A0A087XMV6_POEFO Loading...

NELL2-interacting cell ontogeny regulator 1

AlphaFold DB , UniProt , Accession A0A087XMV6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 89 aa.

						>A0A087XMV6_POEFO|A0A087XMV6
SSGSYVQVALVLLAVQLVCVGAAEADQETGTVIPAESRPCVDCHAFEFMQRALQDLKKTAFNLDARTETLVLRAERRALCDCMPTTTLR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	60.7	Low	80.6	Confident	132 Å²	132	99.5 Å²	99.5	92%	0.923	60%	0.598	S	S	*	*				0	-30.8	0	-149.2	0	0	0	0	113.2	S4 Y5	S1-S4 PolarHBondContact O-OG 2.93Å; S1-Y5 WeakPolarHBondContact O-CD2 3.47Å; S1-Y5 WeakPolarHBondContact O-CE2 3.18Å
2	S	62.6	Low	81.4	Confident	96 Å²	96	100 Å²	100	67%	0.671	59%	0.594	S	S	*	*	H	α-helix	trans	-69.4	-32.3	-179.4	47.4	0	0	0	0	115.4	S4 Y5 V6	S2-S4 VanDerWaalsContact C-N 3.34Å; S2-S4 PolarHBondContact O-N 2.97Å; S2-Y5 PolarHBondContact O-N 2.89Å; S2-V6 WeakPolarHBondContact O-CG2 3.36Å; S2-V6 PolarHBondContact O-N 2.86Å
3	G	71.3	Confident	81.9	Confident	46 Å²	46	101.7 Å²	101.7	47%	0.474	60%	0.598	S	S	.	*	H	α-helix	trans	-65	-30.9	-177	0	0	0	0	0	114.8	Q7	G3-Q7 PolarHBondContact O-N 3.41Å; G3-Q7 VanDerWaalsContact O-N 3.11Å
4	S	74.5	Confident	82.3	Confident	66 Å²	66	98.2 Å²	98.2	46%	0.462	59%	0.586	S	S	.	*	H	α-helix	trans	-69.6	-38.3	178.1	53.5	0	0	0	0	112	S1 S2 Q7 V8	S1-S4 PolarHBondContact O-OG 2.93Å; S2-S4 VanDerWaalsContact C-N 3.34Å; S2-S4 PolarHBondContact O-N 2.97Å; S4-Q7 PolarHBondContact O-N 2.8Å; S4-V8 VanDerWaalsContact O-CG2 3.27Å; S4-V8 WeakPolarHBondContact O-CG2 3.32Å; S4-V8 PolarHBondContact O-N 2.82Å
5	Y	83.1	Confident	82.7	Confident	167 Å²	167	96.3 Å²	96.3	66%	0.655	58%	0.576	S	S	*	*	H	α-helix	trans	-67.9	-38.8	177.7	-66.9	-77.4	0	0	0	111.9	S1 S2 Q7 V8 A9	S1-Y5 WeakPolarHBondContact O-CD2 3.47Å; S1-Y5 WeakPolarHBondContact O-CE2 3.18Å; S2-Y5 PolarHBondContact O-N 2.89Å; Y5-Q7 VanDerWaalsContact C-N 3.34Å; Y5-V8 PolarHBondContact O-N 2.92Å; Y5-A9 VanDerWaalsContact O-CB 3.32Å; Y5-A9 WeakPolarHBondContact O-CB 3.16Å; Y5-A9 PolarHBondContact O-N 3.49Å
6	V	87.3	Confident	82.8	Confident	100 Å²	100	97.6 Å²	97.6	61%	0.606	57%	0.574	S	S	*	*	H	α-helix	trans	-64.1	-42.1	176	177.6	0	0	0	0	110.6	S2 A9 L10	S2-V6 WeakPolarHBondContact O-CG2 3.36Å; S2-V6 PolarHBondContact O-N 2.86Å; V6-A9 PolarHBondContact O-N 3.16Å; V6-L10 WeakPolarHBondContact O-CB 3.37Å; V6-L10 PolarHBondContact O-N 3.27Å
7	Q	85.9	Confident	82.7	Confident	137 Å²	137	99.8 Å²	99.8	64%	0.64	58%	0.581	S	S	*	*	H	α-helix	trans	-65.4	-42.4	177.6	-171	173.7	-24.5	0	0	112.1	G3 S4 Y5 L10 V11	G3-Q7 PolarHBondContact O-N 3.41Å; G3-Q7 VanDerWaalsContact O-N 3.11Å; S4-Q7 PolarHBondContact O-N 2.8Å; Y5-Q7 VanDerWaalsContact C-N 3.34Å; Q7-L10 PolarHBondContact O-N 3.05Å; Q7-V11 VanDerWaalsContact O-CG2 3.31Å; Q7-V11 WeakPolarHBondContact O-CG2 3.28Å; Q7-V11 PolarHBondContact O-N 3.27Å
8	V	89.2	Confident	82.4	Confident	86 Å²	86	100.1 Å²	100.1	52%	0.521	58%	0.584	S	S	.	*	H	α-helix	trans	-64.3	-42.9	175.5	172.3	0	0	0	0	111.1	S4 Y5 L10 V11 L12	S4-V8 VanDerWaalsContact O-CG2 3.27Å; S4-V8 WeakPolarHBondContact O-CG2 3.32Å; S4-V8 PolarHBondContact O-N 2.82Å; Y5-V8 PolarHBondContact O-N 2.92Å; V8-L10 VanDerWaalsContact C-N 3.32Å; V8-L10 PolarHBondContact O-N 3.24Å; V8-V11 PolarHBondContact O-N 3.34Å; V8-L12 HydrophobicContact CG1-CD1 4.05Å; V8-L12 HydrophobicContact CG1-CG 4.46Å; V8-L12 WeakPolarHBondContact O-CG 3.3Å; V8-L12 PolarHBondContact O-N 2.96Å
9	A	90.4	Very high	81.9	Confident	57 Å²	57	98.6 Å²	98.6	47%	0.471	58%	0.579	S	S	.	*	H	α-helix	trans	-62.1	-39.8	176.8	0	0	0	0	0	112.1	Y5 V6 L12 L13	Y5-A9 VanDerWaalsContact O-CB 3.32Å; Y5-A9 WeakPolarHBondContact O-CB 3.16Å; Y5-A9 PolarHBondContact O-N 3.49Å; V6-A9 PolarHBondContact O-N 3.16Å; A9-L12 PolarHBondContact O-N 3.03Å; A9-L13 WeakPolarHBondContact O-CB 3.5Å; A9-L13 PolarHBondContact O-N 2.99Å
10	L	91.7	Very high	81.3	Confident	122 Å²	122	97.7 Å²	97.7	64%	0.639	58%	0.575	S	S	*	*	H	α-helix	trans	-65.8	-41.6	177.4	-157.2	83.9	0	0	0	111.8	V6 Q7 V8 L13 A14	V6-L10 WeakPolarHBondContact O-CB 3.37Å; V6-L10 PolarHBondContact O-N 3.27Å; Q7-L10 PolarHBondContact O-N 3.05Å; V8-L10 VanDerWaalsContact C-N 3.32Å; V8-L10 PolarHBondContact O-N 3.24Å; L10-L13 PolarHBondContact O-N 3.4Å; L10-A14 WeakPolarHBondContact O-CB 3.2Å; L10-A14 PolarHBondContact O-N 3.39Å
11	V	90.4	Very high	80.4	Confident	85 Å²	85	94.9 Å²	94.9	52%	0.515	57%	0.567	S	S	.	*	H	α-helix	trans	-64.5	-45.3	176.6	171.5	0	0	0	0	110.7	Q7 V8 L13 A14 V15	Q7-V11 VanDerWaalsContact O-CG2 3.31Å; Q7-V11 WeakPolarHBondContact O-CG2 3.28Å; Q7-V11 PolarHBondContact O-N 3.27Å; V8-V11 PolarHBondContact O-N 3.34Å; V11-L13 VanDerWaalsContact C-N 3.33Å; V11-L13 PolarHBondContact O-N 3.36Å; V11-A14 PolarHBondContact O-N 3.03Å; V11-V15 WeakPolarHBondContact O-CG2 3.43Å; V11-V15 PolarHBondContact O-N 3.11Å
12	L	89.2	Confident	80.2	Confident	106 Å²	106	91.7 Å²	91.7	56%	0.555	55%	0.548	S	S	*	.	H	α-helix	trans	-61.5	-42.7	176.5	-71.8	172.5	0	0	0	111.5	V8 A9 A14 V15 Q16	V8-L12 HydrophobicContact CG1-CD1 4.05Å; V8-L12 HydrophobicContact CG1-CG 4.46Å; V8-L12 WeakPolarHBondContact O-CG 3.3Å; V8-L12 PolarHBondContact O-N 2.96Å; A9-L12 PolarHBondContact O-N 3.03Å; L12-A14 VanDerWaalsContact C-N 3.34Å; L12-A14 PolarHBondContact O-N 2.97Å; L12-V15 PolarHBondContact O-N 3.35Å; L12-Q16 WeakPolarHBondContact O-CG 3.37Å; L12-Q16 PolarHBondContact O-N 3.37Å
13	L	88.5	Confident	79.7	Confident	122 Å²	122	89.8 Å²	89.8	64%	0.639	54%	0.538	S	S	*	.	H	α-helix	trans	-62.2	-41.5	176.9	-169.9	69.9	0	0	0	111.9	A9 L10 V11 Q16 L17	A9-L13 WeakPolarHBondContact O-CB 3.5Å; A9-L13 PolarHBondContact O-N 2.99Å; L10-L13 PolarHBondContact O-N 3.4Å; V11-L13 VanDerWaalsContact C-N 3.33Å; V11-L13 PolarHBondContact O-N 3.36Å; L13-Q16 PolarHBondContact O-N 2.94Å; L13-L17 PolarHBondContact O-N 3.43Å
14	A	87.9	Confident	78.7	Confident	53 Å²	53	93.2 Å²	93.2	44%	0.438	54%	0.542	S	S	.	.	H	α-helix	trans	-64	-41.2	176.1	0	0	0	0	0	112.1	L10 V11 L12 L17 V18	L10-A14 WeakPolarHBondContact O-CB 3.2Å; L10-A14 PolarHBondContact O-N 3.39Å; V11-A14 PolarHBondContact O-N 3.03Å; L12-A14 VanDerWaalsContact C-N 3.34Å; L12-A14 PolarHBondContact O-N 2.97Å; A14-L17 PolarHBondContact O-N 3.31Å; A14-V18 VanDerWaalsContact O-CG2 3.32Å; A14-V18 WeakPolarHBondContact O-CG2 3.27Å; A14-V18 PolarHBondContact O-N 3.45Å
15	V	87.6	Confident	77.5	Confident	70 Å²	70	94.2 Å²	94.2	42%	0.424	55%	0.554	S	S	.	*	H	α-helix	trans	-61.9	-47.3	175.8	170.9	0	0	0	0	110.8	V11 L12 L17 V18 C19	V11-V15 WeakPolarHBondContact O-CG2 3.43Å; V11-V15 PolarHBondContact O-N 3.11Å; L12-V15 PolarHBondContact O-N 3.35Å; V15-L17 VanDerWaalsContact C-N 3.3Å; V15-L17 PolarHBondContact O-N 3.45Å; V15-V18 PolarHBondContact O-N 3.27Å; V15-C19 WeakPolarHBondContact O-CB 3.31Å; V15-C19 PolarHBondContact O-N 3.4Å; V15-C19 PolarHBondContact O-SG 2.94Å
16	Q	83.8	Confident	75.8	Confident	117 Å²	117	93.1 Å²	93.1	55%	0.547	56%	0.559	S	S	.	*	H	α-helix	trans	-60.1	-40.6	177.7	-65.3	-56.5	108	0	0	111.9	L12 L13 C19 V20	L12-Q16 WeakPolarHBondContact O-CG 3.37Å; L12-Q16 PolarHBondContact O-N 3.37Å; L13-Q16 PolarHBondContact O-N 2.94Å; Q16-C19 PolarHBondContact O-N 3.46Å; Q16-V20 WeakPolarHBondContact O-CB 3.46Å; Q16-V20 VanDerWaalsContact O-CG2 3.28Å; Q16-V20 WeakPolarHBondContact O-CG2 3.32Å; Q16-V20 PolarHBondContact O-N 3.42Å
17	L	81.3	Confident	73.9	Confident	134 Å²	134	94.4 Å²	94.4	70%	0.702	56%	0.559	S	S	*	*	H	α-helix	trans	-66.7	-38.7	179.1	-165	70.7	0	0	0	112.2	L13 A14 V15 G21	L13-L17 PolarHBondContact O-N 3.43Å; A14-L17 PolarHBondContact O-N 3.31Å; V15-L17 VanDerWaalsContact C-N 3.3Å; V15-L17 PolarHBondContact O-N 3.45Å; L17-G21 PolarHBondContact O-N 2.97Å
18	V	77.3	Confident	72.1	Confident	105 Å²	105	95.9 Å²	95.9	64%	0.636	57%	0.566	S	S	*	*	H	α-helix	trans	-68.2	-42.5	175	172.5	0	0	0	0	111	A14 V15 A22	A14-V18 VanDerWaalsContact O-CG2 3.32Å; A14-V18 WeakPolarHBondContact O-CG2 3.27Å; A14-V18 PolarHBondContact O-N 3.45Å; V15-V18 PolarHBondContact O-N 3.27Å; V18-A22 VanDerWaalsContact O-CB 3.27Å; V18-A22 WeakPolarHBondContact O-CB 3.41Å; V18-A22 PolarHBondContact O-N 3.33Å
19	C	73.4	Confident	69.9	Low	72 Å²	72	97.7 Å²	97.7	49%	0.486	58%	0.577	S	S	.	*	H	α-helix	trans	-66.5	-40.6	178.9	-67.8	0	0	0	0	112.5	V15 Q16 A23	V15-C19 WeakPolarHBondContact O-CB 3.31Å; V15-C19 PolarHBondContact O-N 3.4Å; V15-C19 PolarHBondContact O-SG 2.94Å; Q16-C19 PolarHBondContact O-N 3.46Å; C19-A23 PolarHBondContact O-N 3.04Å
20	V	70.4	Confident	68.1	Low	81 Å²	81	98.5 Å²	98.5	49%	0.491	59%	0.591	S	S	.	*	H	α-helix	trans	-71.8	-43.4	176	173	0	0	0	0	110.7	Q16 A22 A23 E24	Q16-V20 WeakPolarHBondContact O-CB 3.46Å; Q16-V20 VanDerWaalsContact O-CG2 3.28Å; Q16-V20 WeakPolarHBondContact O-CG2 3.32Å; Q16-V20 PolarHBondContact O-N 3.42Å; V20-A22 PolarHBondContact O-N 2.95Å; V20-A23 WeakPolarHBondContact O-CA 3.36Å; V20-A23 WeakPolarHBondContact O-CB 3.44Å; V20-A23 PolarHBondContact O-N 3Å; V20-E24 HydrophobicContact CG1-CG 4.3Å; V20-E24 WeakPolarHBondContact O-CG 3.42Å; V20-E24 PolarHBondContact O-N 3.27Å
21	G	61.3	Low	66	Low	39 Å²	39	97.7 Å²	97.7	40%	0.402	59%	0.591	S	S	.	*	H	α-helix	trans	-62.3	-31	175.8	0	0	0	0	0	113.4	L17 A25	L17-G21 PolarHBondContact O-N 2.97Å; G21-A25 VanDerWaalsContact O-CB 3.29Å; G21-A25 WeakPolarHBondContact O-CB 3.41Å; G21-A25 PolarHBondContact O-N 3.36Å
22	A	56.2	Low	64.2	Low	65 Å²	65	100.3 Å²	100.3	54%	0.537	61%	0.607	S	S	.	*	H	α-helix	trans	-72.9	-29.1	172	0	0	0	0	0	113	V18 V20	V18-A22 VanDerWaalsContact O-CB 3.27Å; V18-A22 WeakPolarHBondContact O-CB 3.41Å; V18-A22 PolarHBondContact O-N 3.33Å; V20-A22 PolarHBondContact O-N 2.95Å
23	A	52.9	Low	62.3	Low	55 Å²	55	100 Å²	100	46%	0.455	61%	0.605	S	S	.	*	H	α-helix	trans	-74.7	-39.3	174.4	0	0	0	0	0	111.8	C19 V20 D26	C19-A23 PolarHBondContact O-N 3.04Å; V20-A23 WeakPolarHBondContact O-CA 3.36Å; V20-A23 WeakPolarHBondContact O-CB 3.44Å; V20-A23 PolarHBondContact O-N 3Å; A23-D26 PolarHBondContact O-N 3.21Å
24	E	50.9	Low	60.7	Low	119 Å²	119	98.2 Å²	98.2	56%	0.556	60%	0.601	S	S	*	*	H	α-helix	trans	-73.9	-30.4	178	-61.4	-70	110.7	0	0	112.1	V20 D26 Q27	V20-E24 HydrophobicContact CG1-CG 4.3Å; V20-E24 WeakPolarHBondContact O-CG 3.42Å; V20-E24 PolarHBondContact O-N 3.27Å; E24-D26 PolarHBondContact O-N 2.89Å; E24-Q27 PolarHBondContact O-N 3.25Å; E24-Q27 VanDerWaalsContact O-N 3.08Å
25	A	48.5	Very low	59.1	Low	86 Å²	86	99.4 Å²	99.4	71%	0.711	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.4	-13.1	175	0	0	0	0	0	113.7	G21	G21-A25 VanDerWaalsContact O-CB 3.29Å; G21-A25 WeakPolarHBondContact O-CB 3.41Å; G21-A25 PolarHBondContact O-N 3.36Å
26	D	47.7	Very low	57.5	Low	145 Å²	145	105.6 Å²	105.6	78%	0.775	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.9	-9.4	172.4	-165.5	62.5	0	0	0	112.2	A23 E24	A23-D26 PolarHBondContact O-N 3.21Å; E24-D26 PolarHBondContact O-N 2.89Å
27	Q	46.8	Very low	55.9	Low	127 Å²	127	102.8 Å²	102.8	59%	0.593	63%	0.628	S	S	*	*	S	Bend	trans	-99.3	3.9	-163.3	-142.4	165.2	-17.2	0	0	115.9	E24	E24-Q27 PolarHBondContact O-N 3.25Å; E24-Q27 VanDerWaalsContact O-N 3.08Å
28	E	47.6	Very low	54.9	Low	168 Å²	168	105.5 Å²	105.5	79%	0.785	63%	0.629	S	S	*	*	S	Bend	trans	-114.9	40.5	-172.4	-128.4	78.8	116.8	0	0	115.6
29	T	44.7	Very low	54	Low	123 Å²	123	104.5 Å²	104.5	76%	0.755	63%	0.625	S	S	*	*			trans	-147.5	66.2	156.9	-39.9	0	0	0	0	111.3	T31	T29-T31 VanDerWaalsContact C-N 3.29Å; T29-T31 HydrophobicContact CG2-CG2 4.31Å; T29-T31 PolarHBondContact O-N 3.01Å
30	G	50.9	Low	53.2	Low	74 Å²	74	105.1 Å²	105.1	76%	0.763	63%	0.629	S	S	*	*			trans	-62.7	89.1	163.2	0	0	0	0	0	110.6	V32	G30-V32 PolarHBondContact O-N 2.91Å
31	T	48.7	Very low	52.4	Low	106 Å²	106	107.1 Å²	107.1	65%	0.65	64%	0.641	S	S	*	*			trans	-76.9	103.1	157.6	55.3	0	0	0	0	106.5	T29 I33	T29-T31 VanDerWaalsContact C-N 3.29Å; T29-T31 HydrophobicContact CG2-CG2 4.31Å; T29-T31 PolarHBondContact O-N 3.01Å; T31-I33 PolarHBondContact O-N 2.88Å
32	V	53.1	Low	52.2	Low	139 Å²	139	112.4 Å²	112.4	84%	0.842	66%	0.66	S	S	*	*			trans	-62.9	91.7	166.8	177.9	0	0	0	0	106.3	G30 P34	G30-V32 PolarHBondContact O-N 2.91Å; V32-P34 WeakPolarHBondContact O-CD 3.49Å
33	I	48.8	Very low	52.3	Low	99 Å²	99	113.7 Å²	113.7	51%	0.508	66%	0.664	S	S	.	*			trans	-63.9	118.6	172.7	-66	-163.2	0	0	0	106.7	T31 S37	T31-I33 PolarHBondContact O-N 2.88Å; I33-S37 WeakPolarHBondContact CG2-OG 3.33Å
34	P	54	Low	53.2	Low	86 Å²	86	114.8 Å²	114.8	56%	0.558	66%	0.659	S	S	*	*			trans	-53.2	144.1	179.1	-23.2	31.6	0	0	0	110.4	V32 E36 S37	V32-P34 WeakPolarHBondContact O-CD 3.49Å; P34-E36 PolarHBondContact O-N 3.39Å; P34-S37 PolarHBondContact O-N 2.94Å; P34-S37 PolarHBondContact O-OG 2.99Å
35	A	54.8	Low	54.3	Low	78 Å²	78	111.5 Å²	111.5	65%	0.645	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-56.7	-18.1	-175.2	0	0	0	0	0	114.3	S37	A35-S37 VanDerWaalsContact C-N 3.3Å; A35-S37 PolarHBondContact O-N 3.29Å
36	E	53.6	Low	55.4	Low	199 Å²	199	114.4 Å²	114.4	93%	0.93	65%	0.65	S	S	*	*	G	3₁₀ helix	trans	-80.1	-1.3	172.6	-69.4	-144.3	135.2	0	0	115.4	P34	P34-E36 PolarHBondContact O-N 3.39Å
37	S	51.7	Low	56.7	Low	59 Å²	59	113.2 Å²	113.2	41%	0.413	64%	0.639	S	S	.	*	G	3₁₀ helix	trans	-119.9	18.1	173.1	45.5	0	0	0	0	112.1	I33 P34 A35 P39	I33-S37 WeakPolarHBondContact CG2-OG 3.33Å; P34-S37 PolarHBondContact O-N 2.94Å; P34-S37 PolarHBondContact O-OG 2.99Å; A35-S37 VanDerWaalsContact C-N 3.3Å; A35-S37 PolarHBondContact O-N 3.29Å; S37-P39 WeakPolarHBondContact O-CD 2.89Å; S37-P39 VanDerWaalsContact O-N 3.17Å
38	R	59	Low	58.4	Low	191 Å²	191	114.8 Å²	114.8	72%	0.721	65%	0.645	S	S	*	*			trans	-67.7	107.1	162.4	-72.7	-179.1	-178.2	-102.6	-1	106.7	C40	R38-C40 PolarHBondContact O-N 3.18Å; R38-C40 VanDerWaalsContact O-N 3.16Å
39	P	59.8	Low	60.1	Low	83 Å²	83	112.3 Å²	112.3	54%	0.539	63%	0.634	S	S	.	*			trans	-66.7	124	172.4	6.4	10.6	0	0	0	104.6	S37 V41 H44	S37-P39 WeakPolarHBondContact O-CD 2.89Å; S37-P39 VanDerWaalsContact O-N 3.17Å; P39-V41 PolarHBondContact O-N 3.27Å; P39-H44 HydrophobicContact CB-CB 4.43Å; P39-H44 WeakPolarHBondContact CB-CD2 3.48Å
40	C	56.4	Low	62	Low	85 Å²	85	110.7 Å²	110.7	57%	0.574	62%	0.619	S	S	*	*			trans	-46.8	114.7	179.1	-39.8	0	0	0	0	107.7	R38 D42 C43 H44	R38-C40 PolarHBondContact O-N 3.18Å; R38-C40 VanDerWaalsContact O-N 3.16Å; C40-D42 PolarHBondContact O-N 3.37Å; C40-C43 HydrophobicContact CB-CB 3.78Å; C40-C43 PolarHBondContact O-N 2.93Å; C40-H44 PolarHBondContact O-N 3.08Å
41	V	52.6	Low	63.7	Low	123 Å²	123	114.8 Å²	114.8	75%	0.745	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.1	-19.1	-169.8	100.7	0	0	0	0	111.9	P39	P39-V41 PolarHBondContact O-N 3.27Å
42	D	57.9	Low	65.6	Low	150 Å²	150	111.6 Å²	111.6	80%	0.802	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.7	-13.6	177.1	-58	-53.7	0	0	0	114.4	C40	C40-D42 PolarHBondContact O-N 3.37Å
43	C	58.7	Low	67.4	Low	92 Å²	92	110 Å²	110	62%	0.622	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.1	-25	178.1	-158.2	0	0	0	0	112.6	C40	C40-C43 HydrophobicContact CB-CB 3.78Å; C40-C43 PolarHBondContact O-N 2.93Å
44	H	70.5	Confident	69.4	Low	78 Å²	78	110.1 Å²	110.1	36%	0.361	58%	0.58	S	S	.	*	S	Bend	trans	-105.3	-1	-177	-69.2	-81.9	0	0	0	115.3	P39 C40 F46 E47 F48	P39-H44 HydrophobicContact CB-CB 4.43Å; P39-H44 WeakPolarHBondContact CB-CD2 3.48Å; C40-H44 PolarHBondContact O-N 3.08Å; H44-F46 PolarHBondContact O-N 2.86Å; H44-E47 IonicContact CE1-OE2 3.56Å; H44-E47 IonicContact CG-OE2 3.93Å; H44-E47 IonicContact ND1-OE2 2.81Å; H44-E47 PolarHBondContact ND1-OE2 3.45Å; H44-E47 PolarHBondContact O-N 2.87Å; H44-F48 PolarHBondContact O-N 3.26Å
45	A	75	Confident	71.2	Confident	51 Å²	51	109.9 Å²	109.9	42%	0.421	57%	0.574	S	S	.	*	H	α-helix	trans	-58.5	-36.5	178	0	0	0	0	0	112.5	M49	A45-M49 VanDerWaalsContact O-CB 3.3Å; A45-M49 WeakPolarHBondContact O-CB 3.23Å; A45-M49 PolarHBondContact O-N 2.81Å
46	F	71.8	Confident	73	Confident	147 Å²	147	111.6 Å²	111.6	65%	0.645	57%	0.572	S	S	*	*	H	α-helix	trans	-67.6	-44.2	177.9	-177.3	-101.3	0	0	0	112.4	H44 M49 Q50	H44-F46 PolarHBondContact O-N 2.86Å; F46-M49 PolarHBondContact O-N 2.87Å; F46-Q50 VanDerWaalsContact CE1-OE1 3.32Å; F46-Q50 VanDerWaalsContact O-CB 3.29Å; F46-Q50 WeakPolarHBondContact O-CB 3.42Å; F46-Q50 PolarHBondContact O-N 2.95Å
47	E	73.4	Confident	74.9	Confident	119 Å²	119	108.7 Å²	108.7	56%	0.556	56%	0.556	S	S	*	*	H	α-helix	trans	-66.5	-40.4	178.8	-67.8	-176.9	155	0	0	112.1	H44 Q50 R51	H44-E47 IonicContact CE1-OE2 3.56Å; H44-E47 IonicContact CG-OE2 3.93Å; H44-E47 IonicContact ND1-OE2 2.81Å; H44-E47 PolarHBondContact ND1-OE2 3.45Å; H44-E47 PolarHBondContact O-N 2.87Å; E47-Q50 PolarHBondContact O-N 2.81Å; E47-R51 WeakPolarHBondContact O-CB 3.42Å; E47-R51 PolarHBondContact O-N 3.31Å
48	F	82.8	Confident	76.9	Confident	161 Å²	161	113.2 Å²	113.2	71%	0.706	57%	0.568	S	S	*	*	H	α-helix	trans	-62.3	-47.7	174.8	-179.5	-94	0	0	0	111.2	H44 Q50 R51 A52	H44-F48 PolarHBondContact O-N 3.26Å; F48-Q50 VanDerWaalsContact C-N 3.34Å; F48-Q50 PolarHBondContact O-N 3.07Å; F48-R51 PolarHBondContact O-N 3.45Å; F48-A52 WeakPolarHBondContact O-CB 3.29Å; F48-A52 PolarHBondContact O-N 3.44Å
49	M	82.9	Confident	78.6	Confident	115 Å²	115	107.8 Å²	107.8	57%	0.567	56%	0.556	S	S	*	*	H	α-helix	trans	-63.6	-41	179.1	-165.9	176.4	-55.7	0	0	111.5	A45 F46 R51 A52 L53	A45-M49 VanDerWaalsContact O-CB 3.3Å; A45-M49 WeakPolarHBondContact O-CB 3.23Å; A45-M49 PolarHBondContact O-N 2.81Å; F46-M49 PolarHBondContact O-N 2.87Å; M49-R51 VanDerWaalsContact C-N 3.33Å; M49-R51 PolarHBondContact O-N 3.38Å; M49-A52 PolarHBondContact O-N 2.89Å; M49-L53 HydrophobicContact CG-CD1 4.37Å; M49-L53 WeakPolarHBondContact O-CB 3.29Å; M49-L53 VanDerWaalsContact O-CG 3.23Å; M49-L53 WeakPolarHBondContact O-CG 3.29Å; M49-L53 PolarHBondContact O-N 3.26Å
50	Q	86.1	Confident	80.1	Confident	90 Å²	90	106.6 Å²	106.6	42%	0.421	55%	0.553	S	S	.	*	H	α-helix	trans	-65.1	-37.5	177.4	-165.1	174.3	5.3	0	0	111.8	F46 E47 F48 L53 Q54	F46-Q50 VanDerWaalsContact CE1-OE1 3.32Å; F46-Q50 VanDerWaalsContact O-CB 3.29Å; F46-Q50 WeakPolarHBondContact O-CB 3.42Å; F46-Q50 PolarHBondContact O-N 2.95Å; E47-Q50 PolarHBondContact O-N 2.81Å; F48-Q50 VanDerWaalsContact C-N 3.34Å; F48-Q50 PolarHBondContact O-N 3.07Å; Q50-L53 PolarHBondContact O-N 3.32Å; Q50-Q54 VanDerWaalsContact O-CG 3.25Å; Q50-Q54 WeakPolarHBondContact O-CG 3.41Å; Q50-Q54 PolarHBondContact O-N 2.92Å
51	R	85.6	Confident	81.8	Confident	160 Å²	160	108.6 Å²	108.6	60%	0.604	55%	0.552	S	S	*	*	H	α-helix	trans	-66.4	-45.4	173.1	-171.2	157.1	-166.2	79.8	2.9	112.1	E47 F48 M49 L53 Q54 D55	E47-R51 WeakPolarHBondContact O-CB 3.42Å; E47-R51 PolarHBondContact O-N 3.31Å; F48-R51 PolarHBondContact O-N 3.45Å; M49-R51 VanDerWaalsContact C-N 3.33Å; M49-R51 PolarHBondContact O-N 3.38Å; R51-L53 VanDerWaalsContact C-N 3.3Å; R51-L53 PolarHBondContact O-N 2.92Å; R51-Q54 PolarHBondContact O-N 3.38Å; R51-Q54 VanDerWaalsContact O-N 3.16Å; R51-D55 PolarHBondContact O-N 3.5Å
52	A	89.4	Confident	83.5	Confident	38 Å²	38	108 Å²	108	31%	0.314	55%	0.545	S	S	.	.	H	α-helix	trans	-59.2	-41.5	175.1	0	0	0	0	0	111.9	F48 M49 Q54 D55 L56	F48-A52 WeakPolarHBondContact O-CB 3.29Å; F48-A52 PolarHBondContact O-N 3.44Å; M49-A52 PolarHBondContact O-N 2.89Å; A52-Q54 PolarHBondContact O-N 2.95Å; A52-D55 PolarHBondContact O-N 3.16Å; A52-L56 WeakPolarHBondContact O-CB 3.28Å; A52-L56 VanDerWaalsContact O-CG 3.29Å; A52-L56 WeakPolarHBondContact O-CG 3.25Å; A52-L56 PolarHBondContact O-N 3.48Å
53	L	90.3	Very high	84.9	Confident	106 Å²	106	105.4 Å²	105.4	56%	0.555	53%	0.53	S	S	*	.	H	α-helix	trans	-65.3	-37.8	176.2	-72.6	172.2	0	0	0	112.5	M49 Q50 R51 K57	M49-L53 HydrophobicContact CG-CD1 4.37Å; M49-L53 WeakPolarHBondContact O-CB 3.29Å; M49-L53 VanDerWaalsContact O-CG 3.23Å; M49-L53 WeakPolarHBondContact O-CG 3.29Å; M49-L53 PolarHBondContact O-N 3.26Å; Q50-L53 PolarHBondContact O-N 3.32Å; R51-L53 VanDerWaalsContact C-N 3.3Å; R51-L53 PolarHBondContact O-N 2.92Å; L53-K57 VanDerWaalsContact O-CB 3.28Å; L53-K57 WeakPolarHBondContact O-CB 3.27Å; L53-K57 PolarHBondContact O-N 2.76Å
54	Q	91.8	Very high	86.4	Confident	102 Å²	102	105.3 Å²	105.3	48%	0.477	52%	0.524	S	S	.	.	H	α-helix	trans	-67.1	-41.8	175.7	-74	171.7	10.4	0	0	112	Q50 R51 A52 K57 K58	Q50-Q54 VanDerWaalsContact O-CG 3.25Å; Q50-Q54 WeakPolarHBondContact O-CG 3.41Å; Q50-Q54 PolarHBondContact O-N 2.92Å; R51-Q54 PolarHBondContact O-N 3.38Å; R51-Q54 VanDerWaalsContact O-N 3.16Å; A52-Q54 PolarHBondContact O-N 2.95Å; Q54-K57 PolarHBondContact O-N 2.93Å; Q54-K58 WeakPolarHBondContact O-CB 3.4Å; Q54-K58 PolarHBondContact O-N 3.41Å
55	D	90.8	Very high	87.2	Confident	80 Å²	80	104.1 Å²	104.1	43%	0.428	53%	0.527	S	S	.	.	H	α-helix	trans	-67.2	-40.4	177.6	-72.5	-21.9	0	0	0	111.6	R51 A52 K58 T59	R51-D55 PolarHBondContact O-N 3.5Å; A52-D55 PolarHBondContact O-N 3.16Å; D55-K58 PolarHBondContact O-N 3.02Å; D55-T59 WeakPolarHBondContact O-CB 3.38Å; D55-T59 PolarHBondContact O-N 3.38Å; D55-T59 PolarHBondContact O-OG1 3.42Å
56	L	92.7	Very high	87.6	Confident	115 Å²	115	109.6 Å²	109.6	60%	0.602	54%	0.537	S	S	*	.	H	α-helix	trans	-60.3	-47.3	171.3	-76.1	169	0	0	0	111.5	A52 K58 T59 A60	A52-L56 WeakPolarHBondContact O-CB 3.28Å; A52-L56 VanDerWaalsContact O-CG 3.29Å; A52-L56 WeakPolarHBondContact O-CG 3.25Å; A52-L56 PolarHBondContact O-N 3.48Å; L56-K58 PolarHBondContact O-N 3.47Å; L56-T59 PolarHBondContact O-N 3.49Å; L56-A60 WeakPolarHBondContact O-CB 3.5Å; L56-A60 PolarHBondContact O-N 2.97Å
57	K	93.1	Very high	88.6	Confident	137 Å²	137	106 Å²	106	60%	0.596	53%	0.527	S	S	*	.	H	α-helix	trans	-59.3	-45.8	177.9	-177.9	172.9	-178.8	172.9	0	111.5	L53 Q54 T59 A60 F61	L53-K57 VanDerWaalsContact O-CB 3.28Å; L53-K57 WeakPolarHBondContact O-CB 3.27Å; L53-K57 PolarHBondContact O-N 2.76Å; Q54-K57 PolarHBondContact O-N 2.93Å; K57-T59 VanDerWaalsContact C-N 3.33Å; K57-T59 PolarHBondContact O-N 3.08Å; K57-A60 PolarHBondContact O-N 3.25Å; K57-F61 HydrophobicContact CD-CE2 4.17Å; K57-F61 HydrophobicContact CG-CD2 3.84Å; K57-F61 HydrophobicContact CG-CE2 3.54Å; K57-F61 WeakPolarHBondContact O-CD2 3.34Å; K57-F61 PolarHBondContact O-N 3.2Å; K57-F61 VanDerWaalsContact O-N 3.08Å
58	K	94.3	Very high	89.3	Confident	154 Å²	154	105.9 Å²	105.9	67%	0.67	53%	0.527	S	S	*	.	H	α-helix	trans	-60.2	-43.4	176.1	179.7	176.6	178.8	171.4	0	111.8	Q54 D55 L56 F61 N62	Q54-K58 WeakPolarHBondContact O-CB 3.4Å; Q54-K58 PolarHBondContact O-N 3.41Å; D55-K58 PolarHBondContact O-N 3.02Å; L56-K58 PolarHBondContact O-N 3.47Å; K58-F61 PolarHBondContact O-N 3.44Å; K58-N62 WeakPolarHBondContact O-CB 3.41Å; K58-N62 PolarHBondContact O-N 3.19Å
59	T	93.8	Very high	89.5	Confident	78 Å²	78	102.1 Å²	102.1	48%	0.479	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-45.4	179.2	-56.2	0	0	0	0	111	D55 L56 K57 F61 N62 L63	D55-T59 WeakPolarHBondContact O-CB 3.38Å; D55-T59 PolarHBondContact O-N 3.38Å; D55-T59 PolarHBondContact O-OG1 3.42Å; L56-T59 PolarHBondContact O-N 3.49Å; K57-T59 VanDerWaalsContact C-N 3.33Å; K57-T59 PolarHBondContact O-N 3.08Å; T59-F61 PolarHBondContact O-N 2.88Å; T59-N62 PolarHBondContact O-N 2.91Å; T59-L63 HydrophobicContact CG2-CD1 4.18Å; T59-L63 WeakPolarHBondContact O-CG 3.39Å; T59-L63 PolarHBondContact O-N 3.3Å
60	A	92.5	Very high	89.8	Confident	57 Å²	57	100.9 Å²	100.9	47%	0.471	51%	0.513	S	S	.	.	H	α-helix	trans	-58.6	-47.8	176.9	0	0	0	0	0	112	L56 K57 N62 L63 D64	L56-A60 WeakPolarHBondContact O-CB 3.5Å; L56-A60 PolarHBondContact O-N 2.97Å; K57-A60 PolarHBondContact O-N 3.25Å; A60-N62 VanDerWaalsContact C-N 3.34Å; A60-N62 PolarHBondContact O-N 3.39Å; A60-L63 PolarHBondContact O-N 2.89Å; A60-D64 WeakPolarHBondContact O-CB 3.14Å; A60-D64 PolarHBondContact O-N 3.47Å
61	F	92.1	Very high	90.1	Very high	128 Å²	128	99.9 Å²	99.9	56%	0.561	51%	0.512	S	S	*	.	H	α-helix	trans	-63.8	-37.2	177.2	-79.2	-61.5	0	0	0	113.5	K57 K58 T59 D64 A65	K57-F61 HydrophobicContact CD-CE2 4.17Å; K57-F61 HydrophobicContact CG-CD2 3.84Å; K57-F61 HydrophobicContact CG-CE2 3.54Å; K57-F61 WeakPolarHBondContact O-CD2 3.34Å; K57-F61 PolarHBondContact O-N 3.2Å; K57-F61 VanDerWaalsContact O-N 3.08Å; K58-F61 PolarHBondContact O-N 3.44Å; T59-F61 PolarHBondContact O-N 2.88Å; F61-D64 PolarHBondContact O-N 2.84Å; F61-A65 PolarHBondContact O-N 3.36Å; F61-A65 VanDerWaalsContact O-N 3.1Å
62	N	88.1	Confident	90.3	Very high	109 Å²	109	97.7 Å²	97.7	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-66.4	-41.6	177.3	-173.5	-94.3	0	0	0	111.6	K58 T59 A60 R66	K58-N62 WeakPolarHBondContact O-CB 3.41Å; K58-N62 PolarHBondContact O-N 3.19Å; T59-N62 PolarHBondContact O-N 2.91Å; A60-N62 VanDerWaalsContact C-N 3.34Å; A60-N62 PolarHBondContact O-N 3.39Å; N62-R66 WeakPolarHBondContact O-CB 3.48Å; N62-R66 PolarHBondContact O-N 2.65Å
63	L	88.1	Confident	90.3	Very high	96 Å²	96	102.4 Å²	102.4	50%	0.503	52%	0.522	S	S	.	.	H	α-helix	trans	-63.7	-43	175.4	-71	175.1	0	0	0	111.4	T59 A60 R66 T67	T59-L63 HydrophobicContact CG2-CD1 4.18Å; T59-L63 WeakPolarHBondContact O-CG 3.39Å; T59-L63 PolarHBondContact O-N 3.3Å; A60-L63 PolarHBondContact O-N 2.89Å; L63-R66 PolarHBondContact O-N 2.94Å; L63-T67 VanDerWaalsContact O-CB 3.29Å; L63-T67 WeakPolarHBondContact O-CB 3.46Å; L63-T67 PolarHBondContact O-N 3.44Å; L63-T67 PolarHBondContact O-OG1 3.5Å
64	D	89.5	Confident	90.2	Very high	90 Å²	90	100 Å²	100	48%	0.481	52%	0.517	S	S	.	.	H	α-helix	trans	-59.3	-55.9	179.4	-171.2	59.3	0	0	0	111.8	A60 F61 R66 T67 E68	A60-D64 WeakPolarHBondContact O-CB 3.14Å; A60-D64 PolarHBondContact O-N 3.47Å; F61-D64 PolarHBondContact O-N 2.84Å; D64-R66 VanDerWaalsContact C-N 3.25Å; D64-R66 PolarHBondContact O-N 2.95Å; D64-T67 WeakPolarHBondContact O-CA 3.31Å; D64-T67 WeakPolarHBondContact O-CB 3.29Å; D64-T67 PolarHBondContact O-N 3.04Å; D64-E68 PolarHBondContact O-N 3.19Å
65	A	86.6	Confident	90.1	Very high	53 Å²	53	100.4 Å²	100.4	44%	0.438	52%	0.519	S	S	.	.	H	α-helix	trans	-57.9	-37.1	178.3	0	0	0	0	0	113	F61 T69	F61-A65 PolarHBondContact O-N 3.36Å; F61-A65 VanDerWaalsContact O-N 3.1Å; A65-T69 PolarHBondContact O-OG1 2.99Å
66	R	84.8	Confident	90	Very high	166 Å²	166	105.6 Å²	105.6	63%	0.626	53%	0.532	S	S	*	.	H	α-helix	trans	-70.5	-37.6	175.7	-170.9	177.7	-179.6	-175.3	-0.4	111.5	N62 L63 D64 T69 L70	N62-R66 WeakPolarHBondContact O-CB 3.48Å; N62-R66 PolarHBondContact O-N 2.65Å; L63-R66 PolarHBondContact O-N 2.94Å; D64-R66 VanDerWaalsContact C-N 3.25Å; D64-R66 PolarHBondContact O-N 2.95Å; R66-T69 PolarHBondContact O-N 3.1Å; R66-L70 HydrophobicContact CG-CD1 4.2Å; R66-L70 VanDerWaalsContact O-CG 3.3Å; R66-L70 WeakPolarHBondContact O-CG 3.49Å; R66-L70 PolarHBondContact O-N 2.88Å; R66-L70 VanDerWaalsContact O-N 3.1Å
67	T	91	Very high	89.7	Confident	71 Å²	71	107.6 Å²	107.6	44%	0.436	53%	0.532	S	S	.	.	H	α-helix	trans	-68.2	-42.7	-179.1	-57.6	0	0	0	0	110.9	L63 D64 T69 L70 V71	L63-T67 VanDerWaalsContact O-CB 3.29Å; L63-T67 WeakPolarHBondContact O-CB 3.46Å; L63-T67 PolarHBondContact O-N 3.44Å; L63-T67 PolarHBondContact O-OG1 3.5Å; D64-T67 WeakPolarHBondContact O-CA 3.31Å; D64-T67 WeakPolarHBondContact O-CB 3.29Å; D64-T67 PolarHBondContact O-N 3.04Å; T67-T69 VanDerWaalsContact C-N 3.29Å; T67-T69 PolarHBondContact O-N 3.23Å; T67-L70 PolarHBondContact O-N 3.36Å; T67-V71 HydrophobicContact CG2-CG2 4.07Å; T67-V71 WeakPolarHBondContact O-CB 3.43Å; T67-V71 VanDerWaalsContact O-CG2 3.31Å; T67-V71 WeakPolarHBondContact O-CG2 3.41Å; T67-V71 PolarHBondContact O-N 3.1Å
68	E	89.5	Confident	89.3	Confident	117 Å²	117	103.6 Å²	103.6	55%	0.547	52%	0.524	S	S	.	.	H	α-helix	trans	-53.6	-47.1	174.3	-68.8	-175.8	149.5	0	0	111.8	D64 L70 V71 L72	D64-E68 PolarHBondContact O-N 3.19Å; E68-L70 VanDerWaalsContact C-N 3.33Å; E68-L70 PolarHBondContact O-N 3.42Å; E68-V71 PolarHBondContact O-N 3.45Å; E68-L72 WeakPolarHBondContact O-CG 3.46Å; E68-L72 PolarHBondContact O-N 3.25Å
69	T	86.8	Confident	88.8	Confident	83 Å²	83	102 Å²	102	51%	0.509	52%	0.522	S	S	.	.	H	α-helix	trans	-64.3	-38.8	178.3	-58	0	0	0	0	112.1	A65 R66 T67 R73	A65-T69 PolarHBondContact O-OG1 2.99Å; R66-T69 PolarHBondContact O-N 3.1Å; T67-T69 VanDerWaalsContact C-N 3.29Å; T67-T69 PolarHBondContact O-N 3.23Å; T69-R73 WeakPolarHBondContact O-CB 3.48Å; T69-R73 PolarHBondContact O-N 2.87Å; T69-R73 VanDerWaalsContact O-N 3.1Å
70	L	89.5	Confident	88.2	Confident	89 Å²	89	102 Å²	102	47%	0.466	53%	0.525	S	S	.	.	H	α-helix	trans	-70.2	-40.5	178.7	-72	173.2	0	0	0	111.9	R66 T67 E68 R73 A74	R66-L70 HydrophobicContact CG-CD1 4.2Å; R66-L70 VanDerWaalsContact O-CG 3.3Å; R66-L70 WeakPolarHBondContact O-CG 3.49Å; R66-L70 PolarHBondContact O-N 2.88Å; R66-L70 VanDerWaalsContact O-N 3.1Å; T67-L70 PolarHBondContact O-N 3.36Å; E68-L70 VanDerWaalsContact C-N 3.33Å; E68-L70 PolarHBondContact O-N 3.42Å; L70-R73 PolarHBondContact O-N 3.06Å; L70-A74 WeakPolarHBondContact O-CB 3.5Å; L70-A74 PolarHBondContact O-N 2.99Å
71	V	92.4	Very high	87.5	Confident	69 Å²	69	105.2 Å²	105.2	42%	0.418	53%	0.534	S	S	.	.	H	α-helix	trans	-62.3	-51.7	176.3	170.1	0	0	0	0	110	T67 E68 R73 A74 E75	T67-V71 HydrophobicContact CG2-CG2 4.07Å; T67-V71 WeakPolarHBondContact O-CB 3.43Å; T67-V71 VanDerWaalsContact O-CG2 3.31Å; T67-V71 WeakPolarHBondContact O-CG2 3.41Å; T67-V71 PolarHBondContact O-N 3.1Å; E68-V71 PolarHBondContact O-N 3.45Å; V71-R73 VanDerWaalsContact C-N 3.26Å; V71-R73 PolarHBondContact O-N 2.84Å; V71-A74 WeakPolarHBondContact O-CA 3.3Å; V71-A74 WeakPolarHBondContact O-CB 3.34Å; V71-A74 PolarHBondContact O-N 3.38Å; V71-E75 HydrophobicContact CG1-CG 4.41Å; V71-E75 PolarHBondContact O-N 3.31Å
72	L	90	Very high	86.4	Confident	113 Å²	113	103.4 Å²	103.4	59%	0.592	54%	0.536	S	S	*	.	H	α-helix	trans	-58.4	-38.6	177.3	-70	173.6	0	0	0	112.3	E68 R76	E68-L72 WeakPolarHBondContact O-CG 3.46Å; E68-L72 PolarHBondContact O-N 3.25Å; L72-R76 WeakPolarHBondContact O-CB 3.42Å; L72-R76 PolarHBondContact O-N 3.48Å
73	R	88.5	Confident	85.1	Confident	138 Å²	138	103.5 Å²	103.5	52%	0.521	54%	0.535	S	S	.	.	H	α-helix	trans	-66.9	-38.4	174.8	179.8	179.4	-105	136.8	-7.3	111.9	T69 L70 V71 R77	T69-R73 WeakPolarHBondContact O-CB 3.48Å; T69-R73 PolarHBondContact O-N 2.87Å; T69-R73 VanDerWaalsContact O-N 3.1Å; L70-R73 PolarHBondContact O-N 3.06Å; V71-R73 VanDerWaalsContact C-N 3.26Å; V71-R73 PolarHBondContact O-N 2.84Å; R73-R77 VanDerWaalsContact O-CG 3.3Å; R73-R77 WeakPolarHBondContact O-CG 3.3Å; R73-R77 PolarHBondContact O-N 3.38Å; R73-R77 VanDerWaalsContact O-N 3.08Å
74	A	88.5	Confident	83.7	Confident	55 Å²	55	102.8 Å²	102.8	46%	0.455	54%	0.536	S	S	.	.	H	α-helix	trans	-68.1	-45.1	177.4	0	0	0	0	0	111.4	L70 V71 R76 R77 A78	L70-A74 WeakPolarHBondContact O-CB 3.5Å; L70-A74 PolarHBondContact O-N 2.99Å; V71-A74 WeakPolarHBondContact O-CA 3.3Å; V71-A74 WeakPolarHBondContact O-CB 3.34Å; V71-A74 PolarHBondContact O-N 3.38Å; A74-R76 PolarHBondContact O-N 2.81Å; A74-R77 PolarHBondContact O-N 3.1Å; A74-A78 WeakPolarHBondContact O-CB 3.01Å; A74-A78 PolarHBondContact O-N 3.31Å
75	E	88.8	Confident	82.2	Confident	111 Å²	111	104.1 Å²	104.1	52%	0.519	55%	0.547	S	S	.	.	H	α-helix	trans	-61.2	-44.6	175.2	-71.3	-175.7	164.3	0	0	111.8	V71 R77 A78 L79	V71-E75 HydrophobicContact CG1-CG 4.41Å; V71-E75 PolarHBondContact O-N 3.31Å; E75-R77 VanDerWaalsContact C-N 3.31Å; E75-R77 PolarHBondContact O-N 2.92Å; E75-A78 PolarHBondContact O-N 3.22Å; E75-L79 WeakPolarHBondContact O-CB 3.36Å; E75-L79 WeakPolarHBondContact O-CG 3.41Å; E75-L79 PolarHBondContact O-N 3.14Å
76	R	88.6	Confident	80.8	Confident	188 Å²	188	106.4 Å²	106.4	71%	0.709	56%	0.556	S	S	*	*	H	α-helix	trans	-59.8	-42.4	175.5	-175.1	178.7	177.4	-169.5	0.4	111.9	L72 A74 L79 C80	L72-R76 WeakPolarHBondContact O-CB 3.42Å; L72-R76 PolarHBondContact O-N 3.48Å; A74-R76 PolarHBondContact O-N 2.81Å; R76-L79 PolarHBondContact O-N 3.36Å; R76-C80 WeakPolarHBondContact O-CB 3.37Å; R76-C80 PolarHBondContact O-N 3.08Å; R76-C80 PolarHBondContact O-SG 3.09Å
77	R	86.9	Confident	79.5	Confident	158 Å²	158	103 Å²	103	60%	0.596	55%	0.554	S	S	*	*	H	α-helix	trans	-62.9	-47.3	175.3	-75.3	173.4	-179.3	178.1	-1.5	110.9	R73 A74 E75 L79 C80 D81	R73-R77 VanDerWaalsContact O-CG 3.3Å; R73-R77 WeakPolarHBondContact O-CG 3.3Å; R73-R77 PolarHBondContact O-N 3.38Å; R73-R77 VanDerWaalsContact O-N 3.08Å; A74-R77 PolarHBondContact O-N 3.1Å; E75-R77 VanDerWaalsContact C-N 3.31Å; E75-R77 PolarHBondContact O-N 2.92Å; R77-L79 VanDerWaalsContact C-N 3.32Å; R77-L79 PolarHBondContact O-N 3.4Å; R77-C80 PolarHBondContact O-N 2.81Å; R77-C80 VanDerWaalsContact O-N 3.14Å; R77-D81 WeakPolarHBondContact O-CB 3.34Å; R77-D81 PolarHBondContact O-N 3.18Å
78	A	84.9	Confident	77.8	Confident	52 Å²	52	107.2 Å²	107.2	43%	0.43	57%	0.573	S	S	.	*	H	α-helix	trans	-58.7	-41.4	176.4	0	0	0	0	0	112.4	A74 E75 D81 C82	A74-A78 WeakPolarHBondContact O-CB 3.01Å; A74-A78 PolarHBondContact O-N 3.31Å; E75-A78 PolarHBondContact O-N 3.22Å; A78-D81 PolarHBondContact O-N 2.97Å; A78-C82 WeakPolarHBondContact O-CB 3.49Å; A78-C82 PolarHBondContact O-N 3.43Å; A78-C82 PolarHBondContact O-SG 3.07Å
79	L	84.2	Confident	75.8	Confident	121 Å²	121	115.8 Å²	115.8	63%	0.634	60%	0.6	S	S	*	*	H	α-helix	trans	-64.5	-42.2	174.8	-73.5	172.6	0	0	0	112.4	E75 R76 R77 C82 M83	E75-L79 WeakPolarHBondContact O-CB 3.36Å; E75-L79 WeakPolarHBondContact O-CG 3.41Å; E75-L79 PolarHBondContact O-N 3.14Å; R76-L79 PolarHBondContact O-N 3.36Å; R77-L79 VanDerWaalsContact C-N 3.32Å; R77-L79 PolarHBondContact O-N 3.4Å; L79-C82 PolarHBondContact O-N 2.83Å; L79-M83 WeakPolarHBondContact O-CB 3.36Å; L79-M83 PolarHBondContact O-N 3.27Å; L79-M83 VanDerWaalsContact O-N 3.09Å
80	C	81.4	Confident	75.2	Confident	78 Å²	78	117.4 Å²	117.4	53%	0.527	60%	0.604	S	S	.	*	H	α-helix	trans	-65.9	-39.3	175.5	-70.5	0	0	0	0	112.1	R76 R77 C82 M83	R76-C80 WeakPolarHBondContact O-CB 3.37Å; R76-C80 PolarHBondContact O-N 3.08Å; R76-C80 PolarHBondContact O-SG 3.09Å; R77-C80 PolarHBondContact O-N 2.81Å; R77-C80 VanDerWaalsContact O-N 3.14Å; C80-C82 VanDerWaalsContact C-N 3.3Å; C80-C82 PolarHBondContact O-N 2.97Å; C80-M83 WeakPolarHBondContact O-CB 3.5Å; C80-M83 PolarHBondContact O-N 3.4Å; C80-M83 VanDerWaalsContact O-N 3.07Å
81	D	77.2	Confident	74.5	Confident	125 Å²	125	118.9 Å²	118.9	67%	0.668	61%	0.612	S	S	*	*	H	α-helix	trans	-69.7	-28.2	177.1	-66.7	-22.3	0	0	0	111.8	R77 A78 M83 P84	R77-D81 WeakPolarHBondContact O-CB 3.34Å; R77-D81 PolarHBondContact O-N 3.18Å; A78-D81 PolarHBondContact O-N 2.97Å; D81-M83 VanDerWaalsContact C-N 3.34Å; D81-P84 WeakPolarHBondContact O-CD 3.42Å
82	C	69.4	Low	73.5	Confident	90 Å²	90	121.7 Å²	121.7	61%	0.608	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.7	-11.7	169.8	-70	0	0	0	0	113.7	A78 L79 C80	A78-C82 WeakPolarHBondContact O-CB 3.49Å; A78-C82 PolarHBondContact O-N 3.43Å; A78-C82 PolarHBondContact O-SG 3.07Å; L79-C82 PolarHBondContact O-N 2.83Å; C80-C82 VanDerWaalsContact C-N 3.3Å; C80-C82 PolarHBondContact O-N 2.97Å
83	M	61.3	Low	72.5	Confident	111 Å²	111	122.2 Å²	122.2	55%	0.547	62%	0.624	S	S	.	*	S	Bend	trans	-90	40.9	178.6	-100	-75.6	150.7	0	0	115	L79 C80 D81 T87	L79-M83 WeakPolarHBondContact O-CB 3.36Å; L79-M83 PolarHBondContact O-N 3.27Å; L79-M83 VanDerWaalsContact O-N 3.09Å; C80-M83 WeakPolarHBondContact O-CB 3.5Å; C80-M83 PolarHBondContact O-N 3.4Å; C80-M83 VanDerWaalsContact O-N 3.07Å; D81-M83 VanDerWaalsContact C-N 3.34Å; M83-T87 HydrophobicContact CE-CG2 4Å; M83-T87 HydrophobicContact SD-CG2 3.79Å
84	P	58.2	Low	71.5	Confident	81 Å²	81	121.2 Å²	121.2	53%	0.526	63%	0.631	S	S	.	*	S	Bend	trans	-137.2	43	158.9	42.2	-29.2	0	0	0	114.6	D81	D81-P84 WeakPolarHBondContact O-CD 3.42Å
85	T	57	Low	70.4	Confident	117 Å²	117	125.6 Å²	125.6	72%	0.718	64%	0.643	S	S	*	*	S	Bend	trans	-139.1	-15.5	168.9	44.2	0	0	0	0	115.9
86	T	57.3	Low	69	Low	101 Å²	101	126.6 Å²	126.6	62%	0.62	65%	0.651	S	S	*	*	S	Bend	trans	-106.9	-16.7	-176.7	49.6	0	0	0	0	114.5
87	T	57.2	Low	67.5	Low	95 Å²	95	121.9 Å²	121.9	58%	0.583	65%	0.647	S	S	*	*	S	Bend	trans	-98.6	-1.4	-178.6	47.1	0	0	0	0	114.5	M83	M83-T87 HydrophobicContact CE-CG2 4Å; M83-T87 HydrophobicContact SD-CG2 3.79Å
88	L	56.5	Low	65.9	Low	160 Å²	160	118.9 Å²	118.9	84%	0.838	65%	0.651	S	S	*	*			trans	-103.4	45.9	171.9	-75.7	172.7	0	0	0	111.7
89	R	46.4	Very low	64.2	Low	296 Å²	296	125 Å²	125	100%	1.117	67%	0.671	S	S	*	*			trans	-130.3	0	171	-156.6	-175.7	-176	97.4	1.6	111.1

Retrieved 89 of 89 residues in 36.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).