD-O 3.37Å; V82-V93 HydrophobicContact CG2-CG2 4.35Å; V82-V93 PolarHBondContact N-O 2.81Å; V82-V93 PolarHBondContact O-N 2.84Å; V93-A95 PolarHBondContact O-N 3.35Å; V93-V98 HydrophobicContact CG2-CG2 4.01Å; V93-M106 HydrophobicContact CB-CB 4.45Å; V93-M106 HydrophobicContact CG1-CB 3.92Å
94	D	93.5	Very high	93.1	Very high	55 Å²	55	54.9 Å²	54.9	29%	0.294	28%	0.283	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.8	134.6	176.8	-154.4	-83	0	0	0	112.2	K81 S96 I97	K81-D94 IonicContact NZ-OD2 2.89Å; K81-D94 PolarHBondContact NZ-OD2 2.83Å; D94-S96 PolarHBondContact O-N 3.27Å; D94-S96 VanDerWaalsContact OD1-CB 3.29Å; D94-S96 WeakPolarHBondContact OD1-CB 3.06Å; D94-S96 PolarHBondContact OD1-N 2.83Å; D94-S96 PolarHBondContact OD1-OG 3.03Å; D94-I97 HydrophobicContact CB-CD1 3.99Å; D94-I97 HydrophobicContact CB-CG1 4.14Å; D94-I97 WeakPolarHBondContact O-CB 3.36Å; D94-I97 PolarHBondContact O-N 2.81Å; D94-I97 VanDerWaalsContact O-N 3.15Å
95	A	92.8	Very high	93.2	Very high	23 Å²	23	59.5 Å²	59.5	19%	0.19	30%	0.299	C	S	.	.	H	α-helix	trans	-58.5	-33.2	177.7	0	0	0	0	0	112.1	G80 V82 V93 I97 V98 I99	G80-A95 WeakPolarHBondContact O-CB 3.45Å; G80-A95 PolarHBondContact O-N 3.08Å; G80-A95 VanDerWaalsContact O-N 3.08Å; V82-A95 HydrophobicContact CG1-CB 4.03Å; V82-A95 HydrophobicContact CG2-CB 4.48Å; V93-A95 PolarHBondContact O-N 3.35Å; A95-I97 VanDerWaalsContact C-N 3.27Å; A95-I97 PolarHBondContact O-N 3.22Å; A95-V98 PolarHBondContact O-N 2.9Å; A95-I99 HydrophobicContact CB-CD1 4.26Å; A95-I99 WeakPolarHBondContact O-CB 3.44Å; A95-I99 WeakPolarHBondContact O-CD1 3.5Å; A95-I99 VanDerWaalsContact O-CG1 3.22Å; A95-I99 WeakPolarHBondContact O-CG1 3.35Å; A95-I99 PolarHBondContact O-N 2.82Å
96	S	93.2	Very high	93.2	Very high	49 Å²	49	59 Å²	59	34%	0.343	30%	0.295	S	S	.	.	H	α-helix	trans	-59.6	-36	178.3	59.4	0	0	0	0	112.9	D94 I99 G100	D94-S96 PolarHBondContact O-N 3.27Å; D94-S96 VanDerWaalsContact OD1-CB 3.29Å; D94-S96 WeakPolarHBondContact OD1-CB 3.06Å; D94-S96 PolarHBondContact OD1-N 2.83Å; D94-S96 PolarHBondContact OD1-OG 3.03Å; S96-I99 PolarHBondContact O-N 2.82Å; S96-G100 WeakPolarHBondContact O-CA 3.38Å; S96-G100 PolarHBondContact O-N 3.17Å
97	I	92.9	Very high	93.4	Very high	20 Å²	20	63 Å²	63	10%	0.103	31%	0.312	C	S	.	.	H	α-helix	trans	-63	-45.7	178.4	-64.6	170.3	0	0	0	110.6	D94 A95 K101 W102 E105 M106	D94-I97 HydrophobicContact CB-CD1 3.99Å; D94-I97 HydrophobicContact CB-CG1 4.14Å; D94-I97 WeakPolarHBondContact O-CB 3.36Å; D94-I97 PolarHBondContact O-N 2.81Å; D94-I97 VanDerWaalsContact O-N 3.15Å; A95-I97 VanDerWaalsContact C-N 3.27Å; A95-I97 PolarHBondContact O-N 3.22Å; I97-K101 CarbonylContact O-C 3.59Å; I97-K101 WeakPolarHBondContact O-CA 3.05Å; I97-K101 PolarHBondContact O-N 3.2Å; I97-W102 HydrophobicContact CG1-CE3 4.44Å; I97-W102 HydrophobicContact CG2-CB 4.26Å; I97-W102 WeakPolarHBondContact CG2-O 3.43Å; I97-W102 PolarHBondContact O-N 3.03Å; I97-E105 HydrophobicContact CD1-CB 4.4Å; I97-E105 HydrophobicContact CG1-CB 4.37Å; I97-E105 HydrophobicContact CG2-CB 4.44Å; I97-M106 HydrophobicContact CG2-CB 4.25Å
98	V	91.9	Very high	93.5	Very high	47 Å²	47	56.5 Å²	56.5	29%	0.285	29%	0.287	S	S	.	.	H	α-helix	trans	-73.2	-40.4	-179	179.4	0	0	0	0	111.1	V82 V93 A95 K101 W103	V82-V98 HydrophobicContact CG2-CB 4.04Å; V82-V98 HydrophobicContact CG2-CG2 3.59Å; V93-V98 HydrophobicContact CG2-CG2 4.01Å; A95-V98 PolarHBondContact O-N 2.9Å; V98-K101 PolarHBondContact O-N 3.45Å; V98-W103 HydrophobicContact CB-CZ3 4.41Å; V98-W103 HydrophobicContact CG1-CH2 4.23Å; V98-W103 HydrophobicContact CG1-CZ3 4.11Å; V98-W103 HydrophobicContact CG2-CZ3 4.38Å
99	I	92.5	Very high	93.8	Very high	141 Å²	141	53.7 Å²	53.7	72%	0.723	27%	0.273	S	S	*	.	H	α-helix	trans	-64.2	-44.8	176.8	-67.4	165.9	0	0	0	110.7	A95 S96 K101	A95-I99 HydrophobicContact CB-CD1 4.26Å; A95-I99 WeakPolarHBondContact O-CB 3.44Å; A95-I99 WeakPolarHBondContact O-CD1 3.5Å; A95-I99 VanDerWaalsContact O-CG1 3.22Å; A95-I99 WeakPolarHBondContact O-CG1 3.35Å; A95-I99 PolarHBondContact O-N 2.82Å; S96-I99 PolarHBondContact O-N 2.82Å; I99-K101 VanDerWaalsContact C-N 3.25Å; I99-K101 PolarHBondContact O-N 2.97Å
100	G	93.4	Very high	94	Very high	31 Å²	31	49.1 Å²	49.1	32%	0.32	26%	0.261	S	S	.	.	H	α-helix	trans	-75.8	-10.9	177.4	0	0	0	0	0	114	S96 W102	S96-G100 WeakPolarHBondContact O-CA 3.38Å; S96-G100 PolarHBondContact O-N 3.17Å; G100-W102 VanDerWaalsContact C-CD1 3.43Å; G100-W102 PolarHBondContact O-N 2.85Å; G100-W102 PolarHBondContact O-NE1 2.86Å; G100-W102 VanDerWaalsContact O-NE1 3.16Å
101	K	94.3	Very high	94.1	Very high	101 Å²	101	56.5 Å²	56.5	44%	0.439	29%	0.292	S	S	.	.	T	Hydrogen-bonded Turn	trans	58.8	34.3	-174.8	-53.3	-175.9	177.7	-174.2	0	112.8	I97 V98 I99 W103 N121	I97-K101 CarbonylContact O-C 3.59Å; I97-K101 WeakPolarHBondContact O-CA 3.05Å; I97-K101 PolarHBondContact O-N 3.2Å; V98-K101 PolarHBondContact O-N 3.45Å; I99-K101 VanDerWaalsContact C-N 3.25Å; I99-K101 PolarHBondContact O-N 2.97Å; K101-W103 HydrophobicContact CB-CZ2 3.72Å; K101-W103 HydrophobicContact CD-CZ2 4.31Å; K101-W103 HydrophobicContact CG-CH2 4.38Å; K101-W103 HydrophobicContact CG-CZ2 3.75Å; K101-W103 VanDerWaalsContact O-CD1 3.29Å; K101-W103 PolarHBondContact O-N 2.91Å; K101-W103 PolarHBondContact O-NE1 2.76Å; K101-N121 HydrophobicContact CB-CB 4.16Å; K101-N121 HydrophobicContact CD-CB 3.62Å
102	W	94.8	Very high	94.1	Very high	121 Å²	121	60.1 Å²	60.1	46%	0.458	33%	0.331	S	S	.	.			trans	-83.4	55.6	-179.4	-50	-26.9	0	0	0	110.7	I97 G100 C104 E105	I97-W102 HydrophobicContact CG1-CE3 4.44Å; I97-W102 HydrophobicContact CG2-CB 4.26Å; I97-W102 WeakPolarHBondContact CG2-O 3.43Å; I97-W102 PolarHBondContact O-N 3.03Å; G100-W102 VanDerWaalsContact C-CD1 3.43Å; G100-W102 PolarHBondContact O-N 2.85Å; G100-W102 PolarHBondContact O-NE1 2.86Å; G100-W102 VanDerWaalsContact O-NE1 3.16Å; W102-C104 PolarHBondContact O-N 2.05Å; W102-E105 HydrophobicContact CB-CB 4.16Å; W102-E105 HydrophobicContact CB-CG 3.86Å; W102-E105 WeakPolarHBondContact O-CB 3.49Å; W102-E105 PolarHBondContact O-N 2.8Å
103	W	95.4	Very high	94.3	Very high	15 Å²	15	61.3 Å²	61.3	6%	0.057	34%	0.335	C	S	.	.	T	Hydrogen-bonded Turn	trans	-56.7	-26.2	-165.4	-51.1	119	0	0	0	115.3	V98 K101 M106 P108 N121 W124 V137	V98-W103 HydrophobicContact CB-CZ3 4.41Å; V98-W103 HydrophobicContact CG1-CH2 4.23Å; V98-W103 HydrophobicContact CG1-CZ3 4.11Å; V98-W103 HydrophobicContact CG2-CZ3 4.38Å; K101-W103 HydrophobicContact CB-CZ2 3.72Å; K101-W103 HydrophobicContact CD-CZ2 4.31Å; K101-W103 HydrophobicContact CG-CH2 4.38Å; K101-W103 HydrophobicContact CG-CZ2 3.75Å; K101-W103 VanDerWaalsContact O-CD1 3.29Å; K101-W103 PolarHBondContact O-N 2.91Å; K101-W103 PolarHBondContact O-NE1 2.76Å; W103-M106 HydrophobicContact CB-CE 4.26Å; W103-M106 HydrophobicContact CE3-CE 4.26Å; W103-M106 WeakPolarHBondContact O-CE 3.3Å; W103-M106 WeakPolarHBondContact O-CG 3.38Å; W103-P108 WeakPolarHBondContact O-CD 3.47Å; W103-P108 WeakPolarHBondContact O-CG 3.38Å; W103-N121 WeakPolarHBondContact CZ2-O 3.41Å; W103-N121 PolarHBondContact NE1-O 2.86Å; W103-W124 HydrophobicContact CB-CB 3.93Å; W103-W124 HydrophobicContact CB-CD2 4.46Å; W103-W124 HydrophobicContact CB-CE3 3.98Å; W103-W124 HydrophobicContact CB-CG 4.49Å; W103-W124 HydrophobicContact CD2-CE3 4.43Å; W103-W124 HydrophobicContact CG-CE3 4.22Å; W103-V137 HydrophobicContact CH2-CG2 4.34Å; W103-V137 HydrophobicContact CZ3-CG2 4.36Å
104	C	96.2	Very high	94.4	Very high	40 Å²	40	67.2 Å²	67.2	27%	0.27	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.6	-15.5	177	-68.9	0	0	0	0	114	W102 M106 E107 C115 K116	W102-C104 PolarHBondContact O-N 2.05Å; C104-M106 VanDerWaalsContact C-N 3.29Å; C104-M106 PolarHBondContact O-N 2.79Å; C104-E107 PolarHBondContact O-N 3.41Å; C104-E107 VanDerWaalsContact O-N 3.14Å; C104-C115 WeakPolarHBondContact CA-SG 3.39Å; C104-C115 HydrophobicContact CB-CB 3.84Å; C104-C115 WeakPolarHBondContact CB-SG 3.37Å; C104-C115 WeakPolarHBondContact SG-CB 3.07Å; C104-C115 CovalentContact SG-SG 2.06Å; C104-C115 PolarHBondContact SG-SG 3.24Å; C104-K116 VanDerWaalsContact SG-C 3.58Å; C104-K116 PolarHBondContact SG-N 2.05Å; C104-K116 VanDerWaalsContact SG-N 3.39Å
105	E	94.8	Very high	94.6	Very high	121 Å²	121	66.4 Å²	66.4	57%	0.565	36%	0.36	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.4	-22.6	176	-66.9	-173.1	-163.9	0	0	112.9	I97 W102 E107	I97-E105 HydrophobicContact CD1-CB 4.4Å; I97-E105 HydrophobicContact CG1-CB 4.37Å; I97-E105 HydrophobicContact CG2-CB 4.44Å; W102-E105 HydrophobicContact CB-CB 4.16Å; W102-E105 HydrophobicContact CB-CG 3.86Å; W102-E105 WeakPolarHBondContact O-CB 3.49Å; W102-E105 PolarHBondContact O-N 2.8Å; E105-E107 PolarHBondContact O-N 3.46Å
106	M	93.2	Very high	94.8	Very high	9 Å²	9	71 Å²	71	4%	0.044	38%	0.376	C	S	.	.	T	Hydrogen-bonded Turn	trans	-75.9	-0.5	170.9	59.9	175.7	178.4	0	0	114.1	T85 T86 V93 I97 W103 C104 P108 W124	T85-M106 HydrophobicContact CG2-CE 3.52Å; T85-M106 HydrophobicContact CG2-SD 3.76Å; T85-M106 WeakPolarHBondContact O-CG 3.24Å; T86-M106 PolarHBondContact OG1-O 3.39Å; V93-M106 HydrophobicContact CB-CB 4.45Å; V93-M106 HydrophobicContact CG1-CB 3.92Å; I97-M106 HydrophobicContact CG2-CB 4.25Å; W103-M106 HydrophobicContact CB-CE 4.26Å; W103-M106 HydrophobicContact CE3-CE 4.26Å; W103-M106 WeakPolarHBondContact O-CE 3.3Å; W103-M106 WeakPolarHBondContact O-CG 3.38Å; C104-M106 VanDerWaalsContact C-N 3.29Å; C104-M106 PolarHBondContact O-N 2.79Å; M106-P108 HydrophobicContact CE-CB 3.8Å; M106-P108 HydrophobicContact CE-CG 4.16Å; M106-P108 HydrophobicContact CG-CB 4.2Å; M106-P108 HydrophobicContact CG-CG 4.37Å; M106-W124 HydrophobicContact CE-CD2 3.77Å; M106-W124 HydrophobicContact CE-CE3 3.4Å; M106-W124 VanDerWaalsContact CE-CE3 3.4Å; M106-W124 HydrophobicContact CE-CH2 3.59Å; M106-W124 HydrophobicContact CE-CZ2 3.95Å; M106-W124 HydrophobicContact CE-CZ3 3.31Å
107	E	95.5	Very high	95	Very high	114 Å²	114	70.7 Å²	70.7	53%	0.533	37%	0.372	S	S	.	.			trans	50.3	60.4	-175.3	-58.1	-171.7	150.8	0	0	112.7	R87 C104 E105 C109	R87-E107 PolarHBondContact N-O 2.91Å; C104-E107 PolarHBondContact O-N 3.41Å; C104-E107 VanDerWaalsContact O-N 3.14Å; E105-E107 PolarHBondContact O-N 3.46Å; E107-C109 VanDerWaalsContact C-N 3.32Å; E107-C109 PolarHBondContact O-N 2.87Å
108	P	95.3	Very high	95.2	Very high	2 Å²	2	70.3 Å²	70.3	1%	0.013	37%	0.37	C	S	.	.			trans	-77.1	-19.4	-169.4	33.7	-38.2	0	0	0	113.7	T85 N88 W103 M106 W124	T85-P108 HydrophobicContact CG2-CB 3.7Å; N88-P108 PolarHBondContact N-O 2.77Å; W103-P108 WeakPolarHBondContact O-CD 3.47Å; W103-P108 WeakPolarHBondContact O-CG 3.38Å; M106-P108 HydrophobicContact CE-CB 3.8Å; M106-P108 HydrophobicContact CE-CG 4.16Å; M106-P108 HydrophobicContact CG-CB 4.2Å; M106-P108 HydrophobicContact CG-CG 4.37Å; P108-W124 HydrophobicContact CB-CD2 4.29Å; P108-W124 HydrophobicContact CB-CG 4.4Å; P108-W124 HydrophobicContact CB-CZ2 4.25Å; P108-W124 HydrophobicContact CG-CD2 4.23Å; P108-W124 HydrophobicContact CG-CG 3.91Å
109	C	96.3	Very high	95.4	Very high	12 Å²	12	74 Å²	74	8%	0.081	40%	0.395	C	S	.	.	S	Bend	trans	-86.8	160.7	-176.6	-54.7	0	0	0	0	112.1	R87 E107 E113 C115 C126	R87-C109 WeakPolarHBondContact CA-O 3.06Å; E107-C109 VanDerWaalsContact C-N 3.32Å; E107-C109 PolarHBondContact O-N 2.87Å; C109-E113 HydrophobicContact CB-CB 3.8Å; C109-C115 HydrophobicContact CB-CB 4.49Å; C109-C115 VanDerWaalsContact SG-CB 3.55Å; C109-C126 WeakPolarHBondContact CA-SG 3.2Å; C109-C126 HydrophobicContact CB-CB 3.72Å; C109-C126 WeakPolarHBondContact CB-SG 3.26Å; C109-C126 WeakPolarHBondContact SG-CA 3.43Å; C109-C126 WeakPolarHBondContact SG-CB 3.29Å; C109-C126 CovalentContact SG-SG 2.03Å; C109-C126 PolarHBondContact SG-SG 2.89Å
110	L	95.6	Very high	95.5	Very high	71 Å²	71	72.1 Å²	72.1	37%	0.372	39%	0.386	S	S	.	.	P	Polyproline II helix	trans	-74.2	164.1	174.2	-67.2	172.7	0	0	0	111	R87 N88 G112 E113	R87-L110 HydrophobicContact CB-CD2 4.44Å; R87-L110 WeakPolarHBondContact O-CD2 3.41Å; N88-L110 HydrophobicContact CB-CD2 4.01Å; N88-L110 HydrophobicContact CB-CG 4.05Å; L110-G112 PolarHBondContact O-N 3.24Å; L110-E113 HydrophobicContact CB-CG 4.15Å; L110-E113 PolarHBondContact N-OE2 3.33Å; L110-E113 WeakPolarHBondContact O-CB 3.35Å; L110-E113 PolarHBondContact O-N 3.15Å
111	E	94	Very high	95.6	Very high	189 Å²	189	74.2 Å²	74.2	88%	0.883	39%	0.391	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.3	132.1	174.5	-168	172.4	-175	0	0	110.7	E113	E111-E113 VanDerWaalsContact C-N 3.3Å
112	G	93.1	Very high	95.7	Very high	82 Å²	82	70.8 Å²	70.8	85%	0.845	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.1	0.5	-174.6	0	0	0	0	0	115	L110	L110-G112 PolarHBondContact O-N 3.24Å
113	E	96.9	Very high	95.8	Very high	34 Å²	34	65 Å²	65	16%	0.159	36%	0.357	C	S	.	.	P	Polyproline II helix	trans	-95.5	142.1	168.3	-59.3	-174.4	151	0	0	110.8	C109 L110 E111 C126 Y127 A128 K133	C109-E113 HydrophobicContact CB-CB 3.8Å; L110-E113 HydrophobicContact CB-CG 4.15Å; L110-E113 PolarHBondContact N-OE2 3.33Å; L110-E113 WeakPolarHBondContact O-CB 3.35Å; L110-E113 PolarHBondContact O-N 3.15Å; E111-E113 VanDerWaalsContact C-N 3.3Å; E113-C126 HydrophobicContact CB-CB 4.36Å; E113-Y127 CarbonylContact C-O 3.47Å; E113-Y127 WeakPolarHBondContact CA-O 3.06Å; E113-A128 HydrophobicContact CG-CB 4.01Å; E113-K133 IonicContact OE1-NZ 3.63Å; E113-K133 PolarHBondContact OE1-NZ 3.48Å; E113-K133 IonicContact OE2-NZ 2.68Å
114	E	96.9	Very high	95.8	Very high	135 Å²	135	65.4 Å²	65.4	63%	0.631	36%	0.359	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.5	129.3	174	-170.7	-173.2	164.8	0	0	110.4	C126 Y127	E114-C126 WeakPolarHBondContact O-CA 3.41Å; E114-Y127 PolarHBondContact N-O 2.9Å; E114-Y127 PolarHBondContact O-N 3.42Å
115	C	97.6	Very high	95.9	Very high	37 Å²	37	64.6 Å²	64.6	25%	0.25	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.6	136	177.4	-173.3	0	0	0	0	111.6	C104 C109 M125	C104-C115 WeakPolarHBondContact CA-SG 3.39Å; C104-C115 HydrophobicContact CB-CB 3.84Å; C104-C115 WeakPolarHBondContact CB-SG 3.37Å; C104-C115 WeakPolarHBondContact SG-CB 3.07Å; C104-C115 CovalentContact SG-SG 2.06Å; C104-C115 PolarHBondContact SG-SG 3.24Å; C109-C115 HydrophobicContact CB-CB 4.49Å; C109-C115 VanDerWaalsContact SG-CB 3.55Å; C115-M125 WeakPolarHBondContact CA-O 3.48Å
116	K	97.3	Very high	96	Very high	120 Å²	120	59.1 Å²	59.1	52%	0.522	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	139.2	168.6	-173.2	174.6	-178.8	173.7	0	111.4	C104 W124 M125 Y127	C104-K116 VanDerWaalsContact SG-C 3.58Å; C104-K116 PolarHBondContact SG-N 2.05Å; C104-K116 VanDerWaalsContact SG-N 3.39Å; K116-W124 CarbonylContact O-C 3.56Å; K116-W124 VanDerWaalsContact O-CA 3.29Å; K116-W124 WeakPolarHBondContact O-CA 3.42Å; K116-M125 HydrophobicContact CB-CG 3.73Å; K116-M125 HydrophobicContact CB-SD 4.06Å; K116-M125 HydrophobicContact CD-SD 4.17Å; K116-M125 HydrophobicContact CG-SD 4.33Å; K116-M125 PolarHBondContact N-O 3.16Å; K116-M125 VanDerWaalsContact O-CG 3.23Å; K116-M125 WeakPolarHBondContact O-CG 3.32Å; K116-M125 PolarHBondContact O-N 3.15Å; K116-Y127 HydrophobicContact CB-CE2 4.1Å; K116-Y127 HydrophobicContact CD-CE2 4.45Å
117	T	96.8	Very high	96.2	Very high	42 Å²	42	62.1 Å²	62.1	26%	0.258	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71	140.6	171.5	-66.2	0	0	0	0	110.7	N121	T117-N121 WeakPolarHBondContact CG2-OD1 3.42Å
118	L	97.4	Very high	96.2	Very high	13 Å²	13	58.4 Å²	58.4	7%	0.068	33%	0.327	C	S	.	.			trans	-62.6	145.4	172.4	-72	171.1	0	0	0	110.7	D120 N121 S122 G123 M125 T134 R136	L118-D120 VanDerWaalsContact CB-OD1 3.3Å; L118-D120 WeakPolarHBondContact CB-OD1 3.18Å; L118-D120 PolarHBondContact O-N 2.97Å; L118-D120 VanDerWaalsContact O-N 3.11Å; L118-N121 WeakPolarHBondContact O-CA 3.46Å; L118-N121 PolarHBondContact O-N 2.94Å; L118-S122 WeakPolarHBondContact CD1-OG 3.33Å; L118-G123 WeakPolarHBondContact CB-O 3.24Å; L118-G123 PolarHBondContact N-O 2.94Å; L118-M125 HydrophobicContact CD2-CE 3.4Å; L118-M125 VanDerWaalsContact CD2-CE 3.4Å; L118-M125 HydrophobicContact CG-CE 4.4Å; L118-T134 HydrophobicContact CD1-CG2 4.22Å; L118-T134 HydrophobicContact CD2-CG2 4.11Å; L118-R136 HydrophobicContact CD1-CG 3.83Å
119	P	95.4	Very high	96	Very high	125 Å²	125	61.5 Å²	61.5	81%	0.812	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.1	-26.9	-176.6	-25.4	34.4	0	0	0	115	N121	P119-N121 VanDerWaalsContact C-N 3.33Å
120	D	96	Very high	95.7	Very high	100 Å²	100	69.2 Å²	69.2	54%	0.535	40%	0.399	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.2	4.6	178	61.3	-0.7	0	0	0	113.1	L118 S122	L118-D120 VanDerWaalsContact CB-OD1 3.3Å; L118-D120 WeakPolarHBondContact CB-OD1 3.18Å; L118-D120 PolarHBondContact O-N 2.97Å; L118-D120 VanDerWaalsContact O-N 3.11Å; D120-S122 PolarHBondContact O-N 3.38Å; D120-S122 VanDerWaalsContact O-N 3.15Å; D120-S122 VanDerWaalsContact OD1-CB 3.24Å; D120-S122 WeakPolarHBondContact OD1-CB 3.47Å; D120-S122 PolarHBondContact OD1-N 2.9Å; D120-S122 PolarHBondContact OD1-OG 3.47Å; D120-S122 PolarHBondContact OD2-OG 2.64Å
121	N	95.3	Very high	95.5	Very high	76 Å²	76	73.4 Å²	73.4	41%	0.406	42%	0.415	S	S	.	.	S	Bend	trans	55.8	22.3	-172.6	-54.6	-52.8	0	0	0	113.6	K101 W103 T117 L118 P119 G123	K101-N121 HydrophobicContact CB-CB 4.16Å; K101-N121 HydrophobicContact CD-CB 3.62Å; W103-N121 WeakPolarHBondContact CZ2-O 3.41Å; W103-N121 PolarHBondContact NE1-O 2.86Å; T117-N121 WeakPolarHBondContact CG2-OD1 3.42Å; L118-N121 WeakPolarHBondContact O-CA 3.46Å; L118-N121 PolarHBondContact O-N 2.94Å; P119-N121 VanDerWaalsContact C-N 3.33Å; N121-G123 PolarHBondContact O-N 2.96Å
122	S	95.7	Very high	95.4	Very high	29 Å²	29	69.1 Å²	69.1	20%	0.203	40%	0.397	C	S	.	.	S	Bend	trans	-80.8	1.9	178.3	68.6	0	0	0	0	113.6	L118 D120 R136 V137	L118-S122 WeakPolarHBondContact CD1-OG 3.33Å; D120-S122 PolarHBondContact O-N 3.38Å; D120-S122 VanDerWaalsContact O-N 3.15Å; D120-S122 VanDerWaalsContact OD1-CB 3.24Å; D120-S122 WeakPolarHBondContact OD1-CB 3.47Å; D120-S122 PolarHBondContact OD1-N 2.9Å; D120-S122 PolarHBondContact OD1-OG 3.47Å; D120-S122 PolarHBondContact OD2-OG 2.64Å; S122-R136 CarbonylContact O-C 3.56Å; S122-R136 WeakPolarHBondContact O-CA 3.22Å; S122-V137 PolarHBondContact O-N 3.26Å
123	G	96.2	Very high	95.4	Very high	0 Å²	0	69.4 Å²	69.4	0%	0	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	154.9	-150.1	-178.9	0	0	0	0	0	112.2	L118 N121 T135	L118-G123 WeakPolarHBondContact CB-O 3.24Å; L118-G123 PolarHBondContact N-O 2.94Å; N121-G123 PolarHBondContact O-N 2.96Å; G123-T135 WeakPolarHBondContact CA-O 3.46Å
124	W	97.3	Very high	95.3	Very high	22 Å²	22	71.3 Å²	71.3	8%	0.083	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.7	170.4	-173	66.4	94.9	0	0	0	112.4	T85 W103 M106 P108 K116 T135 V137	T85-W124 HydrophobicContact CG2-CH2 3.53Å; T85-W124 HydrophobicContact CG2-CZ2 3.32Å; W103-W124 HydrophobicContact CB-CB 3.93Å; W103-W124 HydrophobicContact CB-CD2 4.46Å; W103-W124 HydrophobicContact CB-CE3 3.98Å; W103-W124 HydrophobicContact CB-CG 4.49Å; W103-W124 HydrophobicContact CD2-CE3 4.43Å; W103-W124 HydrophobicContact CG-CE3 4.22Å; M106-W124 HydrophobicContact CE-CD2 3.77Å; M106-W124 HydrophobicContact CE-CE3 3.4Å; M106-W124 VanDerWaalsContact CE-CE3 3.4Å; M106-W124 HydrophobicContact CE-CH2 3.59Å; M106-W124 HydrophobicContact CE-CZ2 3.95Å; M106-W124 HydrophobicContact CE-CZ3 3.31Å; P108-W124 HydrophobicContact CB-CD2 4.29Å; P108-W124 HydrophobicContact CB-CG 4.4Å; P108-W124 HydrophobicContact CB-CZ2 4.25Å; P108-W124 HydrophobicContact CG-CD2 4.23Å; P108-W124 HydrophobicContact CG-CG 3.91Å; K116-W124 CarbonylContact O-C 3.56Å; K116-W124 VanDerWaalsContact O-CA 3.29Å; K116-W124 WeakPolarHBondContact O-CA 3.42Å; W124-T135 VanDerWaalsContact CE2-CB 3.45Å; W124-T135 HydrophobicContact CH2-CG2 3.31Å; W124-T135 HydrophobicContact CZ2-CG2 3.25Å; W124-T135 HydrophobicContact CZ3-CG2 4Å; W124-T135 PolarHBondContact N-O 3.44Å; W124-T135 PolarHBondContact O-N 2.95Å; W124-T135 VanDerWaalsContact O-O 3.13Å; W124-V137 HydrophobicContact CH2-CG2 4.49Å; W124-V137 HydrophobicContact CZ3-CG2 3.74Å
125	M	97.1	Very high	95.1	Very high	23 Å²	23	67.4 Å²	67.4	11%	0.113	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	143	173.9	54.4	-176.2	72.1	0	0	110	C115 K116 L118 Y127 I132 K133	C115-M125 WeakPolarHBondContact CA-O 3.48Å; K116-M125 HydrophobicContact CB-CG 3.73Å; K116-M125 HydrophobicContact CB-SD 4.06Å; K116-M125 HydrophobicContact CD-SD 4.17Å; K116-M125 HydrophobicContact CG-SD 4.33Å; K116-M125 PolarHBondContact N-O 3.16Å; K116-M125 VanDerWaalsContact O-CG 3.23Å; K116-M125 WeakPolarHBondContact O-CG 3.32Å; K116-M125 PolarHBondContact O-N 3.15Å; L118-M125 HydrophobicContact CD2-CE 3.4Å; L118-M125 VanDerWaalsContact CD2-CE 3.4Å; L118-M125 HydrophobicContact CG-CE 4.4Å; M125-Y127 HydrophobicContact CB-CE2 4.3Å; M125-Y127 HydrophobicContact CG-CD2 4.27Å; M125-Y127 HydrophobicContact CG-CE2 3.51Å; M125-Y127 HydrophobicContact SD-CD2 4.46Å; M125-Y127 HydrophobicContact SD-CE2 3.26Å; M125-Y127 WeakPolarHBondContact SD-CE2 3.45Å; M125-Y127 PolarHBondContact SD-OH 3.11Å; M125-I132 HydrophobicContact CB-CG2 4.41Å; M125-K133 CarbonylContact C-O 3.59Å; M125-K133 VanDerWaalsContact CA-O 3.24Å; M125-K133 WeakPolarHBondContact CA-O 3.47Å
126	C	97.7	Very high	94.8	Very high	7 Å²	7	74.6 Å²	74.6	5%	0.047	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	123.9	173.6	-58.2	0	0	0	0	109.2	C109 E113 E114 K133	C109-C126 WeakPolarHBondContact CA-SG 3.2Å; C109-C126 HydrophobicContact CB-CB 3.72Å; C109-C126 WeakPolarHBondContact CB-SG 3.26Å; C109-C126 WeakPolarHBondContact SG-CA 3.43Å; C109-C126 WeakPolarHBondContact SG-CB 3.29Å; C109-C126 CovalentContact SG-SG 2.03Å; C109-C126 PolarHBondContact SG-SG 2.89Å; E113-C126 HydrophobicContact CB-CB 4.36Å; E114-C126 WeakPolarHBondContact O-CA 3.41Å; C126-K133 HydrophobicContact CB-CB 4.4Å; C126-K133 PolarHBondContact N-O 2.78Å; C126-K133 PolarHBondContact O-N 2.96Å
127	Y	96.7	Very high	94.4	Very high	71 Å²	71	72.3 Å²	72.3	28%	0.278	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	122.9	178.7	-67.8	-92.4	0	0	0	110.7	E113 E114 K116 M125 I132	E113-Y127 CarbonylContact C-O 3.47Å; E113-Y127 WeakPolarHBondContact CA-O 3.06Å; E114-Y127 PolarHBondContact N-O 2.9Å; E114-Y127 PolarHBondContact O-N 3.42Å; K116-Y127 HydrophobicContact CB-CE2 4.1Å; K116-Y127 HydrophobicContact CD-CE2 4.45Å; M125-Y127 HydrophobicContact CB-CE2 4.3Å; M125-Y127 HydrophobicContact CG-CD2 4.27Å; M125-Y127 HydrophobicContact CG-CE2 3.51Å; M125-Y127 HydrophobicContact SD-CD2 4.46Å; M125-Y127 HydrophobicContact SD-CE2 3.26Å; M125-Y127 WeakPolarHBondContact SD-CE2 3.45Å; M125-Y127 PolarHBondContact SD-OH 3.11Å; Y127-I132 HydrophobicContact CD1-CD1 4.05Å; Y127-I132 HydrophobicContact CD1-CG1 3.72Å; Y127-I132 HydrophobicContact CE1-CD1 3.61Å; Y127-I132 HydrophobicContact CE1-CG1 3.79Å; Y127-I132 HydrophobicContact CE1-CG2 4.29Å
128	A	95.3	Very high	93.5	Very high	37 Å²	37	79.2 Å²	79.2	31%	0.306	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	75.6	174.3	0	0	0	0	0	108.7	E113 N130 K131	E113-A128 HydrophobicContact CG-CB 4.01Å; A128-N130 PolarHBondContact O-N 3.4Å; A128-N130 VanDerWaalsContact O-N 3.12Å; A128-K131 HydrophobicContact CB-CB 4.3Å; A128-K131 PolarHBondContact N-O 3.01Å; A128-K131 PolarHBondContact O-N 3.08Å; A128-K131 VanDerWaalsContact O-N 3.08Å
129	G	90.6	Very high	93.3	Very high	67 Å²	67	82.6 Å²	82.6	69%	0.691	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.8	-113.5	-169.7	0	0	0	0	0	110.9	K131	G129-K131 VanDerWaalsContact C-N 3.31Å; G129-K131 PolarHBondContact O-N 2.57Å
130	N	91.3	Very high	93.2	Very high	173 Å²	173	80.3 Å²	80.3	93%	0.925	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.6	-3.7	-178.6	-57.6	-0.9	0	0	0	113.6	A128	A128-N130 PolarHBondContact O-N 3.4Å; A128-N130 VanDerWaalsContact O-N 3.12Å
131	K	90.9	Very high	93	Very high	159 Å²	159	79.2 Å²	79.2	69%	0.691	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.9	127.2	179.7	-66.5	179.1	-179	176.5	0	109.5	A128 G129	A128-K131 HydrophobicContact CB-CB 4.3Å; A128-K131 PolarHBondContact N-O 3.01Å; A128-K131 PolarHBondContact O-N 3.08Å; A128-K131 VanDerWaalsContact O-N 3.08Å; G129-K131 VanDerWaalsContact C-N 3.31Å; G129-K131 PolarHBondContact O-N 2.57Å
132	I	93	Very high	92.9	Very high	100 Å²	100	79.4 Å²	79.4	51%	0.513	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	126.6	178.1	-54.4	176	0	0	0	108.1	M125 Y127	M125-I132 HydrophobicContact CB-CG2 4.41Å; Y127-I132 HydrophobicContact CD1-CD1 4.05Å; Y127-I132 HydrophobicContact CD1-CG1 3.72Å; Y127-I132 HydrophobicContact CE1-CD1 3.61Å; Y127-I132 HydrophobicContact CE1-CG1 3.79Å; Y127-I132 HydrophobicContact CE1-CG2 4.29Å
133	K	92.9	Very high	92.7	Very high	87 Å²	87	82.6 Å²	82.6	38%	0.378	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	120	172.1	-61.9	170.7	-172.2	157.8	0	108.3	E113 M125 C126	E113-K133 IonicContact OE1-NZ 3.63Å; E113-K133 PolarHBondContact OE1-NZ 3.48Å; E113-K133 IonicContact OE2-NZ 2.68Å; M125-K133 CarbonylContact C-O 3.59Å; M125-K133 VanDerWaalsContact CA-O 3.24Å; M125-K133 WeakPolarHBondContact CA-O 3.47Å; C126-K133 HydrophobicContact CB-CB 4.4Å; C126-K133 PolarHBondContact N-O 2.78Å; C126-K133 PolarHBondContact O-N 2.96Å
134	T	93.3	Very high	92.5	Very high	74 Å²	74	88.1 Å²	88.1	45%	0.454	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	132	178	-58	0	0	0	0	109.5	L118 R136	L118-T134 HydrophobicContact CD1-CG2 4.22Å; L118-T134 HydrophobicContact CD2-CG2 4.11Å; T134-R136 HydrophobicContact CG2-CG 4.45Å
135	T	92.9	Very high	92.1	Very high	54 Å²	54	92.8 Å²	92.8	33%	0.331	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	131.1	170.4	-54.2	0	0	0	0	109.3	G123 W124	G123-T135 WeakPolarHBondContact CA-O 3.46Å; W124-T135 VanDerWaalsContact CE2-CB 3.45Å; W124-T135 HydrophobicContact CH2-CG2 3.31Å; W124-T135 HydrophobicContact CZ2-CG2 3.25Å; W124-T135 HydrophobicContact CZ3-CG2 4Å; W124-T135 PolarHBondContact N-O 3.44Å; W124-T135 PolarHBondContact O-N 2.95Å; W124-T135 VanDerWaalsContact O-O 3.13Å
136	R	92.2	Very high	91.8	Very high	187 Å²	187	98.2 Å²	98.2	71%	0.706	54%	0.544	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.9	144.2	175	-68.6	-172.3	177.3	118.3	-2.1	109.7	L118 S122 T134	L118-R136 HydrophobicContact CD1-CG 3.83Å; S122-R136 CarbonylContact O-C 3.56Å; S122-R136 WeakPolarHBondContact O-CA 3.22Å; T134-R136 HydrophobicContact CG2-CG 4.45Å
137	V	89.1	Confident	91.3	Very high	73 Å²	73	105.8 Å²	105.8	44%	0.442	59%	0.585	S	S	.	*			trans	-106.6	117.8	172.4	-173.1	0	0	0	0	106.4	W103 S122 W124	W103-V137 HydrophobicContact CH2-CG2 4.34Å; W103-V137 HydrophobicContact CZ3-CG2 4.36Å; S122-V137 PolarHBondContact O-N 3.26Å; W124-V137 HydrophobicContact CH2-CG2 4.49Å; W124-V137 HydrophobicContact CZ3-CG2 3.74Å
138	S	77.1	Confident	90.8	Very high	187 Å²	187	108.9 Å²	108.9	100%	1.308	61%	0.613	S	S	*	*			trans	-96.6	0	-179.9	60	0	0	0	0	112

Retrieved 138 of 138 residues in 167.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).