A0A087XM67_POEFO Loading...

Heat shock protein, alpha-crystallin-related, b6

AlphaFold DB , UniProt , Accession A0A087XM67, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 142 aa.

						>A0A087XM67_POEFO|A0A087XM67
MDFIVPPSLTTGGIPWEKVLPPRLNGSHGYYNWSPSLLVPETESVSSAEVHCDEIGFTVQVDVKHFNPEDLLVKVVGDFVEVQGQHKEQKKEGHGFTTLQFNRRYRIPKGVNIMALESAVSPEGVLIISAPMLQIEGTRCLS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.3	Very low	44.1	Very low	236 Å²	236	148 Å²	148	100%	1.163	83%	0.827	S	S	*	*				0	94.7	0	-78.8	75.5	172.4	0	0	107
2	D	37.8	Very low	44.4	Very low	155 Å²	155	140.8 Å²	140.8	83%	0.829	81%	0.811	S	S	*	*			trans	-80.1	127.5	-177.1	-58.4	-73.8	0	0	0	110.1	I4	D2-I4 PolarHBondContact O-N 3.21Å
3	F	46	Very low	44.3	Very low	191 Å²	191	135.6 Å²	135.6	84%	0.838	81%	0.807	S	S	*	*			trans	-80.6	99	177.4	-159.5	-93.3	0	0	0	108.1	V5	F3-V5 HydrophobicContact CD1-CG2 4.24Å; F3-V5 PolarHBondContact O-N 2.84Å
4	I	39.5	Very low	45	Very low	153 Å²	153	136.9 Å²	136.9	79%	0.785	81%	0.806	S	S	*	*			trans	-70.6	103.7	174	-62	170.2	0	0	0	107.3	D2 P6	D2-I4 PolarHBondContact O-N 3.21Å; I4-P6 WeakPolarHBondContact O-CD 3.49Å
5	V	44.9	Very low	45	Very low	111 Å²	111	132.8 Å²	132.8	67%	0.673	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-69.2	121.6	169.7	-179	0	0	0	0	107.6	F3	F3-V5 HydrophobicContact CD1-CG2 4.24Å; F3-V5 PolarHBondContact O-N 2.84Å
6	P	45.4	Very low	45.6	Very low	100 Å²	100	136.9 Å²	136.9	65%	0.649	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-66.2	144.9	174.7	25.5	-30.5	0	0	0	110.1	I4 S8	I4-P6 WeakPolarHBondContact O-CD 3.49Å; P6-S8 PolarHBondContact O-N 3.38Å
7	P	42.9	Very low	46.1	Very low	116 Å²	116	137.1 Å²	137.1	75%	0.753	78%	0.775	S	S	*	*	P	Polyproline II helix	trans	-62.9	137.3	-177.6	26.2	-32.6	0	0	0	110.2	L9	P7-L9 PolarHBondContact O-N 3.06Å
8	S	49.4	Very low	46.5	Very low	112 Å²	112	139.3 Å²	139.3	78%	0.783	78%	0.775	S	S	*	*			trans	-42.3	117.4	176.8	51.1	0	0	0	0	111.9	P6 T10	P6-S8 PolarHBondContact O-N 3.38Å; S8-T10 PolarHBondContact O-N 2.82Å
9	L	44	Very low	47	Very low	175 Å²	175	137.7 Å²	137.7	92%	0.916	77%	0.769	S	S	*	*			trans	-68.6	114.3	173.3	-73.4	169.8	0	0	0	109.4	P7	P7-L9 PolarHBondContact O-N 3.06Å
10	T	42.3	Very low	47.2	Very low	122 Å²	122	137.7 Å²	137.7	75%	0.748	77%	0.766	S	S	*	*			trans	-67.8	145.8	167.6	54.1	0	0	0	0	110.5	S8 G12	S8-T10 PolarHBondContact O-N 2.82Å; T10-G12 PolarHBondContact O-N 2.8Å
11	T	47.3	Very low	47.2	Very low	157 Å²	157	136.3 Å²	136.3	96%	0.963	76%	0.763	S	S	*	*	S	Bend	trans	-50.3	48.7	-179.8	-56.8	0	0	0	0	117.6
12	G	47.4	Very low	47.1	Very low	61 Å²	61	130.1 Å²	130.1	63%	0.629	74%	0.741	S	S	*	*			trans	-132.1	117.6	171	0	0	0	0	0	109.8	T10	T10-G12 PolarHBondContact O-N 2.8Å
13	G	43.1	Very low	47.6	Very low	74 Å²	74	134.9 Å²	134.9	76%	0.763	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-52.3	154.7	-177.9	0	0	0	0	0	114.2	P15	G13-P15 WeakPolarHBondContact O-CD 3.42Å
14	I	55.3	Low	47.4	Very low	154 Å²	154	133.2 Å²	133.2	79%	0.79	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-63.8	122.4	-176.5	-52.8	170.9	0	0	0	109.4	W16	I14-W16 PolarHBondContact O-N 3.18Å
15	P	44.9	Very low	47.5	Very low	75 Å²	75	134.2 Å²	134.2	49%	0.487	75%	0.753	S	S	.	*	P	Polyproline II helix	trans	-70.6	124	177.5	-13.9	28.3	0	0	0	110.6	G13 E17 K18	G13-P15 WeakPolarHBondContact O-CD 3.42Å; P15-E17 PolarHBondContact O-N 3.22Å; P15-K18 PolarHBondContact O-N 3.45Å
16	W	53.7	Low	47	Very low	199 Å²	199	132.2 Å²	132.2	75%	0.754	76%	0.755	S	S	*	*	G	3₁₀ helix	trans	-63.7	-12.9	-173.4	60.2	-93.9	0	0	0	114.6	I14 K18	I14-W16 PolarHBondContact O-N 3.18Å; W16-K18 VanDerWaalsContact C-N 3.26Å; W16-K18 PolarHBondContact O-N 3.23Å
17	E	54.8	Low	47.1	Very low	140 Å²	140	132.7 Å²	132.7	65%	0.654	76%	0.761	S	S	*	*	G	3₁₀ helix	trans	-73.6	-13.8	177.2	-60.6	-170.8	135.7	0	0	113.6	P15	P15-E17 PolarHBondContact O-N 3.22Å
18	K	52.8	Low	47.3	Very low	177 Å²	177	135.8 Å²	135.8	77%	0.77	77%	0.765	S	S	*	*	G	3₁₀ helix	trans	-92	3	179.8	-67.7	-172	177.5	-178.7	0	114.8	P15 W16	P15-K18 PolarHBondContact O-N 3.45Å; W16-K18 VanDerWaalsContact C-N 3.26Å; W16-K18 PolarHBondContact O-N 3.23Å
19	V	56	Low	46.8	Very low	109 Å²	109	132.6 Å²	132.6	66%	0.661	75%	0.75	S	S	*	*			trans	-102.8	3.2	-175.5	-151.1	0	0	0	0	112.5
20	L	50.6	Low	46.9	Very low	137 Å²	137	135.4 Å²	135.4	72%	0.717	75%	0.75	S	S	*	*	S	Bend	trans	-81.9	130.4	174.9	-60.8	179.9	0	0	0	110.2
21	P	46.8	Very low	46.8	Very low	108 Å²	108	139 Å²	139	70%	0.701	75%	0.751	S	S	*	*	P	Polyproline II helix	trans	-64.6	145.9	176.2	25.9	-32.2	0	0	0	110.5	R23	P21-R23 PolarHBondContact O-N 3.07Å
22	P	43.9	Very low	46.4	Very low	107 Å²	107	139 Å²	139	70%	0.695	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-62.6	133.6	176.7	25.6	-31.4	0	0	0	109.6	L24	P22-L24 VanDerWaalsContact C-N 3.26Å; P22-L24 PolarHBondContact O-N 3.37Å
23	R	48.7	Very low	45.9	Very low	254 Å²	254	146.6 Å²	146.6	96%	0.958	76%	0.755	S	S	*	*			trans	-67.4	85.2	171.4	-66.8	-81.6	-178.9	176.2	-2.5	108.5	P21	P21-R23 PolarHBondContact O-N 3.07Å
24	L	41.6	Very low	46.1	Very low	157 Å²	157	145.4 Å²	145.4	82%	0.822	74%	0.735	S	S	*	*			trans	-94.6	119.4	169.5	-74.8	172.7	0	0	0	109.8	P22	P22-L24 VanDerWaalsContact C-N 3.26Å; P22-L24 PolarHBondContact O-N 3.37Å
25	N	41.1	Very low	45.2	Very low	173 Å²	173	143.3 Å²	143.3	93%	0.925	73%	0.731	S	S	*	*			trans	-78.3	122.7	173.7	-160.8	26.4	0	0	0	108.3
26	G	35.9	Very low	45.3	Very low	69 Å²	69	143.8 Å²	143.8	71%	0.711	74%	0.737	S	S	*	*			trans	134.6	100.6	160.6	0	0	0	0	0	118.4
27	S	46.4	Very low	45	Very low	110 Å²	110	141.4 Å²	141.4	77%	0.769	74%	0.738	S	S	*	*			trans	52.4	120.1	141	-157.3	0	0	0	0	122.4
28	H	47.3	Very low	44.5	Very low	181 Å²	181	142.5 Å²	142.5	84%	0.838	75%	0.747	S	S	*	*			trans	70.8	88.6	152	-83.4	94.1	0	0	0	119.4
29	G	38.8	Very low	43.9	Very low	46 Å²	46	138.7 Å²	138.7	47%	0.474	74%	0.739	S	S	.	*			trans	-163.9	117.8	149.3	0	0	0	0	0	108.3	Y31	G29-Y31 PolarHBondContact O-N 3.1Å
30	Y	46	Very low	43.2	Very low	234 Å²	234	138.2 Å²	138.2	92%	0.918	74%	0.738	S	S	*	*			trans	-67.5	81.8	174.3	-90.1	-94.4	0	0	0	109.4
31	Y	39.8	Very low	42.5	Very low	196 Å²	196	139.2 Å²	139.2	77%	0.769	74%	0.739	S	S	*	*			trans	-102.5	105.9	157.5	-50	-74.9	0	0	0	105.6	G29 W33	G29-Y31 PolarHBondContact O-N 3.1Å; Y31-W33 PolarHBondContact O-N 2.72Å
32	N	39.2	Very low	42.4	Very low	157 Å²	157	138.4 Å²	138.4	84%	0.84	73%	0.732	S	S	*	*			trans	-67.8	83.2	170.9	-168.5	39.3	0	0	0	107.6	S34	N32-S34 PolarHBondContact O-N 3.4Å; N32-S34 VanDerWaalsContact O-N 3.1Å
33	W	37.2	Very low	42.1	Very low	221 Å²	221	140.8 Å²	140.8	84%	0.837	73%	0.734	S	S	*	*			trans	-78.5	89.3	175.3	74.7	-69	0	0	0	107.8	Y31	Y31-W33 PolarHBondContact O-N 2.72Å
34	S	46.6	Very low	42	Very low	49 Å²	49	131.6 Å²	131.6	34%	0.343	71%	0.708	S	S	.	*			trans	-78.5	134.7	160.8	51.6	0	0	0	0	108.1	N32 S36	N32-S34 PolarHBondContact O-N 3.4Å; N32-S34 VanDerWaalsContact O-N 3.1Å; S34-S36 PolarHBondContact O-N 3.47Å
35	P	37.3	Very low	42.3	Very low	110 Å²	110	129.1 Å²	129.1	71%	0.714	70%	0.7	S	S	*	*	G	3₁₀ helix	trans	-70.6	7.3	177.8	29.5	-32.9	0	0	0	112.9
36	S	46.7	Very low	43.2	Very low	86 Å²	86	121.5 Å²	121.5	60%	0.601	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-82.2	-8.3	-177.3	-41.5	0	0	0	0	114	S34 L38	S34-S36 PolarHBondContact O-N 3.47Å; S36-L38 VanDerWaalsContact C-N 3.35Å; S36-L38 PolarHBondContact O-N 2.98Å
37	L	47.4	Very low	44.9	Very low	148 Å²	148	122.5 Å²	122.5	78%	0.775	66%	0.656	S	S	*	*	G	3₁₀ helix	trans	-92.4	16.1	-175.3	-65.2	178.3	0	0	0	114.8
38	L	45.4	Very low	46.7	Very low	163 Å²	163	119 Å²	119	85%	0.853	63%	0.633	S	S	*	*	G	3₁₀ helix	trans	-134.5	15.9	175	-110.7	149.4	0	0	0	113.8	S36	S36-L38 VanDerWaalsContact C-N 3.35Å; S36-L38 PolarHBondContact O-N 2.98Å
39	V	40.2	Very low	48.8	Very low	97 Å²	97	116.3 Å²	116.3	59%	0.588	62%	0.622	S	S	*	*	S	Bend	trans	-81.3	116.4	143.6	-171.3	0	0	0	0	102.5	E41	V39-E41 PolarHBondContact O-N 2.89Å
40	P	39.8	Very low	51.4	Low	100 Å²	100	118.1 Å²	118.1	65%	0.649	62%	0.623	S	S	*	*			trans	-49	118.9	161.9	21.7	-29.1	0	0	0	103.8	T42	P40-T42 PolarHBondContact O-N 3.41Å
41	E	36.3	Very low	53.6	Low	158 Å²	158	111.9 Å²	111.9	74%	0.738	60%	0.602	S	S	*	*			trans	-55	98	174.1	-161.1	171.2	110.1	0	0	103.4	V39 E43	V39-E41 PolarHBondContact O-N 2.89Å; E41-E43 HydrophobicContact CG-CG 4.05Å; E41-E43 PolarHBondContact O-N 2.95Å
42	T	44.3	Very low	56	Low	90 Å²	90	104.9 Å²	104.9	55%	0.552	58%	0.581	S	S	*	*			trans	-74.8	72.8	178	49.4	0	0	0	0	102.6	P40 S44 V45	P40-T42 PolarHBondContact O-N 3.41Å; T42-S44 PolarHBondContact O-N 3.34Å; T42-V45 HydrophobicContact CG2-CG2 4.05Å
43	E	37.6	Very low	58.4	Low	157 Å²	157	101.3 Å²	101.3	73%	0.734	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58	90.3	165.6	-77.3	-158.8	109.3	0	0	105	E41	E41-E43 HydrophobicContact CG-CG 4.05Å; E41-E43 PolarHBondContact O-N 2.95Å
44	S	46.4	Very low	60.7	Low	61 Å²	61	99.3 Å²	99.3	43%	0.427	56%	0.562	S	S	.	*	T	Hydrogen-bonded Turn	trans	46.3	103.8	-166.7	73	0	0	0	0	114.3	T42 S46	T42-S44 PolarHBondContact O-N 3.34Å; S44-S46 PolarHBondContact O-N 2.63Å
45	V	49.2	Very low	62.7	Low	106 Å²	106	103.8 Å²	103.8	64%	0.642	58%	0.581	S	S	*	*			trans	-56.4	95.2	135.6	-177.9	0	0	0	0	103.8	T42 S47	T42-V45 HydrophobicContact CG2-CG2 4.05Å; V45-S47 PolarHBondContact O-N 2.88Å
46	S	59.6	Low	65.4	Low	13 Å²	13	98.9 Å²	98.9	9%	0.091	55%	0.551	C	S	.	*			trans	-44.4	117.2	176.6	133.2	0	0	0	0	105.9	S44 A48 D62 R103	S44-S46 PolarHBondContact O-N 2.63Å; S46-A48 PolarHBondContact O-N 2.72Å; S46-D62 VanDerWaalsContact CB-O 3.26Å; S46-D62 WeakPolarHBondContact CB-O 3.31Å; S46-D62 PolarHBondContact OG-N 2.85Å; S46-D62 PolarHBondContact OG-O 3.01Å; S46-R103 VanDerWaalsContact CA-NH2 3.28Å; S46-R103 PolarHBondContact O-NH1 3.14Å; S46-R103 PolarHBondContact O-NH2 2.83Å; S46-R103 PolarHBondContact OG-NH1 2.83Å; S46-R103 PolarHBondContact OG-NH2 3.4Å
47	S	71.3	Confident	67.7	Low	90 Å²	90	94.9 Å²	94.9	63%	0.629	52%	0.522	S	S	*	.			trans	-70	137.6	-174.5	-164	0	0	0	0	106.7	V45	V45-S47 PolarHBondContact O-N 2.88Å
48	A	84.2	Confident	70.1	Confident	35 Å²	35	89.7 Å²	89.7	29%	0.289	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	129.1	172.7	0	0	0	0	0	109	S46 Q60 V61 Y105	S46-A48 PolarHBondContact O-N 2.72Å; A48-Q60 CarbonylContact C-O 3.5Å; A48-Q60 WeakPolarHBondContact CA-O 3.21Å; A48-V61 HydrophobicContact CB-CG2 4.38Å; A48-Y105 HydrophobicContact CB-CE1 3.64Å; A48-Y105 WeakPolarHBondContact CB-OH 3.43Å
49	E	92.5	Very high	72.6	Confident	126 Å²	126	81.9 Å²	81.9	59%	0.589	46%	0.456	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.9	129.1	176	-61.5	-176	134.6	0	0	108.4	V59 Q60	E49-V59 CarbonylContact O-C 3.57Å; E49-V59 WeakPolarHBondContact O-CA 3.43Å; E49-Q60 HydrophobicContact CB-CB 4.39Å; E49-Q60 PolarHBondContact N-O 2.83Å; E49-Q60 PolarHBondContact O-N 3.25Å
50	V	92.7	Very high	75.3	Confident	84 Å²	84	80.9 Å²	80.9	51%	0.509	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	125.6	179.2	-176.9	0	0	0	0	108.1	F57 T58 V59 Y105	V50-F57 HydrophobicContact CG1-CD2 4.5Å; V50-F57 HydrophobicContact CG1-CE2 3.8Å; V50-T58 WeakPolarHBondContact CA-O 3.23Å; V50-V59 HydrophobicContact CG1-CG2 4.3Å; V50-V59 HydrophobicContact CG2-CG1 4.29Å; V50-V59 HydrophobicContact CG2-CG2 4.26Å; V50-Y105 HydrophobicContact CG2-CD1 3.77Å; V50-Y105 HydrophobicContact CG2-CE1 4.19Å
51	H	91.6	Very high	78	Confident	102 Å²	102	76.1 Å²	76.1	47%	0.472	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	135.7	179.9	-175.7	70.5	0	0	0	109.4	D53 T58	H51-D53 IonicContact CE1-OD1 2.98Å; H51-D53 PolarHBondContact CE1-OD1 2.81Å; H51-D53 IonicContact CE1-OD2 3.55Å; H51-D53 PolarHBondContact CE1-OD2 2.73Å; H51-D53 IonicContact ND1-OD1 2.97Å; H51-D53 IonicContact NE2-OD1 3.72Å; H51-D53 PolarHBondContact NE2-OD1 3.02Å; H51-D53 IonicContact NE2-OD2 2.69Å; H51-D53 PolarHBondContact NE2-OD2 2.77Å; H51-T58 PolarHBondContact N-O 2.75Å; H51-T58 PolarHBondContact O-N 2.94Å
52	C	90.4	Very high	80.9	Confident	50 Å²	50	70.6 Å²	70.6	34%	0.338	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.3	110.4	178.2	-175.5	0	0	0	0	110	G56 F57 P108	C52-G56 WeakPolarHBondContact CA-O 3.49Å; C52-F57 HydrophobicContact CB-CD2 4.32Å; C52-P108 HydrophobicContact CB-CG 4.25Å
53	D	88.9	Confident	83.3	Confident	81 Å²	81	66.4 Å²	66.4	43%	0.433	36%	0.364	S	S	.	.			trans	-127.7	-175.4	-177.1	-74.8	10.7	0	0	0	109.8	H51 I55 G56	H51-D53 IonicContact CE1-OD1 2.98Å; H51-D53 PolarHBondContact CE1-OD1 2.81Å; H51-D53 IonicContact CE1-OD2 3.55Å; H51-D53 PolarHBondContact CE1-OD2 2.73Å; H51-D53 IonicContact ND1-OD1 2.97Å; H51-D53 IonicContact NE2-OD1 3.72Å; H51-D53 PolarHBondContact NE2-OD1 3.02Å; H51-D53 IonicContact NE2-OD2 2.69Å; H51-D53 PolarHBondContact NE2-OD2 2.77Å; D53-I55 PolarHBondContact O-N 3.23Å; D53-I55 VanDerWaalsContact O-N 3.16Å; D53-G56 PolarHBondContact N-O 2.83Å; D53-G56 PolarHBondContact O-N 2.93Å
54	E	86.3	Confident	86.1	Confident	180 Å²	180	64.4 Å²	64.4	84%	0.841	35%	0.353	S	S	*	.	S	Bend	trans	-59.6	-23.6	177.2	62	-172.3	-171.7	0	0	113.8
55	I	88.2	Confident	88.3	Confident	142 Å²	142	66 Å²	66	73%	0.728	35%	0.353	S	S	*	.	S	Bend	trans	-77.8	-42.2	179.4	-57.7	174.6	0	0	0	110.7	D53 M132	D53-I55 PolarHBondContact O-N 3.23Å; D53-I55 VanDerWaalsContact O-N 3.16Å; I55-M132 PolarHBondContact O-N 3.23Å; I55-M132 VanDerWaalsContact O-N 3.17Å
56	G	93.6	Very high	90.4	Very high	8 Å²	8	62.4 Å²	62.4	8%	0.082	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	170.1	-173.8	-171.8	0	0	0	0	0	114.6	C52 D53 A130	C52-G56 WeakPolarHBondContact CA-O 3.49Å; D53-G56 PolarHBondContact N-O 2.83Å; D53-G56 PolarHBondContact O-N 2.93Å; G56-A130 CarbonylContact C-O 3.52Å; G56-A130 VanDerWaalsContact CA-O 3.29Å; G56-A130 WeakPolarHBondContact CA-O 3.36Å
57	F	96.8	Very high	92	Very high	1 Å²	1	65.2 Å²	65.2	0%	0.004	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	129.6	178.4	167.7	-104.7	0	0	0	109.3	V50 C52 V59 V80 P108 V111 S129 A130	V50-F57 HydrophobicContact CG1-CD2 4.5Å; V50-F57 HydrophobicContact CG1-CE2 3.8Å; C52-F57 HydrophobicContact CB-CD2 4.32Å; F57-V59 HydrophobicContact CE1-CG2 3.69Å; F57-V59 HydrophobicContact CE2-CG2 3.87Å; F57-V59 HydrophobicContact CZ-CG2 3.24Å; F57-V80 HydrophobicContact CE1-CG2 4.25Å; F57-P108 HydrophobicContact CD2-CG 4Å; F57-P108 HydrophobicContact CE2-CG 4.41Å; F57-V111 HydrophobicContact CB-CG1 4.16Å; F57-V111 HydrophobicContact CB-CG2 3.6Å; F57-V111 HydrophobicContact CG-CG2 4.31Å; F57-S129 CarbonylContact O-C 3.54Å; F57-S129 VanDerWaalsContact O-CA 3.25Å; F57-S129 WeakPolarHBondContact O-CA 3.34Å; F57-A130 PolarHBondContact N-O 2.84Å; F57-A130 PolarHBondContact O-N 3.05Å
58	T	97.7	Very high	93	Very high	39 Å²	39	65 Å²	65	24%	0.239	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	135.1	179.4	-57.2	0	0	0	0	110.6	V50 H51 Q60 I127 I128	V50-T58 WeakPolarHBondContact CA-O 3.23Å; H51-T58 PolarHBondContact N-O 2.75Å; H51-T58 PolarHBondContact O-N 2.94Å; T58-Q60 HydrophobicContact CG2-CG 4.39Å; T58-I127 HydrophobicContact CG2-CG2 4.13Å; T58-I128 CarbonylContact C-O 3.56Å; T58-I128 VanDerWaalsContact CA-O 3.29Å; T58-I128 WeakPolarHBondContact CA-O 3.38Å
59	V	97.3	Very high	93.5	Very high	0 Å²	0	70 Å²	70	0%	0	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	132.8	171.2	-177.2	0	0	0	0	108.9	E49 V50 F57 V61 Y105 I127 I128	E49-V59 CarbonylContact O-C 3.57Å; E49-V59 WeakPolarHBondContact O-CA 3.43Å; V50-V59 HydrophobicContact CG1-CG2 4.3Å; V50-V59 HydrophobicContact CG2-CG1 4.29Å; V50-V59 HydrophobicContact CG2-CG2 4.26Å; F57-V59 HydrophobicContact CE1-CG2 3.69Å; F57-V59 HydrophobicContact CE2-CG2 3.87Å; F57-V59 HydrophobicContact CZ-CG2 3.24Å; V59-V61 HydrophobicContact CG1-CG2 3.79Å; V59-Y105 HydrophobicContact CG1-CD1 3.94Å; V59-Y105 HydrophobicContact CG1-CD2 3.76Å; V59-Y105 HydrophobicContact CG1-CE1 3.89Å; V59-Y105 HydrophobicContact CG1-CE2 3.67Å; V59-Y105 HydrophobicContact CG1-CG 3.87Å; V59-Y105 HydrophobicContact CG2-CD2 4.39Å; V59-Y105 HydrophobicContact CG2-CG 4.07Å; V59-I127 CarbonylContact O-C 3.58Å; V59-I127 WeakPolarHBondContact O-CA 3.43Å; V59-I128 HydrophobicContact CB-CB 4.35Å; V59-I128 PolarHBondContact N-O 2.81Å; V59-I128 PolarHBondContact O-N 2.69Å
60	Q	97.4	Very high	93.6	Very high	76 Å²	76	66 Å²	66	36%	0.355	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	133.2	172	-58.2	-172.1	48.6	0	0	109.5	A48 E49 T58 V125 L126 I127	A48-Q60 CarbonylContact C-O 3.5Å; A48-Q60 WeakPolarHBondContact CA-O 3.21Å; E49-Q60 HydrophobicContact CB-CB 4.39Å; E49-Q60 PolarHBondContact N-O 2.83Å; E49-Q60 PolarHBondContact O-N 3.25Å; T58-Q60 HydrophobicContact CG2-CG 4.39Å; Q60-V125 HydrophobicContact CB-CG1 4Å; Q60-L126 CarbonylContact C-O 3.55Å; Q60-L126 WeakPolarHBondContact CA-O 3.29Å; Q60-I127 HydrophobicContact CG-CG1 4.37Å
61	V	96.6	Very high	93.8	Very high	0 Å²	0	63.4 Å²	63.4	0%	0	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	124.3	-176.4	-169	0	0	0	0	109.4	A48 V59 V63 Y105 V125 L126	A48-V61 HydrophobicContact CB-CG2 4.38Å; V59-V61 HydrophobicContact CG1-CG2 3.79Å; V61-V63 HydrophobicContact CB-CG1 4.38Å; V61-V63 HydrophobicContact CG1-CG1 4.11Å; V61-V63 PolarHBondContact O-N 3.37Å; V61-Y105 HydrophobicContact CG2-CE2 3.93Å; V61-Y105 VanDerWaalsContact CG2-OH 3.27Å; V61-Y105 WeakPolarHBondContact CG2-OH 3.49Å; V61-V125 WeakPolarHBondContact O-CA 2.86Å; V61-L126 HydrophobicContact CB-CB 4.32Å; V61-L126 PolarHBondContact N-O 3.06Å; V61-L126 PolarHBondContact O-N 2.97Å
62	D	95.9	Very high	94.1	Very high	42 Å²	42	62.9 Å²	62.9	23%	0.225	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.2	119.8	170	-176.6	-44.9	0	0	0	109.4	S46 K64	S46-D62 VanDerWaalsContact CB-O 3.26Å; S46-D62 WeakPolarHBondContact CB-O 3.31Å; S46-D62 PolarHBondContact OG-N 2.85Å; S46-D62 PolarHBondContact OG-O 3.01Å; D62-K64 WeakPolarHBondContact OD1-CD 3.46Å; D62-K64 WeakPolarHBondContact OD1-CE 3.4Å; D62-K64 VanDerWaalsContact OD1-CG 3.28Å; D62-K64 WeakPolarHBondContact OD1-CG 3.28Å; D62-K64 PolarHBondContact OD1-N 2.92Å; D62-K64 IonicContact OD1-NZ 3.1Å; D62-K64 WeakPolarHBondContact OD2-CE 3.34Å; D62-K64 IonicContact OD2-NZ 2.93Å; D62-K64 PolarHBondContact OD2-NZ 2.77Å
63	V	96.1	Very high	94.5	Very high	2 Å²	2	62.4 Å²	62.4	1%	0.012	32%	0.318	C	S	.	.			trans	-130.1	21.8	-179.6	-63.8	0	0	0	0	111.6	V61 H65 F66 L71 F101 V120 G124 L126	V61-V63 HydrophobicContact CB-CG1 4.38Å; V61-V63 HydrophobicContact CG1-CG1 4.11Å; V61-V63 PolarHBondContact O-N 3.37Å; V63-H65 PolarHBondContact O-N 2.67Å; V63-F66 PolarHBondContact O-N 2.67Å; V63-L71 HydrophobicContact CB-CD1 3.98Å; V63-L71 HydrophobicContact CB-CD2 4.29Å; V63-L71 HydrophobicContact CG1-CD1 4.13Å; V63-L71 HydrophobicContact CG1-CD2 4.03Å; V63-L71 HydrophobicContact CG2-CD1 3.89Å; V63-F101 HydrophobicContact CG1-CE1 4.38Å; V63-F101 HydrophobicContact CG1-CZ 3.99Å; V63-V120 HydrophobicContact CG2-CG1 4.05Å; V63-G124 CarbonylContact C-O 3.53Å; V63-G124 VanDerWaalsContact CG2-O 3.28Å; V63-G124 WeakPolarHBondContact CG2-O 3.37Å; V63-G124 PolarHBondContact N-O 3Å; V63-L126 HydrophobicContact CG1-CB 3.92Å; V63-L126 HydrophobicContact CG2-CB 3.88Å
64	K	94.6	Very high	94.8	Very high	114 Å²	114	62.1 Å²	62.1	50%	0.496	31%	0.313	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.7	-14.8	-173.3	72.8	-162.2	164.5	-150.2	0	115.5	D62 G124	D62-K64 WeakPolarHBondContact OD1-CD 3.46Å; D62-K64 WeakPolarHBondContact OD1-CE 3.4Å; D62-K64 VanDerWaalsContact OD1-CG 3.28Å; D62-K64 WeakPolarHBondContact OD1-CG 3.28Å; D62-K64 PolarHBondContact OD1-N 2.92Å; D62-K64 IonicContact OD1-NZ 3.1Å; D62-K64 WeakPolarHBondContact OD2-CE 3.34Å; D62-K64 IonicContact OD2-NZ 2.93Å; D62-K64 PolarHBondContact OD2-NZ 2.77Å; K64-G124 PolarHBondContact N-O 3.46Å
65	H	92.6	Very high	95.4	Very high	95 Å²	95	56.5 Å²	56.5	44%	0.44	29%	0.291	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98.3	7.8	178	-57.5	-64.1	0	0	0	113.4	V63 L99	V63-H65 PolarHBondContact O-N 2.67Å; H65-L99 HydrophobicContact CB-CD1 3.69Å
66	F	94.3	Very high	95.8	Very high	31 Å²	31	52.6 Å²	52.6	14%	0.136	27%	0.273	C	S	.	.	S	Bend	trans	-126.4	142.5	-179.2	-63.9	-93.3	0	0	0	109.4	V63 D70 L71 G84 H86 L99 F101	V63-F66 PolarHBondContact O-N 2.67Å; F66-D70 HydrophobicContact CB-CB 4.48Å; F66-D70 HydrophobicContact CD1-CB 4.36Å; F66-L71 HydrophobicContact CB-CD2 3.8Å; F66-L71 HydrophobicContact CB-CG 4.19Å; F66-L71 HydrophobicContact CD1-CD2 4.47Å; F66-L71 HydrophobicContact CG-CD2 4.09Å; F66-G84 VanDerWaalsContact CE1-C 3.48Å; F66-H86 HydrophobicContact CD1-CB 3.68Å; F66-H86 HydrophobicContact CE1-CB 3.91Å; F66-L99 HydrophobicContact CE1-CB 3.98Å; F66-L99 HydrophobicContact CZ-CB 3.67Å; F66-F101 HydrophobicContact CD1-CE1 4.29Å; F66-F101 HydrophobicContact CD2-CD1 4.19Å; F66-F101 AromaticContact CD2-CE1 3.77Å; F66-F101 HydrophobicContact CD2-CE1 3.77Å; F66-F101 AromaticContact CE1-CD1 3.96Å; F66-F101 HydrophobicContact CE1-CD1 3.96Å; F66-F101 HydrophobicContact CE1-CE1 4.13Å; F66-F101 AromaticContact CE2-CD1 3.52Å; F66-F101 HydrophobicContact CE2-CD1 3.52Å; F66-F101 AromaticContact CE2-CE1 3.59Å; F66-F101 HydrophobicContact CE2-CE1 3.59Å; F66-F101 HydrophobicContact CG-CE1 4.14Å; F66-F101 AromaticContact CZ-CD1 3.41Å; F66-F101 HydrophobicContact CZ-CD1 3.41Å; F66-F101 VanDerWaalsContact CZ-CD1 3.41Å; F66-F101 AromaticContact CZ-CE1 3.8Å; F66-F101 HydrophobicContact CZ-CE1 3.8Å
67	N	92.3	Very high	95.8	Very high	71 Å²	71	55 Å²	55	38%	0.38	30%	0.299	S	S	.	.			trans	-78.7	156.2	167.4	-59.8	-25.1	0	0	0	109.7	E69 D70	N67-E69 HydrophobicContact CB-CG 4.21Å; N67-E69 WeakPolarHBondContact CB-OE1 3.38Å; N67-E69 VanDerWaalsContact CB-OE2 3.28Å; N67-E69 WeakPolarHBondContact CB-OE2 3.32Å; N67-E69 PolarHBondContact ND2-OE1 2.6Å; N67-E69 PolarHBondContact O-N 3.46Å; N67-E69 VanDerWaalsContact O-N 3.16Å; N67-D70 WeakPolarHBondContact CB-OD2 3.42Å; N67-D70 PolarHBondContact N-OD2 2.75Å; N67-D70 WeakPolarHBondContact O-CB 3.47Å; N67-D70 PolarHBondContact O-N 3.41Å
68	P	92.3	Very high	95.7	Very high	87 Å²	87	59.8 Å²	59.8	57%	0.565	32%	0.324	S	S	*	.	G	3₁₀ helix	trans	-53.8	-35.3	177	-27.5	36.1	0	0	0	114	D70 L71	P68-D70 VanDerWaalsContact C-N 3.28Å; P68-D70 PolarHBondContact O-N 2.93Å; P68-L71 PolarHBondContact O-N 3.39Å
69	E	94.9	Very high	95.7	Very high	140 Å²	140	60.9 Å²	60.9	65%	0.654	33%	0.326	S	S	*	.	G	3₁₀ helix	trans	-70.7	-19.2	178.1	65.8	-84.8	-168.5	0	0	114.6	N67 L71	N67-E69 HydrophobicContact CB-CG 4.21Å; N67-E69 WeakPolarHBondContact CB-OE1 3.38Å; N67-E69 VanDerWaalsContact CB-OE2 3.28Å; N67-E69 WeakPolarHBondContact CB-OE2 3.32Å; N67-E69 PolarHBondContact ND2-OE1 2.6Å; N67-E69 PolarHBondContact O-N 3.46Å; N67-E69 VanDerWaalsContact O-N 3.16Å; E69-L71 VanDerWaalsContact C-N 3.28Å
70	D	95.2	Very high	95.8	Very high	42 Å²	42	60.9 Å²	60.9	23%	0.225	33%	0.326	C	S	.	.	G	3₁₀ helix	trans	-84.7	-6.7	177.6	-63.4	-39.6	0	0	0	112.4	F66 N67 P68 G84 Q85 H86	F66-D70 HydrophobicContact CB-CB 4.48Å; F66-D70 HydrophobicContact CD1-CB 4.36Å; N67-D70 WeakPolarHBondContact CB-OD2 3.42Å; N67-D70 PolarHBondContact N-OD2 2.75Å; N67-D70 WeakPolarHBondContact O-CB 3.47Å; N67-D70 PolarHBondContact O-N 3.41Å; P68-D70 VanDerWaalsContact C-N 3.28Å; P68-D70 PolarHBondContact O-N 2.93Å; D70-G84 WeakPolarHBondContact O-CA 3.07Å; D70-Q85 VanDerWaalsContact CB-O 3.32Å; D70-Q85 WeakPolarHBondContact CB-O 3.07Å; D70-Q85 PolarHBondContact O-N 2.79Å; D70-H86 IonicContact OD2-CE1 3.46Å; D70-H86 IonicContact OD2-CG 3.6Å; D70-H86 IonicContact OD2-ND1 3.36Å; D70-H86 PolarHBondContact OD2-ND1 3.27Å
71	L	97.2	Very high	95.8	Very high	29 Å²	29	58.2 Å²	58.2	15%	0.152	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	135.7	-175.6	-61.3	175.1	0	0	0	111.4	V63 F66 P68 E69 Q83 F101 V120	V63-L71 HydrophobicContact CB-CD1 3.98Å; V63-L71 HydrophobicContact CB-CD2 4.29Å; V63-L71 HydrophobicContact CG1-CD1 4.13Å; V63-L71 HydrophobicContact CG1-CD2 4.03Å; V63-L71 HydrophobicContact CG2-CD1 3.89Å; F66-L71 HydrophobicContact CB-CD2 3.8Å; F66-L71 HydrophobicContact CB-CG 4.19Å; F66-L71 HydrophobicContact CD1-CD2 4.47Å; F66-L71 HydrophobicContact CG-CD2 4.09Å; P68-L71 PolarHBondContact O-N 3.39Å; E69-L71 VanDerWaalsContact C-N 3.28Å; L71-Q83 CarbonylContact C-O 3.55Å; L71-Q83 WeakPolarHBondContact CA-O 3.28Å; L71-F101 HydrophobicContact CD2-CE1 3.94Å; L71-F101 HydrophobicContact CD2-CZ 3.88Å; L71-V120 HydrophobicContact CD1-CG2 4.01Å
72	L	97.9	Very high	95.8	Very high	91 Å²	91	58.2 Å²	58.2	48%	0.476	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	119.1	172.3	178.5	66	0	0	0	109.7	K74 V82 Q83	L72-K74 HydrophobicContact CD2-CD 4.47Å; L72-V82 CarbonylContact O-C 3.53Å; L72-V82 WeakPolarHBondContact O-CA 3.41Å; L72-Q83 HydrophobicContact CB-CB 4.28Å; L72-Q83 PolarHBondContact N-O 3.26Å; L72-Q83 PolarHBondContact O-N 3.43Å
73	V	97.8	Very high	95.9	Very high	40 Å²	40	58 Å²	58	24%	0.242	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	128.8	171	-175.2	0	0	0	0	108.5	V80 E81 V82 L126 I128	V73-V80 HydrophobicContact CG1-CG1 3.76Å; V73-E81 WeakPolarHBondContact CA-O 3.25Å; V73-V82 HydrophobicContact CG2-CG1 4.45Å; V73-V82 HydrophobicContact CG2-CG2 4.48Å; V73-L126 HydrophobicContact CG2-CD1 4.32Å; V73-L126 HydrophobicContact CG2-CD2 3.81Å; V73-I128 HydrophobicContact CG1-CD1 4.08Å; V73-I128 HydrophobicContact CG1-CG1 4.25Å; V73-I128 HydrophobicContact CG2-CD1 4.43Å
74	K	97	Very high	95.9	Very high	75 Å²	75	57.9 Å²	57.9	33%	0.326	31%	0.311	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	152	177.5	59.4	176.3	-177.2	165.5	0	111.3	L72 V76 E81 Q83	L72-K74 HydrophobicContact CD2-CD 4.47Å; K74-V76 HydrophobicContact CD-CG2 3.84Å; K74-V76 HydrophobicContact CG-CG2 4.01Å; K74-E81 WeakPolarHBondContact CE-OE2 3.32Å; K74-E81 HydrophobicContact CG-CB 4Å; K74-E81 PolarHBondContact N-O 2.86Å; K74-E81 IonicContact NZ-OE2 3.75Å; K74-E81 PolarHBondContact NZ-OE2 3.16Å; K74-E81 PolarHBondContact O-N 2.78Å; K74-Q83 VanDerWaalsContact CE-NE2 3.32Å
75	V	97.5	Very high	96	Very high	61 Å²	61	57.5 Å²	57.5	37%	0.37	31%	0.311	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	127.3	170.4	-178.8	0	0	0	0	108.9	F79 I107 I113 L116	V75-F79 CarbonylContact C-O 3.59Å; V75-F79 WeakPolarHBondContact CA-O 3.18Å; V75-I107 HydrophobicContact CG1-CD1 3.86Å; V75-I107 HydrophobicContact CG2-CD1 4.47Å; V75-I113 HydrophobicContact CG1-CG2 3.98Å; V75-I113 HydrophobicContact CG2-CG2 4.21Å; V75-L116 HydrophobicContact CG2-CD2 4.32Å
76	V	96.5	Very high	96.1	Very high	60 Å²	60	54.1 Å²	54.1	36%	0.364	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	103.1	178.2	-176.4	0	0	0	0	108.8	K74 D78 F79 E81	K74-V76 HydrophobicContact CD-CG2 3.84Å; K74-V76 HydrophobicContact CG-CG2 4.01Å; V76-D78 PolarHBondContact O-N 3.41Å; V76-F79 PolarHBondContact N-O 2.96Å; V76-F79 PolarHBondContact O-N 2.81Å; V76-E81 HydrophobicContact CB-CG 4.16Å; V76-E81 HydrophobicContact CG2-CG 4Å
77	G	94.7	Very high	96	Very high	60 Å²	60	59 Å²	59	62%	0.619	32%	0.316	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.6	-127.9	-171.1	0	0	0	0	0	110.7	F79	G77-F79 VanDerWaalsContact C-N 3.26Å; G77-F79 PolarHBondContact O-N 2.98Å
78	D	95.2	Very high	95.9	Very high	100 Å²	100	59.8 Å²	59.8	54%	0.535	32%	0.317	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.6	25.9	179.2	-57.6	-27.3	0	0	0	113	V76 R106 I107	V76-D78 PolarHBondContact O-N 3.41Å; D78-R106 CarbonylContact O-C 3.58Å; D78-R106 WeakPolarHBondContact O-CA 3.26Å; D78-I107 PolarHBondContact O-N 2.78Å
79	F	97.4	Very high	95.8	Very high	63 Å²	63	61.8 Å²	61.8	28%	0.276	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.8	142.1	-176.7	-64.6	-95.4	0	0	0	112	V75 V76 G77 R104 Y105 R106	V75-F79 CarbonylContact C-O 3.59Å; V75-F79 WeakPolarHBondContact CA-O 3.18Å; V76-F79 PolarHBondContact N-O 2.96Å; V76-F79 PolarHBondContact O-N 2.81Å; G77-F79 VanDerWaalsContact C-N 3.26Å; G77-F79 PolarHBondContact O-N 2.98Å; F79-R104 HydrophobicContact CD1-CB 4.18Å; F79-Y105 CarbonylContact C-O 3.51Å; F79-Y105 VanDerWaalsContact CA-O 3.25Å; F79-Y105 WeakPolarHBondContact CA-O 3.4Å; F79-R106 HydrophobicContact CD1-CB 4.05Å; F79-R106 HydrophobicContact CE1-CB 3.76Å; F79-R106 HydrophobicContact CE1-CG 4.09Å; F79-R106 HydrophobicContact CZ-CB 4.44Å; F79-R106 HydrophobicContact CZ-CG 4.28Å
80	V	97.8	Very high	95.4	Very high	0 Å²	0	60.4 Å²	60.4	0%	0	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.4	123.1	156.7	-175.3	0	0	0	0	108	F57 V73 V82 R104 Y105 I107 L116 I128	F57-V80 HydrophobicContact CE1-CG2 4.25Å; V73-V80 HydrophobicContact CG1-CG1 3.76Å; V80-V82 HydrophobicContact CG1-CG2 4.41Å; V80-R104 CarbonylContact O-C 3.57Å; V80-R104 VanDerWaalsContact O-CA 3.32Å; V80-R104 WeakPolarHBondContact O-CA 3.48Å; V80-Y105 PolarHBondContact N-O 2.86Å; V80-Y105 PolarHBondContact O-N 2.85Å; V80-I107 HydrophobicContact CG2-CD1 3.71Å; V80-I107 HydrophobicContact CG2-CG1 3.73Å; V80-L116 HydrophobicContact CG2-CD1 3.76Å; V80-I128 HydrophobicContact CG1-CD1 4.02Å; V80-I128 HydrophobicContact CG1-CG2 4.29Å; V80-I128 HydrophobicContact CG2-CG2 4.48Å
81	E	97.8	Very high	94.9	Very high	19 Å²	19	68.5 Å²	68.5	9%	0.089	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	129.7	170.9	-46.8	-162.4	157.6	0	0	110.1	V73 K74 V76 R103 R104	V73-E81 WeakPolarHBondContact CA-O 3.25Å; K74-E81 WeakPolarHBondContact CE-OE2 3.32Å; K74-E81 HydrophobicContact CG-CB 4Å; K74-E81 PolarHBondContact N-O 2.86Å; K74-E81 IonicContact NZ-OE2 3.75Å; K74-E81 PolarHBondContact NZ-OE2 3.16Å; K74-E81 PolarHBondContact O-N 2.78Å; V76-E81 HydrophobicContact CB-CG 4.16Å; V76-E81 HydrophobicContact CG2-CG 4Å; E81-R103 CarbonylContact C-O 3.57Å; E81-R103 VanDerWaalsContact CA-O 3.28Å; E81-R103 WeakPolarHBondContact CA-O 3.39Å; E81-R104 HydrophobicContact CB-CG 4.34Å; E81-R104 HydrophobicContact CG-CG 3.91Å; E81-R104 WeakPolarHBondContact OE1-CD 3.43Å; E81-R104 IonicContact OE1-CZ 3.72Å; E81-R104 IonicContact OE1-NE 2.75Å; E81-R104 PolarHBondContact OE1-NE 3.32Å; E81-R104 IonicContact OE1-NH2 3.93Å
82	V	97.9	Very high	94.3	Very high	0 Å²	0	76.1 Å²	76.1	0%	0	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	124.6	173.5	-172.3	0	0	0	0	108.1	L72 V73 V80 F101 N102 R103 Y105 L126 I128	L72-V82 CarbonylContact O-C 3.53Å; L72-V82 WeakPolarHBondContact O-CA 3.41Å; V73-V82 HydrophobicContact CG2-CG1 4.45Å; V73-V82 HydrophobicContact CG2-CG2 4.48Å; V80-V82 HydrophobicContact CG1-CG2 4.41Å; V82-F101 HydrophobicContact CB-CE2 4.09Å; V82-F101 HydrophobicContact CG1-CE2 3.59Å; V82-F101 HydrophobicContact CG1-CZ 3.8Å; V82-N102 CarbonylContact O-C 3.52Å; V82-N102 WeakPolarHBondContact O-CA 3.37Å; V82-R103 PolarHBondContact N-O 2.97Å; V82-R103 PolarHBondContact O-N 2.91Å; V82-Y105 HydrophobicContact CG2-CD2 4.31Å; V82-Y105 HydrophobicContact CG2-CE2 3.89Å; V82-L126 HydrophobicContact CG1-CD2 3.51Å; V82-L126 HydrophobicContact CG2-CD2 4.22Å; V82-I128 HydrophobicContact CG2-CD1 3.5Å
83	Q	97.6	Very high	93.6	Very high	38 Å²	38	74.1 Å²	74.1	18%	0.178	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	137.1	176.1	-40.8	-167	-4.8	0	0	108.7	L71 L72 K74 F101 N102	L71-Q83 CarbonylContact C-O 3.55Å; L71-Q83 WeakPolarHBondContact CA-O 3.28Å; L72-Q83 HydrophobicContact CB-CB 4.28Å; L72-Q83 PolarHBondContact N-O 3.26Å; L72-Q83 PolarHBondContact O-N 3.43Å; K74-Q83 VanDerWaalsContact CE-NE2 3.32Å; Q83-F101 WeakPolarHBondContact CA-O 3.47Å; Q83-N102 WeakPolarHBondContact CG-ND2 3.36Å; Q83-N102 PolarHBondContact NE2-ND2 2.95Å
84	G	96.9	Very high	93	Very high	0 Å²	0	81.8 Å²	81.8	0%	0	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	135	169.6	0	0	0	0	0	109.5	F66 D70 Q100 F101	F66-G84 VanDerWaalsContact CE1-C 3.48Å; D70-G84 WeakPolarHBondContact O-CA 3.07Å; G84-Q100 CarbonylContact O-C 3.58Å; G84-Q100 VanDerWaalsContact O-CA 3.23Å; G84-Q100 WeakPolarHBondContact O-CA 3.28Å; G84-F101 PolarHBondContact N-O 2.82Å; G84-F101 PolarHBondContact O-N 2.96Å
85	Q	95.8	Very high	92.5	Very high	106 Å²	106	79.4 Å²	79.4	50%	0.495	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.7	103.6	175.6	-73.8	-179.4	56.6	0	0	109.8	D70 L99 Q100	D70-Q85 VanDerWaalsContact CB-O 3.32Å; D70-Q85 WeakPolarHBondContact CB-O 3.07Å; D70-Q85 PolarHBondContact O-N 2.79Å; Q85-L99 WeakPolarHBondContact CA-O 3.39Å; Q85-Q100 HydrophobicContact CG-CB 4.42Å; Q85-Q100 HydrophobicContact CG-CG 3.83Å
86	H	94.8	Very high	92	Very high	23 Å²	23	82.1 Å²	82.1	11%	0.106	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	137.9	-179.3	-176	72.7	0	0	0	110.7	F66 D70 E88 T98 L99	F66-H86 HydrophobicContact CD1-CB 3.68Å; F66-H86 HydrophobicContact CE1-CB 3.91Å; D70-H86 IonicContact OD2-CE1 3.46Å; D70-H86 IonicContact OD2-CG 3.6Å; D70-H86 IonicContact OD2-ND1 3.36Å; D70-H86 PolarHBondContact OD2-ND1 3.27Å; H86-E88 WeakPolarHBondContact NE2-CB 3.27Å; H86-E88 IonicContact NE2-OE2 2.77Å; H86-T98 CarbonylContact O-C 3.49Å; H86-T98 VanDerWaalsContact O-CA 3.31Å; H86-T98 WeakPolarHBondContact O-CA 3.49Å; H86-L99 HydrophobicContact CB-CB 4.49Å; H86-L99 PolarHBondContact N-O 2.83Å; H86-L99 PolarHBondContact O-N 3.23Å
87	K	91.9	Very high	91.5	Very high	133 Å²	133	81.3 Å²	81.3	58%	0.578	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-135.2	111.8	173.2	-177.9	179.7	177.9	-176.3	0	109.9	F96 T97	K87-F96 HydrophobicContact CD-CD1 4.45Å; K87-F96 VanDerWaalsContact CE-CD1 3.5Å; K87-F96 VanDerWaalsContact CE-CG 3.46Å; K87-F96 HydrophobicContact CG-CB 4.29Å; K87-F96 HydrophobicContact CG-CD1 4.2Å; K87-F96 HydrophobicContact CG-CG 4.49Å; K87-T97 WeakPolarHBondContact CA-O 3.16Å
88	E	89.8	Confident	91.2	Very high	89 Å²	89	82.8 Å²	82.8	42%	0.416	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	148.4	175.6	54.8	171.7	-164.9	0	0	111.6	H86 F96 T97	H86-E88 WeakPolarHBondContact NE2-CB 3.27Å; H86-E88 IonicContact NE2-OE2 2.77Å; E88-F96 CarbonylContact O-C 3.57Å; E88-F96 WeakPolarHBondContact O-CA 3.28Å; E88-T97 PolarHBondContact N-O 2.85Å; E88-T97 PolarHBondContact O-N 3.21Å
89	Q	89.9	Confident	91.1	Very high	129 Å²	129	81.1 Å²	81.1	60%	0.603	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79	134.7	169.5	-171.3	174.3	15.7	0	0	109.3	K91 F96	Q89-K91 PolarHBondContact O-N 2.84Å; Q89-F96 HydrophobicContact CB-CD1 4.17Å; Q89-F96 HydrophobicContact CB-CE1 4.13Å; Q89-F96 HydrophobicContact CG-CE1 4.32Å
90	K	87.8	Confident	90.9	Very high	111 Å²	111	84.7 Å²	84.7	48%	0.483	42%	0.417	S	S	.	.			trans	-63.6	134.1	175.4	-68.4	-173.7	180	-171.1	0	109.6	E92 G95	K90-E92 PolarHBondContact O-N 3.33Å; K90-G95 PolarHBondContact N-O 2.8Å
91	K	84.5	Confident	90.8	Very high	211 Å²	211	86.1 Å²	86.1	92%	0.917	42%	0.424	S	S	*	.	S	Bend	trans	-65.3	-28	179.2	-66.2	-179.1	-178.7	173.8	0	112.6	Q89	Q89-K91 PolarHBondContact O-N 2.84Å
92	E	85.1	Confident	90.7	Very high	189 Å²	189	89.2 Å²	89.2	88%	0.883	44%	0.441	S	S	*	.	S	Bend	trans	-110.2	87.6	-178.4	-62.1	-174.1	-173.6	0	0	110.3	K90	K90-E92 PolarHBondContact O-N 3.33Å
93	G	83.1	Confident	90.6	Very high	49 Å²	49	91.4 Å²	91.4	51%	0.505	45%	0.449	S	S	.	.	S	Bend	trans	99.2	-155.7	168.1	0	0	0	0	0	116
94	H	83.9	Confident	90.5	Very high	202 Å²	202	95.8 Å²	95.8	94%	0.935	46%	0.464	S	S	*	.	S	Bend	trans	-94.1	109.8	-176.7	-61.2	-74	0	0	0	110.1
95	G	87.1	Confident	90.5	Very high	24 Å²	24	96.8 Å²	96.8	25%	0.247	47%	0.468	C	S	.	.			trans	167.8	166.9	174.7	0	0	0	0	0	113.6	K90	K90-G95 PolarHBondContact N-O 2.8Å
96	F	87.2	Confident	90.5	Very high	119 Å²	119	100.2 Å²	100.2	52%	0.522	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	148.1	174.8	-60.7	-84.3	0	0	0	110.2	K87 E88 Q89	K87-F96 HydrophobicContact CD-CD1 4.45Å; K87-F96 VanDerWaalsContact CE-CD1 3.5Å; K87-F96 VanDerWaalsContact CE-CG 3.46Å; K87-F96 HydrophobicContact CG-CB 4.29Å; K87-F96 HydrophobicContact CG-CD1 4.2Å; K87-F96 HydrophobicContact CG-CG 4.49Å; E88-F96 CarbonylContact O-C 3.57Å; E88-F96 WeakPolarHBondContact O-CA 3.28Å; Q89-F96 HydrophobicContact CB-CD1 4.17Å; Q89-F96 HydrophobicContact CB-CE1 4.13Å; Q89-F96 HydrophobicContact CG-CE1 4.32Å
97	T	85	Confident	90.6	Very high	43 Å²	43	99.6 Å²	99.6	26%	0.264	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	134.7	159.8	-55.3	0	0	0	0	107.1	K87 E88 L99	K87-T97 WeakPolarHBondContact CA-O 3.16Å; E88-T97 PolarHBondContact N-O 2.85Å; E88-T97 PolarHBondContact O-N 3.21Å; T97-L99 HydrophobicContact CG2-CD2 4.41Å; T97-L99 HydrophobicContact CG2-CG 4.3Å
98	T	89.8	Confident	90.7	Very high	91 Å²	91	95.3 Å²	95.3	56%	0.558	46%	0.459	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.9	122.9	174.7	-58.8	0	0	0	0	108.4	H86	H86-T98 CarbonylContact O-C 3.49Å; H86-T98 VanDerWaalsContact O-CA 3.31Å; H86-T98 WeakPolarHBondContact O-CA 3.49Å
99	L	91.8	Very high	90.9	Very high	64 Å²	64	101 Å²	101	34%	0.335	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	134.8	176.8	-61	177.2	0	0	0	108.4	H65 F66 Q85 H86 T97	H65-L99 HydrophobicContact CB-CD1 3.69Å; F66-L99 HydrophobicContact CE1-CB 3.98Å; F66-L99 HydrophobicContact CZ-CB 3.67Å; Q85-L99 WeakPolarHBondContact CA-O 3.39Å; H86-L99 HydrophobicContact CB-CB 4.49Å; H86-L99 PolarHBondContact N-O 2.83Å; H86-L99 PolarHBondContact O-N 3.23Å; T97-L99 HydrophobicContact CG2-CD2 4.41Å; T97-L99 HydrophobicContact CG2-CG 4.3Å
100	Q	94.4	Very high	91	Very high	138 Å²	138	96.7 Å²	96.7	65%	0.645	47%	0.473	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-143.3	137.1	176.7	178.6	171	1.3	0	0	110.4	G84 Q85	G84-Q100 CarbonylContact O-C 3.58Å; G84-Q100 VanDerWaalsContact O-CA 3.23Å; G84-Q100 WeakPolarHBondContact O-CA 3.28Å; Q85-Q100 HydrophobicContact CG-CB 4.42Å; Q85-Q100 HydrophobicContact CG-CG 3.83Å
101	F	94.8	Very high	91.4	Very high	31 Å²	31	91.8 Å²	91.8	14%	0.136	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.8	156.6	167.5	76.1	-91	0	0	0	112	V63 F66 L71 V82 Q83 G84 R103	V63-F101 HydrophobicContact CG1-CE1 4.38Å; V63-F101 HydrophobicContact CG1-CZ 3.99Å; F66-F101 HydrophobicContact CD1-CE1 4.29Å; F66-F101 HydrophobicContact CD2-CD1 4.19Å; F66-F101 AromaticContact CD2-CE1 3.77Å; F66-F101 HydrophobicContact CD2-CE1 3.77Å; F66-F101 AromaticContact CE1-CD1 3.96Å; F66-F101 HydrophobicContact CE1-CD1 3.96Å; F66-F101 HydrophobicContact CE1-CE1 4.13Å; F66-F101 AromaticContact CE2-CD1 3.52Å; F66-F101 HydrophobicContact CE2-CD1 3.52Å; F66-F101 AromaticContact CE2-CE1 3.59Å; F66-F101 HydrophobicContact CE2-CE1 3.59Å; F66-F101 HydrophobicContact CG-CE1 4.14Å; F66-F101 AromaticContact CZ-CD1 3.41Å; F66-F101 HydrophobicContact CZ-CD1 3.41Å; F66-F101 VanDerWaalsContact CZ-CD1 3.41Å; F66-F101 AromaticContact CZ-CE1 3.8Å; F66-F101 HydrophobicContact CZ-CE1 3.8Å; L71-F101 HydrophobicContact CD2-CE1 3.94Å; L71-F101 HydrophobicContact CD2-CZ 3.88Å; V82-F101 HydrophobicContact CB-CE2 4.09Å; V82-F101 HydrophobicContact CG1-CE2 3.59Å; V82-F101 HydrophobicContact CG1-CZ 3.8Å; Q83-F101 WeakPolarHBondContact CA-O 3.47Å; G84-F101 PolarHBondContact N-O 2.82Å; G84-F101 PolarHBondContact O-N 2.96Å; F101-R103 HydrophobicContact CD2-CG 4.07Å
102	N	95.5	Very high	91.9	Very high	84 Å²	84	84 Å²	84	45%	0.449	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	127	167.7	-176.6	-76.6	0	0	0	108.1	V82 Q83	V82-N102 CarbonylContact O-C 3.52Å; V82-N102 WeakPolarHBondContact O-CA 3.37Å; Q83-N102 WeakPolarHBondContact CG-ND2 3.36Å; Q83-N102 PolarHBondContact NE2-ND2 2.95Å
103	R	95.4	Very high	92.4	Very high	45 Å²	45	78.2 Å²	78.2	17%	0.17	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	146.7	177.7	-71.4	-176.6	-174.5	171.5	1.3	110.9	S46 E81 V82 F101 Y105	S46-R103 VanDerWaalsContact CA-NH2 3.28Å; S46-R103 PolarHBondContact O-NH1 3.14Å; S46-R103 PolarHBondContact O-NH2 2.83Å; S46-R103 PolarHBondContact OG-NH1 2.83Å; S46-R103 PolarHBondContact OG-NH2 3.4Å; E81-R103 CarbonylContact C-O 3.57Å; E81-R103 VanDerWaalsContact CA-O 3.28Å; E81-R103 WeakPolarHBondContact CA-O 3.39Å; V82-R103 PolarHBondContact N-O 2.97Å; V82-R103 PolarHBondContact O-N 2.91Å; F101-R103 HydrophobicContact CD2-CG 4.07Å; R103-Y105 HydrophobicContact CB-CE2 3.99Å; R103-Y105 WeakPolarHBondContact CD-OH 3.35Å
104	R	96.4	Very high	93	Very high	130 Å²	130	84.4 Å²	84.4	49%	0.491	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.7	127.4	-178.1	-58.4	-178.9	66	-155.6	-4.6	109.1	F79 V80 E81	F79-R104 HydrophobicContact CD1-CB 4.18Å; V80-R104 CarbonylContact O-C 3.57Å; V80-R104 VanDerWaalsContact O-CA 3.32Å; V80-R104 WeakPolarHBondContact O-CA 3.48Å; E81-R104 HydrophobicContact CB-CG 4.34Å; E81-R104 HydrophobicContact CG-CG 3.91Å; E81-R104 WeakPolarHBondContact OE1-CD 3.43Å; E81-R104 IonicContact OE1-CZ 3.72Å; E81-R104 IonicContact OE1-NE 2.75Å; E81-R104 PolarHBondContact OE1-NE 3.32Å; E81-R104 IonicContact OE1-NH2 3.93Å
105	Y	96.6	Very high	93.6	Very high	22 Å²	22	76.8 Å²	76.8	9%	0.086	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	124.4	178	-52.6	-77.6	0	0	0	108.6	A48 V50 V59 V61 F79 V80 V82 R103 I107	A48-Y105 HydrophobicContact CB-CE1 3.64Å; A48-Y105 WeakPolarHBondContact CB-OH 3.43Å; V50-Y105 HydrophobicContact CG2-CD1 3.77Å; V50-Y105 HydrophobicContact CG2-CE1 4.19Å; V59-Y105 HydrophobicContact CG1-CD1 3.94Å; V59-Y105 HydrophobicContact CG1-CD2 3.76Å; V59-Y105 HydrophobicContact CG1-CE1 3.89Å; V59-Y105 HydrophobicContact CG1-CE2 3.67Å; V59-Y105 HydrophobicContact CG1-CG 3.87Å; V59-Y105 HydrophobicContact CG2-CD2 4.39Å; V59-Y105 HydrophobicContact CG2-CG 4.07Å; V61-Y105 HydrophobicContact CG2-CE2 3.93Å; V61-Y105 VanDerWaalsContact CG2-OH 3.27Å; V61-Y105 WeakPolarHBondContact CG2-OH 3.49Å; F79-Y105 CarbonylContact C-O 3.51Å; F79-Y105 VanDerWaalsContact CA-O 3.25Å; F79-Y105 WeakPolarHBondContact CA-O 3.4Å; V80-Y105 PolarHBondContact N-O 2.86Å; V80-Y105 PolarHBondContact O-N 2.85Å; V82-Y105 HydrophobicContact CG2-CD2 4.31Å; V82-Y105 HydrophobicContact CG2-CE2 3.89Å; R103-Y105 HydrophobicContact CB-CE2 3.99Å; R103-Y105 WeakPolarHBondContact CD-OH 3.35Å; Y105-I107 PolarHBondContact O-N 2.73Å
106	R	96.1	Very high	94	Very high	178 Å²	178	77.6 Å²	77.6	67%	0.672	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.4	128.7	179.3	-169.2	177	-173.5	164	4.5	109.1	D78 F79 P108	D78-R106 CarbonylContact O-C 3.58Å; D78-R106 WeakPolarHBondContact O-CA 3.26Å; F79-R106 HydrophobicContact CD1-CB 4.05Å; F79-R106 HydrophobicContact CE1-CB 3.76Å; F79-R106 HydrophobicContact CE1-CG 4.09Å; F79-R106 HydrophobicContact CZ-CB 4.44Å; F79-R106 HydrophobicContact CZ-CG 4.28Å; R106-P108 WeakPolarHBondContact O-CD 3.36Å
107	I	96.1	Very high	94.5	Very high	9 Å²	9	78.1 Å²	78.1	5%	0.046	39%	0.388	C	S	.	.	P	Polyproline II helix	trans	-80.8	121	174.8	-57.7	171.2	0	0	0	107.7	V75 D78 V80 Y105 V111 I113	V75-I107 HydrophobicContact CG1-CD1 3.86Å; V75-I107 HydrophobicContact CG2-CD1 4.47Å; D78-I107 PolarHBondContact O-N 2.78Å; V80-I107 HydrophobicContact CG2-CD1 3.71Å; V80-I107 HydrophobicContact CG2-CG1 3.73Å; Y105-I107 PolarHBondContact O-N 2.73Å; I107-V111 HydrophobicContact CG2-CB 3.74Å; I107-V111 HydrophobicContact CG2-CG1 3.98Å; I107-V111 HydrophobicContact CG2-CG2 4.16Å; I107-I113 HydrophobicContact CD1-CD1 4.39Å; I107-I113 HydrophobicContact CD1-CG1 4.42Å; I107-I113 HydrophobicContact CG2-CD1 4.45Å; I107-I113 HydrophobicContact CG2-CG1 4.2Å
108	P	94.5	Very high	95.1	Very high	43 Å²	43	79.1 Å²	79.1	28%	0.279	40%	0.396	S	S	.	.	P	Polyproline II helix	trans	-62.2	152.1	174.2	-25.5	37.6	0	0	0	112.1	C52 F57 R106 V111	C52-P108 HydrophobicContact CB-CG 4.25Å; F57-P108 HydrophobicContact CD2-CG 4Å; F57-P108 HydrophobicContact CE2-CG 4.41Å; R106-P108 WeakPolarHBondContact O-CD 3.36Å; P108-V111 HydrophobicContact CB-CG2 4.23Å; P108-V111 WeakPolarHBondContact O-CG2 3.23Å; P108-V111 PolarHBondContact O-N 3.33Å
109	K	92.9	Very high	95.4	Very high	208 Å²	208	77.8 Å²	77.8	90%	0.904	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.9	142.2	172.2	-68.4	-174.2	177.9	-176.3	0	109.6
110	G	93	Very high	95.7	Very high	39 Å²	39	77.6 Å²	77.6	40%	0.402	40%	0.396	S	S	.	.	T	Hydrogen-bonded Turn	trans	89.8	-5.3	178.8	0	0	0	0	0	114	M132 L133	G110-M132 CarbonylContact O-C 3.47Å; G110-L133 VanDerWaalsContact O-CB 3.29Å; G110-L133 WeakPolarHBondContact O-CB 3.44Å; G110-L133 WeakPolarHBondContact O-CG 3.29Å; G110-L133 PolarHBondContact O-N 3.16Å
111	V	96	Very high	95.7	Very high	8 Å²	8	72.3 Å²	72.3	5%	0.048	37%	0.374	C	S	.	.	B	Isolated β-bridge	trans	-71.9	136.8	170.9	175.1	0	0	0	0	110.4	F57 I107 P108 I113 A130 M132	F57-V111 HydrophobicContact CB-CG1 4.16Å; F57-V111 HydrophobicContact CB-CG2 3.6Å; F57-V111 HydrophobicContact CG-CG2 4.31Å; I107-V111 HydrophobicContact CG2-CB 3.74Å; I107-V111 HydrophobicContact CG2-CG1 3.98Å; I107-V111 HydrophobicContact CG2-CG2 4.16Å; P108-V111 HydrophobicContact CB-CG2 4.23Å; P108-V111 WeakPolarHBondContact O-CG2 3.23Å; P108-V111 PolarHBondContact O-N 3.33Å; V111-I113 PolarHBondContact O-N 3.38Å; V111-I113 VanDerWaalsContact O-N 3.09Å; V111-A130 HydrophobicContact CG1-CB 3.41Å; V111-A130 VanDerWaalsContact CG1-CB 3.41Å; V111-M132 HydrophobicContact CG2-CE 4.47Å; V111-M132 HydrophobicContact CG2-SD 3.82Å
112	N	95.8	Very high	95.7	Very high	47 Å²	47	77.1 Å²	77.1	25%	0.251	41%	0.408	S	S	.	.			trans	-79.2	88.5	173.3	-173.2	-3.5	0	0	0	110.5	M114 A115 P131 L133	N112-M114 PolarHBondContact O-N 3.16Å; N112-M114 PolarHBondContact OD1-N 3.09Å; N112-A115 HydrophobicContact CB-CB 4.27Å; N112-A115 PolarHBondContact O-N 3.43Å; N112-P131 HydrophobicContact CB-CG 4.21Å; N112-P131 WeakPolarHBondContact CB-O 3.29Å; N112-P131 PolarHBondContact N-O 3.24Å; N112-L133 HydrophobicContact CB-CD2 3.58Å; N112-L133 HydrophobicContact CB-CG 3.96Å
113	I	95.4	Very high	95.6	Very high	69 Å²	69	79.9 Å²	79.9	35%	0.354	42%	0.419	S	S	.	.	G	3₁₀ helix	trans	-59.4	-30.8	-179.2	-58.3	174.9	0	0	0	112.1	V75 I107 V111 A115 L116	V75-I113 HydrophobicContact CG1-CG2 3.98Å; V75-I113 HydrophobicContact CG2-CG2 4.21Å; I107-I113 HydrophobicContact CD1-CD1 4.39Å; I107-I113 HydrophobicContact CD1-CG1 4.42Å; I107-I113 HydrophobicContact CG2-CD1 4.45Å; I107-I113 HydrophobicContact CG2-CG1 4.2Å; V111-I113 PolarHBondContact O-N 3.38Å; V111-I113 VanDerWaalsContact O-N 3.09Å; I113-A115 PolarHBondContact O-N 3.21Å; I113-L116 VanDerWaalsContact O-CB 3.23Å; I113-L116 WeakPolarHBondContact O-CB 3.38Å; I113-L116 PolarHBondContact O-N 3.34Å; I113-L116 VanDerWaalsContact O-N 3.16Å
114	M	95.1	Very high	95.6	Very high	178 Å²	178	78.3 Å²	78.3	88%	0.877	42%	0.416	S	S	*	.	G	3₁₀ helix	trans	-70.5	-20.6	-180	-64.1	-58	-59.6	0	0	113.1	N112	N112-M114 PolarHBondContact O-N 3.16Å; N112-M114 PolarHBondContact OD1-N 3.09Å
115	A	96.2	Very high	95.6	Very high	43 Å²	43	73.9 Å²	73.9	36%	0.355	40%	0.404	S	S	.	.	G	3₁₀ helix	trans	-102	15.4	175.6	0	0	0	0	0	112.1	N112 I113 E117 P131	N112-A115 HydrophobicContact CB-CB 4.27Å; N112-A115 PolarHBondContact O-N 3.43Å; I113-A115 PolarHBondContact O-N 3.21Å; A115-E117 PolarHBondContact O-N 2.88Å; A115-P131 HydrophobicContact CB-CG 3.87Å
116	L	97	Very high	95.7	Very high	40 Å²	40	73 Å²	73	21%	0.209	40%	0.401	C	S	.	.			trans	-71.3	128.2	176.4	-173.6	136.7	0	0	0	110.4	V75 V80 I113 I128 S129 A130	V75-L116 HydrophobicContact CG2-CD2 4.32Å; V80-L116 HydrophobicContact CG2-CD1 3.76Å; I113-L116 VanDerWaalsContact O-CB 3.23Å; I113-L116 WeakPolarHBondContact O-CB 3.38Å; I113-L116 PolarHBondContact O-N 3.34Å; I113-L116 VanDerWaalsContact O-N 3.16Å; L116-I128 HydrophobicContact CD1-CG2 4.02Å; L116-I128 HydrophobicContact CD2-CG2 3.92Å; L116-I128 HydrophobicContact CG-CG2 4.04Å; L116-S129 WeakPolarHBondContact CA-O 3.25Å; L116-A130 HydrophobicContact CB-CB 3.93Å; L116-A130 HydrophobicContact CD1-CB 4.08Å; L116-A130 HydrophobicContact CG-CB 4.2Å
117	E	97.3	Very high	95.7	Very high	131 Å²	131	67.4 Å²	67.4	61%	0.612	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128	162	179.2	65.9	-174.8	169.8	0	0	110.8	A115 I128 S129	A115-E117 PolarHBondContact O-N 2.88Å; E117-I128 WeakPolarHBondContact O-CA 3.16Å; E117-S129 PolarHBondContact N-O 3.17Å; E117-S129 PolarHBondContact O-N 3.48Å
118	S	97.1	Very high	95.8	Very high	63 Å²	63	67 Å²	67	44%	0.441	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.1	143.1	176.1	64.4	0	0	0	0	111.6	I127	S118-I127 CarbonylContact C-O 3.57Å; S118-I127 WeakPolarHBondContact CA-O 3.38Å
119	A	97.1	Very high	96	Very high	63 Å²	63	66.3 Å²	66.3	52%	0.521	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.5	149.9	175.8	0	0	0	0	0	110.6	I127	A119-I127 PolarHBondContact N-O 2.9Å; A119-I127 PolarHBondContact O-N 2.71Å
120	V	96.9	Very high	96.2	Very high	61 Å²	61	56.7 Å²	56.7	37%	0.37	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	126.5	173	-178.2	0	0	0	0	108.5	V63 L71 V125 L126	V63-V120 HydrophobicContact CG2-CG1 4.05Å; L71-V120 HydrophobicContact CD1-CG2 4.01Å; V120-V125 CarbonylContact C-O 3.59Å; V120-V125 WeakPolarHBondContact CA-O 3.25Å; V120-L126 HydrophobicContact CG2-CB 4.31Å; V120-L126 HydrophobicContact CG2-CD1 3.79Å
121	S	95.1	Very high	96.4	Very high	26 Å²	26	57.6 Å²	57.6	18%	0.182	34%	0.335	C	S	.	.			trans	-76.3	157.7	175.9	90	0	0	0	0	111.5	E123 G124 V125	S121-E123 VanDerWaalsContact CB-OE2 3.25Å; S121-E123 WeakPolarHBondContact CB-OE2 3.46Å; S121-E123 PolarHBondContact O-N 2.94Å; S121-E123 VanDerWaalsContact O-N 3.14Å; S121-E123 PolarHBondContact OG-N 2.82Å; S121-E123 PolarHBondContact OG-OE2 2.79Å; S121-G124 PolarHBondContact O-N 2.89Å; S121-V125 PolarHBondContact N-O 2.98Å; S121-V125 PolarHBondContact OG-N 3.1Å
122	P	94	Very high	96.3	Very high	132 Å²	132	59.6 Å²	59.6	86%	0.857	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.5	-26.1	175	-25.5	35.6	0	0	0	114.4	G124	P122-G124 PolarHBondContact O-N 2.83Å
123	E	93.9	Very high	96.2	Very high	143 Å²	143	61.7 Å²	61.7	67%	0.668	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	0.4	178.2	-55.3	71.9	-154.4	0	0	112.9	S121	S121-E123 VanDerWaalsContact CB-OE2 3.25Å; S121-E123 WeakPolarHBondContact CB-OE2 3.46Å; S121-E123 PolarHBondContact O-N 2.94Å; S121-E123 VanDerWaalsContact O-N 3.14Å; S121-E123 PolarHBondContact OG-N 2.82Å; S121-E123 PolarHBondContact OG-OE2 2.79Å
124	G	95.2	Very high	95.5	Very high	11 Å²	11	67 Å²	67	11%	0.113	38%	0.379	C	S	.	.	S	Bend	trans	81.1	34.2	179.1	0	0	0	0	0	113.2	V63 K64 S121 P122	V63-G124 CarbonylContact C-O 3.53Å; V63-G124 VanDerWaalsContact CG2-O 3.28Å; V63-G124 WeakPolarHBondContact CG2-O 3.37Å; V63-G124 PolarHBondContact N-O 3Å; K64-G124 PolarHBondContact N-O 3.46Å; S121-G124 PolarHBondContact O-N 2.89Å; P122-G124 PolarHBondContact O-N 2.83Å
125	V	96.5	Very high	94.2	Very high	38 Å²	38	66.1 Å²	66.1	23%	0.23	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	118.7	174	-175.7	0	0	0	0	109.7	Q60 V61 V120 S121 I127	Q60-V125 HydrophobicContact CB-CG1 4Å; V61-V125 WeakPolarHBondContact O-CA 2.86Å; V120-V125 CarbonylContact C-O 3.59Å; V120-V125 WeakPolarHBondContact CA-O 3.25Å; S121-V125 PolarHBondContact N-O 2.98Å; S121-V125 PolarHBondContact OG-N 3.1Å; V125-I127 HydrophobicContact CG1-CG1 4.27Å
126	L	97.8	Very high	92.5	Very high	4 Å²	4	73.1 Å²	73.1	2%	0.021	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.2	119.7	169.7	172.2	66.8	0	0	0	108.8	Q60 V61 V63 V73 V82 V120 I128	Q60-L126 CarbonylContact C-O 3.55Å; Q60-L126 WeakPolarHBondContact CA-O 3.29Å; V61-L126 HydrophobicContact CB-CB 4.32Å; V61-L126 PolarHBondContact N-O 3.06Å; V61-L126 PolarHBondContact O-N 2.97Å; V63-L126 HydrophobicContact CG1-CB 3.92Å; V63-L126 HydrophobicContact CG2-CB 3.88Å; V73-L126 HydrophobicContact CG2-CD1 4.32Å; V73-L126 HydrophobicContact CG2-CD2 3.81Å; V82-L126 HydrophobicContact CG1-CD2 3.51Å; V82-L126 HydrophobicContact CG2-CD2 4.22Å; V120-L126 HydrophobicContact CG2-CB 4.31Å; V120-L126 HydrophobicContact CG2-CD1 3.79Å; L126-I128 HydrophobicContact CD1-CG1 4.4Å; L126-I128 HydrophobicContact CD2-CD1 4.02Å; L126-I128 HydrophobicContact CD2-CG1 4.43Å; L126-I128 HydrophobicContact CG-CD1 4.23Å; L126-I128 HydrophobicContact CG-CG1 4.18Å
127	I	97.7	Very high	90.4	Very high	60 Å²	60	74 Å²	74	31%	0.308	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	128	175.1	-55.2	173.2	0	0	0	107.7	T58 V59 Q60 S118 A119 V125	T58-I127 HydrophobicContact CG2-CG2 4.13Å; V59-I127 CarbonylContact O-C 3.58Å; V59-I127 WeakPolarHBondContact O-CA 3.43Å; Q60-I127 HydrophobicContact CG-CG1 4.37Å; S118-I127 CarbonylContact C-O 3.57Å; S118-I127 WeakPolarHBondContact CA-O 3.38Å; A119-I127 PolarHBondContact N-O 2.9Å; A119-I127 PolarHBondContact O-N 2.71Å; V125-I127 HydrophobicContact CG1-CG1 4.27Å
128	I	98.3	Very high	88	Confident	0 Å²	0	73.3 Å²	73.3	0%	0	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	124.8	173.1	-61	150.8	0	0	0	107.1	T58 V59 V73 V80 V82 L116 E117 L126	T58-I128 CarbonylContact C-O 3.56Å; T58-I128 VanDerWaalsContact CA-O 3.29Å; T58-I128 WeakPolarHBondContact CA-O 3.38Å; V59-I128 HydrophobicContact CB-CB 4.35Å; V59-I128 PolarHBondContact N-O 2.81Å; V59-I128 PolarHBondContact O-N 2.69Å; V73-I128 HydrophobicContact CG1-CD1 4.08Å; V73-I128 HydrophobicContact CG1-CG1 4.25Å; V73-I128 HydrophobicContact CG2-CD1 4.43Å; V80-I128 HydrophobicContact CG1-CD1 4.02Å; V80-I128 HydrophobicContact CG1-CG2 4.29Å; V80-I128 HydrophobicContact CG2-CG2 4.48Å; V82-I128 HydrophobicContact CG2-CD1 3.5Å; L116-I128 HydrophobicContact CD1-CG2 4.02Å; L116-I128 HydrophobicContact CD2-CG2 3.92Å; L116-I128 HydrophobicContact CG-CG2 4.04Å; E117-I128 WeakPolarHBondContact O-CA 3.16Å; L126-I128 HydrophobicContact CD1-CG1 4.4Å; L126-I128 HydrophobicContact CD2-CD1 4.02Å; L126-I128 HydrophobicContact CD2-CG1 4.43Å; L126-I128 HydrophobicContact CG-CD1 4.23Å; L126-I128 HydrophobicContact CG-CG1 4.18Å
129	S	97.7	Very high	85.5	Confident	28 Å²	28	81.5 Å²	81.5	20%	0.196	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138	149	-176.4	48.4	0	0	0	0	112.5	F57 L116 E117	F57-S129 CarbonylContact O-C 3.54Å; F57-S129 VanDerWaalsContact O-CA 3.25Å; F57-S129 WeakPolarHBondContact O-CA 3.34Å; L116-S129 WeakPolarHBondContact CA-O 3.25Å; E117-S129 PolarHBondContact N-O 3.17Å; E117-S129 PolarHBondContact O-N 3.48Å
130	A	97.1	Very high	83	Confident	6 Å²	6	83.5 Å²	83.5	5%	0.05	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.9	139.4	172.3	0	0	0	0	0	109.8	G56 F57 V111 L116	G56-A130 CarbonylContact C-O 3.52Å; G56-A130 VanDerWaalsContact CA-O 3.29Å; G56-A130 WeakPolarHBondContact CA-O 3.36Å; F57-A130 PolarHBondContact N-O 2.84Å; F57-A130 PolarHBondContact O-N 3.05Å; V111-A130 HydrophobicContact CG1-CB 3.41Å; V111-A130 VanDerWaalsContact CG1-CB 3.41Å; L116-A130 HydrophobicContact CB-CB 3.93Å; L116-A130 HydrophobicContact CD1-CB 4.08Å; L116-A130 HydrophobicContact CG-CB 4.2Å
131	P	96.9	Very high	80.6	Confident	58 Å²	58	89 Å²	89	38%	0.377	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.7	159.4	176.9	30.2	-33.5	0	0	0	111.4	N112 A115	N112-P131 HydrophobicContact CB-CG 4.21Å; N112-P131 WeakPolarHBondContact CB-O 3.29Å; N112-P131 PolarHBondContact N-O 3.24Å; A115-P131 HydrophobicContact CB-CG 3.87Å
132	M	95.4	Very high	78.8	Confident	51 Å²	51	96.5 Å²	96.5	25%	0.251	53%	0.534	S	S	.	.	B	Isolated β-bridge	trans	-67.3	144.8	163.2	-73.9	-60.6	-159.9	0	0	110.3	I55 G110 V111 Q134	I55-M132 PolarHBondContact O-N 3.23Å; I55-M132 VanDerWaalsContact O-N 3.17Å; G110-M132 CarbonylContact O-C 3.47Å; V111-M132 HydrophobicContact CG2-CE 4.47Å; V111-M132 HydrophobicContact CG2-SD 3.82Å; M132-Q134 PolarHBondContact O-N 3.14Å
133	L	93.3	Very high	78.1	Confident	91 Å²	91	94.7 Å²	94.7	48%	0.476	52%	0.518	S	S	.	.	P	Polyproline II helix	trans	-61	119.6	169.5	-71.6	167.6	0	0	0	108.1	G110 N112 I135	G110-L133 VanDerWaalsContact O-CB 3.29Å; G110-L133 WeakPolarHBondContact O-CB 3.44Å; G110-L133 WeakPolarHBondContact O-CG 3.29Å; G110-L133 PolarHBondContact O-N 3.16Å; N112-L133 HydrophobicContact CB-CD2 3.58Å; N112-L133 HydrophobicContact CB-CG 3.96Å; L133-I135 PolarHBondContact O-N 3.25Å; L133-I135 VanDerWaalsContact O-N 3.14Å
134	Q	80.4	Confident	77.2	Confident	179 Å²	179	92.2 Å²	92.2	84%	0.836	51%	0.51	S	S	*	.			trans	-69.5	111.6	169.4	-59.9	-128.1	-18.6	0	0	107.4	M132 E136	M132-Q134 PolarHBondContact O-N 3.14Å; Q134-E136 PolarHBondContact O-N 2.84Å
135	I	67.5	Low	76.2	Confident	160 Å²	160	96.7 Å²	96.7	82%	0.821	53%	0.532	S	S	*	.			trans	-73.2	81.4	171.8	-55.8	170.7	0	0	0	106.7	L133 G137	L133-I135 PolarHBondContact O-N 3.25Å; L133-I135 VanDerWaalsContact O-N 3.14Å; I135-G137 VanDerWaalsContact C-N 3.33Å; I135-G137 PolarHBondContact O-N 3Å
136	E	59.6	Low	75	Confident	191 Å²	191	100.1 Å²	100.1	89%	0.893	55%	0.549	S	S	*	.			trans	-76.6	86.4	176	-150.7	170.9	-164.7	0	0	108	Q134	Q134-E136 PolarHBondContact O-N 2.84Å
137	G	54.5	Low	73.6	Confident	58 Å²	58	106.1 Å²	106.1	60%	0.598	58%	0.583	S	S	*	*			trans	171.5	34.5	-175.3	0	0	0	0	0	120.3	I135	I135-G137 VanDerWaalsContact C-N 3.33Å; I135-G137 PolarHBondContact O-N 3Å
138	T	45.5	Very low	72	Confident	117 Å²	117	109.2 Å²	109.2	72%	0.718	60%	0.601	S	S	*	*			trans	-149.2	76.8	145.6	-38.4	0	0	0	0	109.3	C140	T138-C140 PolarHBondContact O-N 2.95Å
139	R	45.7	Very low	70.1	Confident	235 Å²	235	117 Å²	117	89%	0.887	64%	0.644	S	S	*	*			trans	-59.8	100.8	146	-85.8	178.5	159.5	156.1	-3.8	104.9	L141	R139-L141 VanDerWaalsContact C-N 3.3Å; R139-L141 PolarHBondContact O-N 2.87Å
140	C	43.3	Very low	68	Low	105 Å²	105	123.8 Å²	123.8	71%	0.709	68%	0.678	S	S	*	*			trans	-55.4	104.1	164.9	-71.5	0	0	0	0	106.1	T138 S142	T138-C140 PolarHBondContact O-N 2.95Å; C140-S142 VanDerWaalsContact C-N 3.35Å; C140-S142 PolarHBondContact O-N 3.12Å; C140-S142 VanDerWaalsContact O-N 3.12Å
141	L	46.6	Very low	65.6	Low	176 Å²	176	133.7 Å²	133.7	92%	0.921	73%	0.731	S	S	*	*			trans	-69.3	101.8	162.5	-64.5	174.3	0	0	0	105.3	R139	R139-L141 VanDerWaalsContact C-N 3.3Å; R139-L141 PolarHBondContact O-N 2.87Å
142	S	58.5	Low	62.7	Low	183 Å²	183	140.5 Å²	140.5	100%	1.28	76%	0.763	S	S	*	*			trans	-123.8	0	159.3	70.1	0	0	0	0	108.4	C140	C140-S142 VanDerWaalsContact C-N 3.35Å; C140-S142 PolarHBondContact O-N 3.12Å; C140-S142 VanDerWaalsContact O-N 3.12Å

Retrieved 142 of 142 residues in 55.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).