A0A087XMW3_POEFO Loading...

Basic leucine zipper transcriptional factor ATF-like

AlphaFold DB , UniProt , Accession A0A087XMW3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 125 aa.

						>A0A087XMW3_POEFO|A0A087XMW3
AMAQGSDSNDASYKSPSPGSRPSSSDDVKKVMRREKNRIAAQKSRMRQTQKADSLHLESENLEKENAALRKEVKQLTEEANYLSSVLSSHEPLCTGLAPQTPDLLYPPHQSSYHRQHIAVPHYQR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	49.8	Very low	54.8	Low	160 Å²	160	134 Å²	134	100%	1.322	86%	0.857	S	S	*	*				0	116.5	0	0	0	0	0	0	107.8
2	M	44.9	Very low	54.7	Low	189 Å²	189	131.2 Å²	131.2	93%	0.931	84%	0.843	S	S	*	*			trans	-97.2	125.2	178	-68.5	-158.9	175.4	0	0	109
3	A	56.2	Low	54.9	Low	105 Å²	105	135.6 Å²	135.6	87%	0.868	84%	0.836	S	S	*	*			trans	-93.2	114.8	166.9	0	0	0	0	0	108.1
4	Q	56.6	Low	55.1	Low	181 Å²	181	140.1 Å²	140.1	85%	0.846	84%	0.838	S	S	*	*			trans	-82.3	111.5	172.8	-64.7	-178.9	-7.6	0	0	108
5	G	48.9	Very low	55.3	Low	75 Å²	75	135.2 Å²	135.2	77%	0.773	81%	0.813	S	S	*	*			trans	-100.7	89.4	165.3	0	0	0	0	0	108.8	D7	G5-D7 PolarHBondContact O-N 3.1Å
6	S	62.2	Low	55.6	Low	103 Å²	103	134.5 Å²	134.5	72%	0.72	81%	0.812	S	S	*	*			trans	-81.3	102	167.4	-70.2	0	0	0	0	108.6
7	D	56.8	Low	55.6	Low	158 Å²	158	132.2 Å²	132.2	85%	0.845	80%	0.804	S	S	*	*			trans	-115.6	95.7	162.4	-78.9	-41.2	0	0	0	108.8	G5 N9	G5-D7 PolarHBondContact O-N 3.1Å; D7-N9 PolarHBondContact O-N 2.87Å
8	S	59.4	Low	55.7	Low	123 Å²	123	132.9 Å²	132.9	86%	0.86	81%	0.812	S	S	*	*			trans	-61.6	99.6	165.6	-66.3	0	0	0	0	109.1
9	N	61	Low	55.6	Low	154 Å²	154	129.7 Å²	129.7	82%	0.824	81%	0.807	S	S	*	*			trans	-91.4	100.6	164.2	-145.3	11.7	0	0	0	107.7	D7 A11	D7-N9 PolarHBondContact O-N 2.87Å; N9-A11 PolarHBondContact O-N 3.22Å
10	D	50.4	Low	55.7	Low	149 Å²	149	128.3 Å²	128.3	80%	0.797	80%	0.803	S	S	*	*			trans	-65.5	73.4	168.6	-178.9	48.3	0	0	0	109	S12	D10-S12 PolarHBondContact O-N 3.23Å
11	A	56.5	Low	56	Low	77 Å²	77	133.5 Å²	133.5	64%	0.636	81%	0.807	S	S	*	*			trans	-71.6	92.6	162.9	0	0	0	0	0	105.9	N9 Y13	N9-A11 PolarHBondContact O-N 3.22Å; A11-Y13 PolarHBondContact O-N 3.16Å
12	S	53.3	Low	56.4	Low	100 Å²	100	129.6 Å²	129.6	70%	0.699	77%	0.768	S	S	*	*			trans	-51.8	88.1	167.1	-172	0	0	0	0	108.9	D10 K14	D10-S12 PolarHBondContact O-N 3.23Å; S12-K14 VanDerWaalsContact C-N 3.31Å; S12-K14 PolarHBondContact O-N 2.87Å
13	Y	57.2	Low	57.3	Low	189 Å²	189	123.4 Å²	123.4	74%	0.741	74%	0.743	S	S	*	*			trans	-71.7	97.9	172.3	77.7	-77.4	0	0	0	104.4	A11 S15	A11-Y13 PolarHBondContact O-N 3.16Å; Y13-S15 WeakPolarHBondContact CD2-OG 3.35Å; Y13-S15 WeakPolarHBondContact CE2-OG 3.49Å; Y13-S15 PolarHBondContact O-N 3.15Å
14	K	58.8	Low	57.9	Low	199 Å²	199	123.2 Å²	123.2	87%	0.865	74%	0.736	S	S	*	*			trans	-66.9	93.6	171.3	-153.1	170.8	-173.4	-169.7	0	106.5	S12	S12-K14 VanDerWaalsContact C-N 3.31Å; S12-K14 PolarHBondContact O-N 2.87Å
15	S	57.8	Low	58.5	Low	66 Å²	66	117.6 Å²	117.6	46%	0.462	72%	0.717	S	S	.	*	P	Polyproline II helix	trans	-48.7	128.3	174.4	-68.3	0	0	0	0	108.5	Y13 S17	Y13-S15 WeakPolarHBondContact CD2-OG 3.35Å; Y13-S15 WeakPolarHBondContact CE2-OG 3.49Å; Y13-S15 PolarHBondContact O-N 3.15Å; S15-S17 PolarHBondContact O-N 2.82Å; S15-S17 VanDerWaalsContact O-N 3.08Å
16	P	59.1	Low	59.9	Low	124 Å²	124	117.5 Å²	117.5	81%	0.805	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-60	118.3	173.7	-16.6	28.9	0	0	0	108.1
17	S	56.1	Low	60.9	Low	96 Å²	96	116.1 Å²	116.1	67%	0.671	68%	0.683	S	S	*	*	P	Polyproline II helix	trans	-52.6	135.5	174.1	-77.1	0	0	0	0	109.9	S15 G19	S15-S17 PolarHBondContact O-N 2.82Å; S15-S17 VanDerWaalsContact O-N 3.08Å; S17-G19 PolarHBondContact O-N 2.99Å
18	P	57.2	Low	62.4	Low	145 Å²	145	112.9 Å²	112.9	94%	0.942	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.2	8.9	-173.5	27.3	-33.3	0	0	0	114.8
19	G	54.5	Low	64	Low	71 Å²	71	112.5 Å²	112.5	73%	0.732	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.3	-9.3	-174.3	0	0	0	0	0	116.2	S17 R21	S17-G19 PolarHBondContact O-N 2.99Å; G19-R21 PolarHBondContact O-N 2.73Å
20	S	57.6	Low	65.6	Low	102 Å²	102	109.6 Å²	109.6	71%	0.713	63%	0.632	S	S	*	*			trans	-100.3	83.8	-177.7	-52.6	0	0	0	0	110.2	P22	S20-P22 WeakPolarHBondContact O-CD 3.44Å; S20-P22 VanDerWaalsContact O-N 3.13Å
21	R	60.9	Low	67.6	Low	238 Å²	238	107 Å²	107	90%	0.898	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-54.8	119	165.1	-84.2	176.9	152.8	-118.4	-1.1	107.4	G19 S23	G19-R21 PolarHBondContact O-N 2.73Å; R21-S23 PolarHBondContact O-N 3.44Å
22	P	58.9	Low	69.5	Low	78 Å²	78	108.3 Å²	108.3	51%	0.506	62%	0.615	S	S	.	*	P	Polyproline II helix	trans	-57.1	128.1	174.9	22.8	-30	0	0	0	107.3	S20 D26	S20-P22 WeakPolarHBondContact O-CD 3.44Å; S20-P22 VanDerWaalsContact O-N 3.13Å; P22-D26 HydrophobicContact CB-CB 4.24Å
23	S	63.6	Low	71.6	Confident	58 Å²	58	111.6 Å²	111.6	41%	0.406	61%	0.612	S	S	.	*	P	Polyproline II helix	trans	-63.5	151	170.6	74.1	0	0	0	0	107.6	R21 S25 D26 D27	R21-S23 PolarHBondContact O-N 3.44Å; S23-S25 PolarHBondContact O-N 3.46Å; S23-D26 WeakPolarHBondContact CB-OD2 3.41Å; S23-D26 PolarHBondContact N-OD2 2.73Å; S23-D26 WeakPolarHBondContact O-CB 3.46Å; S23-D26 PolarHBondContact O-N 2.99Å; S23-D26 VanDerWaalsContact OG-CG 3.29Å; S23-D26 PolarHBondContact OG-N 3.48Å; S23-D26 PolarHBondContact OG-OD2 3.28Å; S23-D27 PolarHBondContact O-N 3.33Å
24	S	68.5	Low	73.5	Confident	102 Å²	102	110.4 Å²	110.4	71%	0.713	61%	0.606	S	S	*	*	H	α-helix	trans	-48.5	-31.2	174.5	167.7	0	0	0	0	112.5	V28	S24-V28 WeakPolarHBondContact O-CG2 3.46Å; S24-V28 PolarHBondContact O-N 2.91Å
25	S	70.1	Confident	75.3	Confident	63 Å²	63	104.6 Å²	104.6	44%	0.441	58%	0.582	S	S	.	*	H	α-helix	trans	-66	-36.4	173.9	-168.8	0	0	0	0	114	S23 V28 K29	S23-S25 PolarHBondContact O-N 3.46Å; S25-V28 PolarHBondContact O-N 2.89Å; S25-K29 WeakPolarHBondContact O-CG 3.36Å; S25-K29 PolarHBondContact O-N 3.44Å; S25-K29 VanDerWaalsContact O-N 3.13Å
26	D	78.2	Confident	77.3	Confident	72 Å²	72	108.5 Å²	108.5	39%	0.385	59%	0.591	S	S	.	*	H	α-helix	trans	-72	-32.9	-178.9	-62.5	-44.7	0	0	0	112.4	P22 S23 K29 K30	P22-D26 HydrophobicContact CB-CB 4.24Å; S23-D26 WeakPolarHBondContact CB-OD2 3.41Å; S23-D26 PolarHBondContact N-OD2 2.73Å; S23-D26 WeakPolarHBondContact O-CB 3.46Å; S23-D26 PolarHBondContact O-N 2.99Å; S23-D26 VanDerWaalsContact OG-CG 3.29Å; S23-D26 PolarHBondContact OG-N 3.48Å; S23-D26 PolarHBondContact OG-OD2 3.28Å; D26-K29 PolarHBondContact O-N 3.07Å; D26-K30 WeakPolarHBondContact O-CB 3.28Å; D26-K30 PolarHBondContact O-N 3.09Å
27	D	83.5	Confident	79.1	Confident	75 Å²	75	108 Å²	108	40%	0.401	58%	0.581	S	S	.	*	H	α-helix	trans	-68.1	-42	174.5	-75	-33.4	0	0	0	111.7	S23 K29 K30 V31	S23-D27 PolarHBondContact O-N 3.33Å; D27-K29 PolarHBondContact O-N 2.91Å; D27-K30 WeakPolarHBondContact O-CB 3.42Å; D27-K30 PolarHBondContact O-N 3.43Å; D27-K30 VanDerWaalsContact O-N 3.15Å; D27-V31 WeakPolarHBondContact O-CG2 3.39Å; D27-V31 PolarHBondContact O-N 2.92Å
28	V	88.5	Confident	81.1	Confident	90 Å²	90	109.4 Å²	109.4	55%	0.545	57%	0.572	S	S	.	*	H	α-helix	trans	-61	-45.4	174.1	176.8	0	0	0	0	111	S24 S25 K30 V31 M32	S24-V28 WeakPolarHBondContact O-CG2 3.46Å; S24-V28 PolarHBondContact O-N 2.91Å; S25-V28 PolarHBondContact O-N 2.89Å; V28-K30 VanDerWaalsContact C-N 3.28Å; V28-K30 PolarHBondContact O-N 3.43Å; V28-V31 PolarHBondContact O-N 2.92Å; V28-M32 WeakPolarHBondContact O-CG 3.36Å; V28-M32 PolarHBondContact O-N 3.15Å
29	K	92.8	Very high	83.1	Confident	115 Å²	115	106.7 Å²	106.7	50%	0.5	55%	0.549	S	S	.	.	H	α-helix	trans	-61.7	-35.8	175.5	-70.3	171.2	-170.4	165	0	112.2	S25 D26 D27 R33	S25-K29 WeakPolarHBondContact O-CG 3.36Å; S25-K29 PolarHBondContact O-N 3.44Å; S25-K29 VanDerWaalsContact O-N 3.13Å; D26-K29 PolarHBondContact O-N 3.07Å; D27-K29 PolarHBondContact O-N 2.91Å; K29-R33 WeakPolarHBondContact O-CG 3.3Å; K29-R33 PolarHBondContact O-N 3.16Å; K29-R33 PolarHBondContact O-NE 2.91Å
30	K	94	Very high	85.2	Confident	93 Å²	93	105.9 Å²	105.9	40%	0.404	54%	0.535	S	S	.	.	H	α-helix	trans	-68.4	-42.9	177.2	-173.1	178	-179.2	179.5	0	111.7	D26 D27 V28 R33 R34	D26-K30 WeakPolarHBondContact O-CB 3.28Å; D26-K30 PolarHBondContact O-N 3.09Å; D27-K30 WeakPolarHBondContact O-CB 3.42Å; D27-K30 PolarHBondContact O-N 3.43Å; D27-K30 VanDerWaalsContact O-N 3.15Å; V28-K30 VanDerWaalsContact C-N 3.28Å; V28-K30 PolarHBondContact O-N 3.43Å; K30-R33 PolarHBondContact O-N 2.98Å; K30-R34 WeakPolarHBondContact O-CG 3.34Å; K30-R34 PolarHBondContact O-N 2.73Å
31	V	93.6	Very high	87.1	Confident	94 Å²	94	103 Å²	103	57%	0.57	52%	0.518	S	S	*	.	H	α-helix	trans	-60.9	-47.8	174	174	0	0	0	0	110.4	D27 V28 R33 R34 E35	D27-V31 WeakPolarHBondContact O-CG2 3.39Å; D27-V31 PolarHBondContact O-N 2.92Å; V28-V31 PolarHBondContact O-N 2.92Å; V31-R33 VanDerWaalsContact C-N 3.3Å; V31-R33 PolarHBondContact O-N 3.43Å; V31-R34 PolarHBondContact O-N 2.78Å; V31-R34 VanDerWaalsContact O-N 3.15Å; V31-E35 PolarHBondContact O-N 2.69Å
32	M	95.3	Very high	88.9	Confident	105 Å²	105	97.3 Å²	97.3	52%	0.517	50%	0.501	S	S	.	.	H	α-helix	trans	-59.5	-38.6	177	-70.5	-62.4	-69.6	0	0	112.8	V28 K36	V28-M32 WeakPolarHBondContact O-CG 3.36Å; V28-M32 PolarHBondContact O-N 3.15Å; M32-K36 WeakPolarHBondContact O-CB 3.35Å; M32-K36 VanDerWaalsContact O-CG 3.3Å; M32-K36 WeakPolarHBondContact O-CG 3.36Å; M32-K36 PolarHBondContact O-N 3.25Å
33	R	96.9	Very high	90.8	Very high	168 Å²	168	98.5 Å²	98.5	63%	0.634	50%	0.498	S	S	*	.	H	α-helix	trans	-65.9	-43.7	174.9	-78.7	-175.8	-68.1	150.4	-6.4	112.5	K29 K30 V31 E35 K36 N37	K29-R33 WeakPolarHBondContact O-CG 3.3Å; K29-R33 PolarHBondContact O-N 3.16Å; K29-R33 PolarHBondContact O-NE 2.91Å; K30-R33 PolarHBondContact O-N 2.98Å; V31-R33 VanDerWaalsContact C-N 3.3Å; V31-R33 PolarHBondContact O-N 3.43Å; R33-E35 VanDerWaalsContact C-N 3.32Å; R33-K36 PolarHBondContact O-N 2.88Å; R33-N37 WeakPolarHBondContact O-CB 3.29Å; R33-N37 PolarHBondContact O-N 3.42Å
34	R	97.5	Very high	92.5	Very high	164 Å²	164	99.2 Å²	99.2	62%	0.619	50%	0.504	S	S	*	.	H	α-helix	trans	-61.4	-43.5	176.5	-74.2	175.6	174.3	-171.6	-4.4	111	K30 V31 N37 R38	K30-R34 WeakPolarHBondContact O-CG 3.34Å; K30-R34 PolarHBondContact O-N 2.73Å; V31-R34 PolarHBondContact O-N 2.78Å; V31-R34 VanDerWaalsContact O-N 3.15Å; R34-N37 PolarHBondContact O-N 2.7Å; R34-R38 WeakPolarHBondContact O-CB 3.42Å; R34-R38 PolarHBondContact O-N 3.22Å
35	E	97.4	Very high	93.9	Very high	78 Å²	78	103.1 Å²	103.1	36%	0.364	50%	0.502	S	S	.	.	H	α-helix	trans	-65.8	-44.3	179.3	-176.1	57.9	-167.3	0	0	111.9	V31 R33 N37 R38 I39	V31-E35 PolarHBondContact O-N 2.69Å; R33-E35 VanDerWaalsContact C-N 3.32Å; E35-N37 VanDerWaalsContact C-N 3.33Å; E35-N37 PolarHBondContact O-N 3.49Å; E35-R38 WeakPolarHBondContact O-CB 3.44Å; E35-R38 PolarHBondContact O-N 2.9Å; E35-R38 IonicContact OE1-CZ 2.8Å; E35-R38 IonicContact OE1-NE 3.75Å; E35-R38 PolarHBondContact OE1-NE 2.92Å; E35-R38 IonicContact OE1-NH2 3.42Å; E35-R38 PolarHBondContact OE1-NH2 3.39Å; E35-R38 IonicContact OE2-CZ 3.45Å; E35-R38 IonicContact OE2-NE 2.86Å; E35-R38 PolarHBondContact OE2-NE 3.45Å; E35-R38 IonicContact OE2-NH2 2.67Å; E35-I39 HydrophobicContact CG-CD1 4.28Å; E35-I39 WeakPolarHBondContact O-CG1 3.35Å; E35-I39 PolarHBondContact O-N 2.69Å
36	K	98.4	Very high	95.3	Very high	147 Å²	147	104.5 Å²	104.5	64%	0.639	50%	0.503	S	S	*	.	H	α-helix	trans	-58.5	-43.4	172.8	-74.9	178.6	-179.5	-174.1	0	112.2	M32 R33 I39 A40	M32-K36 WeakPolarHBondContact O-CB 3.35Å; M32-K36 VanDerWaalsContact O-CG 3.3Å; M32-K36 WeakPolarHBondContact O-CG 3.36Å; M32-K36 PolarHBondContact O-N 3.25Å; R33-K36 PolarHBondContact O-N 2.88Å; K36-I39 PolarHBondContact O-N 3.24Å; K36-A40 WeakPolarHBondContact O-CB 2.8Å; K36-A40 PolarHBondContact O-N 2.95Å
37	N	97.9	Very high	96.3	Very high	114 Å²	114	107.8 Å²	107.8	61%	0.61	51%	0.51	S	S	*	.	H	α-helix	trans	-67.6	-39	177.9	-176.5	-97.7	0	0	0	112	R33 R34 E35 I39 A40 A41	R33-N37 WeakPolarHBondContact O-CB 3.29Å; R33-N37 PolarHBondContact O-N 3.42Å; R34-N37 PolarHBondContact O-N 2.7Å; E35-N37 VanDerWaalsContact C-N 3.33Å; E35-N37 PolarHBondContact O-N 3.49Å; N37-I39 VanDerWaalsContact C-N 3.34Å; N37-I39 PolarHBondContact O-N 3.4Å; N37-A40 PolarHBondContact O-N 3.29Å; N37-A41 WeakPolarHBondContact O-CB 3.27Å; N37-A41 PolarHBondContact O-N 2.94Å
38	R	98.4	Very high	97	Very high	126 Å²	126	111 Å²	111	48%	0.475	52%	0.523	S	S	.	.	H	α-helix	trans	-57.2	-48.4	174.5	-170.2	-172.7	71.2	76.8	-0.8	110.9	R34 E35 A41 Q42	R34-R38 WeakPolarHBondContact O-CB 3.42Å; R34-R38 PolarHBondContact O-N 3.22Å; E35-R38 WeakPolarHBondContact O-CB 3.44Å; E35-R38 PolarHBondContact O-N 2.9Å; E35-R38 IonicContact OE1-CZ 2.8Å; E35-R38 IonicContact OE1-NE 3.75Å; E35-R38 PolarHBondContact OE1-NE 2.92Å; E35-R38 IonicContact OE1-NH2 3.42Å; E35-R38 PolarHBondContact OE1-NH2 3.39Å; E35-R38 IonicContact OE2-CZ 3.45Å; E35-R38 IonicContact OE2-NE 2.86Å; E35-R38 PolarHBondContact OE2-NE 3.45Å; E35-R38 IonicContact OE2-NH2 2.67Å; R38-A41 PolarHBondContact O-N 2.88Å; R38-Q42 WeakPolarHBondContact O-CB 3.42Å; R38-Q42 PolarHBondContact O-N 3.2Å
39	I	98.3	Very high	97.5	Very high	87 Å²	87	110.5 Å²	110.5	45%	0.446	52%	0.52	S	S	.	.	H	α-helix	trans	-64.1	-43.5	176.7	-64.2	166.5	0	0	0	110.8	E35 K36 N37 A41 Q42 K43	E35-I39 HydrophobicContact CG-CD1 4.28Å; E35-I39 WeakPolarHBondContact O-CG1 3.35Å; E35-I39 PolarHBondContact O-N 2.69Å; K36-I39 PolarHBondContact O-N 3.24Å; N37-I39 VanDerWaalsContact C-N 3.34Å; N37-I39 PolarHBondContact O-N 3.4Å; I39-A41 PolarHBondContact O-N 2.78Å; I39-Q42 PolarHBondContact O-N 2.66Å; I39-K43 WeakPolarHBondContact O-CB 3.4Å; I39-K43 PolarHBondContact O-N 3.05Å
40	A	98.5	Very high	97.7	Very high	55 Å²	55	109.7 Å²	109.7	46%	0.455	52%	0.518	S	S	.	.	H	α-helix	trans	-62.6	-42.7	178.5	0	0	0	0	0	112.4	K36 N37 K43 S44	K36-A40 WeakPolarHBondContact O-CB 2.8Å; K36-A40 PolarHBondContact O-N 2.95Å; N37-A40 PolarHBondContact O-N 3.29Å; A40-K43 PolarHBondContact O-N 3.29Å; A40-S44 WeakPolarHBondContact O-CB 3.19Å; A40-S44 PolarHBondContact O-N 3.31Å
41	A	98.6	Very high	98	Very high	41 Å²	41	110.7 Å²	110.7	34%	0.339	52%	0.522	S	S	.	.	H	α-helix	trans	-65.5	-43.2	176.3	0	0	0	0	0	111.5	N37 R38 I39 K43 S44 R45	N37-A41 WeakPolarHBondContact O-CB 3.27Å; N37-A41 PolarHBondContact O-N 2.94Å; R38-A41 PolarHBondContact O-N 2.88Å; I39-A41 PolarHBondContact O-N 2.78Å; A41-K43 PolarHBondContact O-N 3.49Å; A41-S44 PolarHBondContact O-N 2.73Å; A41-R45 WeakPolarHBondContact O-CG 3.34Å; A41-R45 PolarHBondContact O-N 3.24Å
42	Q	98.6	Very high	98.2	Very high	118 Å²	118	108.9 Å²	108.9	55%	0.551	52%	0.517	S	S	*	.	H	α-helix	trans	-60.3	-45.5	174	-176	178.3	-5.4	0	0	111.1	R38 I39 S44 R45 M46	R38-Q42 WeakPolarHBondContact O-CB 3.42Å; R38-Q42 PolarHBondContact O-N 3.2Å; I39-Q42 PolarHBondContact O-N 2.66Å; Q42-S44 PolarHBondContact O-N 2.76Å; Q42-R45 PolarHBondContact O-N 3.38Å; Q42-M46 WeakPolarHBondContact O-CB 3.34Å; Q42-M46 PolarHBondContact O-N 2.93Å
43	K	98.8	Very high	98.3	Very high	103 Å²	103	108.4 Å²	108.4	45%	0.448	52%	0.517	S	S	.	.	H	α-helix	trans	-63.8	-39.9	177.4	-165.6	177.8	-164.8	-179.1	0	112	I39 A40 A41 M46 R47	I39-K43 WeakPolarHBondContact O-CB 3.4Å; I39-K43 PolarHBondContact O-N 3.05Å; A40-K43 PolarHBondContact O-N 3.29Å; A41-K43 PolarHBondContact O-N 3.49Å; K43-M46 PolarHBondContact O-N 2.74Å; K43-R47 VanDerWaalsContact O-CG 3.3Å; K43-R47 WeakPolarHBondContact O-CG 3.35Å; K43-R47 PolarHBondContact O-N 2.92Å
44	S	98.7	Very high	98.4	Very high	74 Å²	74	104 Å²	104	52%	0.517	51%	0.512	S	S	.	.	H	α-helix	trans	-62.7	-48.7	176.2	174	0	0	0	0	111.4	A40 A41 Q42 M46 R47 Q48	A40-S44 WeakPolarHBondContact O-CB 3.19Å; A40-S44 PolarHBondContact O-N 3.31Å; A41-S44 PolarHBondContact O-N 2.73Å; Q42-S44 PolarHBondContact O-N 2.76Å; S44-M46 VanDerWaalsContact C-N 3.35Å; S44-M46 PolarHBondContact O-N 2.75Å; S44-R47 PolarHBondContact O-N 2.89Å; S44-Q48 PolarHBondContact O-N 3.48Å
45	R	98.7	Very high	98.5	Very high	183 Å²	183	99.9 Å²	99.9	69%	0.691	50%	0.501	S	S	*	.	H	α-helix	trans	-58.1	-47	174.6	-71.3	177.5	-174.5	-108.3	2	111.4	A41 Q42 R47 Q48 T49	A41-R45 WeakPolarHBondContact O-CG 3.34Å; A41-R45 PolarHBondContact O-N 3.24Å; Q42-R45 PolarHBondContact O-N 3.38Å; R45-R47 PolarHBondContact O-N 2.9Å; R45-Q48 WeakPolarHBondContact O-CB 3.12Å; R45-Q48 PolarHBondContact O-N 3.46Å; R45-Q48 VanDerWaalsContact O-N 3.13Å; R45-T49 PolarHBondContact O-N 3.16Å; R45-T49 PolarHBondContact O-OG1 2.96Å
46	M	98.6	Very high	98.5	Very high	92 Å²	92	101.7 Å²	101.7	45%	0.453	51%	0.51	S	S	.	.	H	α-helix	trans	-60	-44	178.7	-174.1	179.1	72.2	0	0	112.3	Q42 K43 S44 Q48 T49 Q50	Q42-M46 WeakPolarHBondContact O-CB 3.34Å; Q42-M46 PolarHBondContact O-N 2.93Å; K43-M46 PolarHBondContact O-N 2.74Å; S44-M46 VanDerWaalsContact C-N 3.35Å; S44-M46 PolarHBondContact O-N 2.75Å; M46-Q48 VanDerWaalsContact C-N 3.29Å; M46-Q48 PolarHBondContact O-N 2.91Å; M46-T49 PolarHBondContact O-N 3.34Å; M46-Q50 HydrophobicContact CG-CG 4.47Å; M46-Q50 WeakPolarHBondContact O-CB 3.48Å; M46-Q50 VanDerWaalsContact O-CG 3.29Å; M46-Q50 WeakPolarHBondContact O-CG 3.38Å; M46-Q50 PolarHBondContact O-N 2.84Å
47	R	98.6	Very high	98.5	Very high	142 Å²	142	100.3 Å²	100.3	54%	0.536	51%	0.509	S	S	.	.	H	α-helix	trans	-62.5	-37.9	175.8	-72.5	-179.2	-161.9	-77.8	19.5	112.1	K43 S44 R45 K51	K43-R47 VanDerWaalsContact O-CG 3.3Å; K43-R47 WeakPolarHBondContact O-CG 3.35Å; K43-R47 PolarHBondContact O-N 2.92Å; S44-R47 PolarHBondContact O-N 2.89Å; R45-R47 PolarHBondContact O-N 2.9Å; R47-K51 WeakPolarHBondContact O-CB 3.38Å; R47-K51 PolarHBondContact O-N 3.45Å
48	Q	98.6	Very high	98.5	Very high	142 Å²	142	100 Å²	100	66%	0.664	50%	0.503	S	S	*	.	H	α-helix	trans	-66.1	-45.5	177.6	-172.4	174.1	16.3	0	0	111.2	S44 R45 M46 K51 A52	S44-Q48 PolarHBondContact O-N 3.48Å; R45-Q48 WeakPolarHBondContact O-CB 3.12Å; R45-Q48 PolarHBondContact O-N 3.46Å; R45-Q48 VanDerWaalsContact O-N 3.13Å; M46-Q48 VanDerWaalsContact C-N 3.29Å; M46-Q48 PolarHBondContact O-N 2.91Å; Q48-K51 PolarHBondContact O-N 3.44Å; Q48-A52 PolarHBondContact O-N 3.15Å
49	T	98.4	Very high	98.5	Very high	79 Å²	79	96.6 Å²	96.6	49%	0.485	50%	0.499	S	S	.	.	H	α-helix	trans	-60.3	-50.5	174.4	-57.1	0	0	0	0	111.1	R45 M46 K51 A52 D53	R45-T49 PolarHBondContact O-N 3.16Å; R45-T49 PolarHBondContact O-OG1 2.96Å; M46-T49 PolarHBondContact O-N 3.34Å; T49-K51 VanDerWaalsContact C-N 3.27Å; T49-K51 PolarHBondContact O-N 2.95Å; T49-A52 WeakPolarHBondContact O-CA 3.49Å; T49-A52 WeakPolarHBondContact O-CB 3.38Å; T49-A52 PolarHBondContact O-N 3.07Å; T49-D53 PolarHBondContact O-N 3.44Å
50	Q	98.7	Very high	98.5	Very high	98 Å²	98	96.1 Å²	96.1	46%	0.458	50%	0.495	S	S	.	.	H	α-helix	trans	-57.2	-38.9	177.9	-74.7	175	-13.4	0	0	112.9	M46 S54	M46-Q50 HydrophobicContact CG-CG 4.47Å; M46-Q50 WeakPolarHBondContact O-CB 3.48Å; M46-Q50 VanDerWaalsContact O-CG 3.29Å; M46-Q50 WeakPolarHBondContact O-CG 3.38Å; M46-Q50 PolarHBondContact O-N 2.84Å; Q50-S54 WeakPolarHBondContact O-CB 3.35Å; Q50-S54 PolarHBondContact O-N 2.97Å; Q50-S54 PolarHBondContact O-OG 3.26Å
51	K	98.5	Very high	98.5	Very high	115 Å²	115	97.2 Å²	97.2	50%	0.5	49%	0.493	S	S	.	.	H	α-helix	trans	-64.9	-43.8	175.4	-176	177.5	179.7	-179.5	0	111.4	R47 Q48 T49 S54 L55	R47-K51 WeakPolarHBondContact O-CB 3.38Å; R47-K51 PolarHBondContact O-N 3.45Å; Q48-K51 PolarHBondContact O-N 3.44Å; T49-K51 VanDerWaalsContact C-N 3.27Å; T49-K51 PolarHBondContact O-N 2.95Å; K51-S54 PolarHBondContact O-N 2.98Å; K51-L55 HydrophobicContact CG-CD1 4.17Å; K51-L55 VanDerWaalsContact O-CG 3.3Å; K51-L55 WeakPolarHBondContact O-CG 3.46Å; K51-L55 PolarHBondContact O-N 2.88Å
52	A	98.4	Very high	98.5	Very high	56 Å²	56	99 Å²	99	46%	0.463	50%	0.497	S	S	.	.	H	α-helix	trans	-62.7	-45.7	177	0	0	0	0	0	111.4	Q48 T49 S54 L55 H56	Q48-A52 PolarHBondContact O-N 3.15Å; T49-A52 WeakPolarHBondContact O-CA 3.49Å; T49-A52 WeakPolarHBondContact O-CB 3.38Å; T49-A52 PolarHBondContact O-N 3.07Å; A52-S54 VanDerWaalsContact C-N 3.34Å; A52-S54 PolarHBondContact O-N 3.44Å; A52-L55 PolarHBondContact O-N 2.92Å; A52-H56 WeakPolarHBondContact O-CB 3.46Å; A52-H56 PolarHBondContact O-N 3.45Å
53	D	98.6	Very high	98.5	Very high	95 Å²	95	99.3 Å²	99.3	51%	0.508	50%	0.498	S	S	.	.	H	α-helix	trans	-62.4	-42.4	178.8	-60.4	-20.2	0	0	0	111.4	T49 H56 L57	T49-D53 PolarHBondContact O-N 3.44Å; D53-H56 PolarHBondContact O-N 3.34Å; D53-L57 WeakPolarHBondContact O-CB 3.48Å; D53-L57 PolarHBondContact O-N 3.36Å
54	S	98.3	Very high	98.5	Very high	75 Å²	75	101.3 Å²	101.3	52%	0.524	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-44.7	178.3	-58.4	0	0	0	0	111.7	Q50 K51 A52 H56 L57 E58	Q50-S54 WeakPolarHBondContact O-CB 3.35Å; Q50-S54 PolarHBondContact O-N 2.97Å; Q50-S54 PolarHBondContact O-OG 3.26Å; K51-S54 PolarHBondContact O-N 2.98Å; A52-S54 VanDerWaalsContact C-N 3.34Å; A52-S54 PolarHBondContact O-N 3.44Å; S54-H56 VanDerWaalsContact C-N 3.35Å; S54-L57 PolarHBondContact O-N 2.88Å; S54-E58 WeakPolarHBondContact O-CB 3.43Å; S54-E58 PolarHBondContact O-N 3.22Å
55	L	98.6	Very high	98.5	Very high	77 Å²	77	102.4 Å²	102.4	40%	0.403	50%	0.504	S	S	.	.	H	α-helix	trans	-64.8	-39.3	177.1	-72.5	171.4	0	0	0	111.9	K51 A52 E58 S59	K51-L55 HydrophobicContact CG-CD1 4.17Å; K51-L55 VanDerWaalsContact O-CG 3.3Å; K51-L55 WeakPolarHBondContact O-CG 3.46Å; K51-L55 PolarHBondContact O-N 2.88Å; A52-L55 PolarHBondContact O-N 2.92Å; L55-E58 PolarHBondContact O-N 2.86Å; L55-S59 WeakPolarHBondContact O-CB 3.47Å; L55-S59 PolarHBondContact O-N 2.74Å
56	H	98.4	Very high	98.5	Very high	117 Å²	117	97.5 Å²	97.5	54%	0.542	49%	0.491	S	S	.	.	H	α-helix	trans	-63.4	-48.4	177	-168.6	-79.8	0	0	0	111	A52 D53 S54 E58 S59 E60	A52-H56 WeakPolarHBondContact O-CB 3.46Å; A52-H56 PolarHBondContact O-N 3.45Å; D53-H56 PolarHBondContact O-N 3.34Å; S54-H56 VanDerWaalsContact C-N 3.35Å; H56-E58 VanDerWaalsContact C-N 3.33Å; H56-E58 PolarHBondContact O-N 3.11Å; H56-S59 WeakPolarHBondContact O-CB 3.33Å; H56-S59 PolarHBondContact O-N 3.48Å; H56-E60 IonicContact CE1-OE1 3.28Å; H56-E60 IonicContact CE1-OE2 3.63Å; H56-E60 PolarHBondContact CE1-OE2 2.99Å; H56-E60 VanDerWaalsContact CE1-OE2 3.28Å; H56-E60 VanDerWaalsContact ND1-CD 3.33Å; H56-E60 IonicContact ND1-OE2 3.6Å; H56-E60 PolarHBondContact ND1-OE2 3.05Å; H56-E60 WeakPolarHBondContact O-CG 3.29Å; H56-E60 PolarHBondContact O-N 2.77Å
57	L	98.4	Very high	98.5	Very high	118 Å²	118	95.9 Å²	95.9	62%	0.618	49%	0.493	S	S	*	.	H	α-helix	trans	-61.3	-41.4	178.6	-177.6	62.6	0	0	0	112	D53 S54 E60 N61	D53-L57 WeakPolarHBondContact O-CB 3.48Å; D53-L57 PolarHBondContact O-N 3.36Å; S54-L57 PolarHBondContact O-N 2.88Å; L57-E60 PolarHBondContact O-N 2.8Å; L57-N61 WeakPolarHBondContact O-CB 3.44Å; L57-N61 PolarHBondContact O-N 3.25Å
58	E	98.4	Very high	98.5	Very high	106 Å²	106	92 Å²	92	50%	0.495	49%	0.491	S	S	.	.	H	α-helix	trans	-62.6	-43.9	175.3	-173.6	178.5	177.8	0	0	111.5	S54 L55 H56 N61 L62	S54-E58 WeakPolarHBondContact O-CB 3.43Å; S54-E58 PolarHBondContact O-N 3.22Å; L55-E58 PolarHBondContact O-N 2.86Å; H56-E58 VanDerWaalsContact C-N 3.33Å; H56-E58 PolarHBondContact O-N 3.11Å; E58-N61 PolarHBondContact O-N 3.4Å; E58-L62 HydrophobicContact CG-CD1 4.14Å; E58-L62 WeakPolarHBondContact O-CB 3.45Å; E58-L62 WeakPolarHBondContact O-CG 3.3Å; E58-L62 PolarHBondContact O-N 2.93Å
59	S	98.4	Very high	98.5	Very high	56 Å²	56	90 Å²	90	39%	0.392	48%	0.484	S	S	.	.	H	α-helix	trans	-58.8	-49.6	175.6	-166.4	0	0	0	0	111.5	L55 H56 N61 L62 E63	L55-S59 WeakPolarHBondContact O-CB 3.47Å; L55-S59 PolarHBondContact O-N 2.74Å; H56-S59 WeakPolarHBondContact O-CB 3.33Å; H56-S59 PolarHBondContact O-N 3.48Å; S59-N61 VanDerWaalsContact C-N 3.29Å; S59-N61 PolarHBondContact O-N 2.93Å; S59-L62 PolarHBondContact O-N 2.94Å; S59-E63 WeakPolarHBondContact O-CB 3.43Å; S59-E63 WeakPolarHBondContact O-CG 3.5Å; S59-E63 PolarHBondContact O-N 2.98Å; S59-E63 PolarHBondContact OG-OE1 3.34Å
60	E	98.6	Very high	98.5	Very high	77 Å²	77	94.7 Å²	94.7	36%	0.36	49%	0.493	S	S	.	.	H	α-helix	trans	-62	-37.8	179.4	-71.5	-178.1	103.9	0	0	112.2	H56 L57 K64	H56-E60 IonicContact CE1-OE1 3.28Å; H56-E60 IonicContact CE1-OE2 3.63Å; H56-E60 PolarHBondContact CE1-OE2 2.99Å; H56-E60 VanDerWaalsContact CE1-OE2 3.28Å; H56-E60 VanDerWaalsContact ND1-CD 3.33Å; H56-E60 IonicContact ND1-OE2 3.6Å; H56-E60 PolarHBondContact ND1-OE2 3.05Å; H56-E60 WeakPolarHBondContact O-CG 3.29Å; H56-E60 PolarHBondContact O-N 2.77Å; L57-E60 PolarHBondContact O-N 2.8Å; E60-K64 VanDerWaalsContact O-CG 3.29Å; E60-K64 WeakPolarHBondContact O-CG 3.42Å; E60-K64 PolarHBondContact O-N 3.05Å; E60-K64 VanDerWaalsContact O-N 3.11Å
61	N	98.4	Very high	98.5	Very high	78 Å²	78	96.4 Å²	96.4	42%	0.417	50%	0.499	S	S	.	.	H	α-helix	trans	-65.7	-47.9	176	-172.4	72.6	0	0	0	111.3	L57 E58 S59 E63 K64 E65	L57-N61 WeakPolarHBondContact O-CB 3.44Å; L57-N61 PolarHBondContact O-N 3.25Å; E58-N61 PolarHBondContact O-N 3.4Å; S59-N61 VanDerWaalsContact C-N 3.29Å; S59-N61 PolarHBondContact O-N 2.93Å; N61-E63 VanDerWaalsContact C-N 3.31Å; N61-E63 PolarHBondContact O-N 3.49Å; N61-K64 PolarHBondContact O-N 3.45Å; N61-E65 PolarHBondContact ND2-OE1 3.19Å; N61-E65 WeakPolarHBondContact O-CG 3.42Å; N61-E65 PolarHBondContact O-N 3.35Å
62	L	98.7	Very high	98.5	Very high	79 Å²	79	95.9 Å²	95.9	41%	0.414	50%	0.498	S	S	.	.	H	α-helix	trans	-61.5	-38.7	177.5	-72.3	172.1	0	0	0	112.1	E58 S59 E65 N66	E58-L62 HydrophobicContact CG-CD1 4.14Å; E58-L62 WeakPolarHBondContact O-CB 3.45Å; E58-L62 WeakPolarHBondContact O-CG 3.3Å; E58-L62 PolarHBondContact O-N 2.93Å; S59-L62 PolarHBondContact O-N 2.94Å; L62-E65 PolarHBondContact O-N 2.96Å; L62-N66 WeakPolarHBondContact O-CB 3.35Å; L62-N66 PolarHBondContact O-N 3.31Å
63	E	98.5	Very high	98.5	Very high	124 Å²	124	97.6 Å²	97.6	58%	0.579	50%	0.503	S	S	*	.	H	α-helix	trans	-62.9	-43.9	175.5	-76.4	172.3	-157.7	0	0	111.9	S59 N61 N66 A67	S59-E63 WeakPolarHBondContact O-CB 3.43Å; S59-E63 WeakPolarHBondContact O-CG 3.5Å; S59-E63 PolarHBondContact O-N 2.98Å; S59-E63 PolarHBondContact OG-OE1 3.34Å; N61-E63 VanDerWaalsContact C-N 3.31Å; N61-E63 PolarHBondContact O-N 3.49Å; E63-N66 PolarHBondContact O-N 3.41Å; E63-A67 WeakPolarHBondContact O-CB 2.87Å; E63-A67 PolarHBondContact O-N 2.98Å
64	K	98.6	Very high	98.5	Very high	144 Å²	144	99.1 Å²	99.1	63%	0.626	51%	0.505	S	S	*	.	H	α-helix	trans	-62.5	-48.1	175.8	-73.2	169.5	-173.8	168.6	0	111.7	E60 N61 A67 A68	E60-K64 VanDerWaalsContact O-CG 3.29Å; E60-K64 WeakPolarHBondContact O-CG 3.42Å; E60-K64 PolarHBondContact O-N 3.05Å; E60-K64 VanDerWaalsContact O-N 3.11Å; N61-K64 PolarHBondContact O-N 3.45Å; K64-A67 PolarHBondContact O-N 2.98Å; K64-A68 PolarHBondContact O-N 3.44Å
65	E	98.6	Very high	98.6	Very high	97 Å²	97	100.5 Å²	100.5	45%	0.453	50%	0.503	S	S	.	.	H	α-helix	trans	-62.1	-43.2	177.7	-72.7	178.4	-171.2	0	0	111.4	N61 L62 A67 A68 L69	N61-E65 PolarHBondContact ND2-OE1 3.19Å; N61-E65 WeakPolarHBondContact O-CG 3.42Å; N61-E65 PolarHBondContact O-N 3.35Å; L62-E65 PolarHBondContact O-N 2.96Å; E65-A67 VanDerWaalsContact C-N 3.35Å; E65-A67 PolarHBondContact O-N 2.95Å; E65-A68 PolarHBondContact O-N 2.94Å; E65-L69 WeakPolarHBondContact O-CB 3.42Å; E65-L69 WeakPolarHBondContact O-CG 3.41Å; E65-L69 PolarHBondContact O-N 2.67Å
66	N	98.6	Very high	98.6	Very high	80 Å²	80	101.4 Å²	101.4	43%	0.428	51%	0.508	S	S	.	.	H	α-helix	trans	-61.9	-43.2	177.6	-161.5	-80.4	0	0	0	111.6	L62 E63 L69 R70	L62-N66 WeakPolarHBondContact O-CB 3.35Å; L62-N66 PolarHBondContact O-N 3.31Å; E63-N66 PolarHBondContact O-N 3.41Å; N66-L69 PolarHBondContact O-N 3.28Å; N66-R70 WeakPolarHBondContact O-CB 3.39Å; N66-R70 VanDerWaalsContact O-CG 3.27Å; N66-R70 WeakPolarHBondContact O-CG 3.29Å; N66-R70 PolarHBondContact O-N 3.04Å; N66-R70 WeakPolarHBondContact OD1-CD 3.42Å; N66-R70 PolarHBondContact OD1-NE 2.87Å
67	A	98.6	Very high	98.6	Very high	59 Å²	59	99.1 Å²	99.1	49%	0.488	50%	0.502	S	S	.	.	H	α-helix	trans	-63.1	-42.2	176.4	0	0	0	0	0	112	E63 K64 E65 R70 K71	E63-A67 WeakPolarHBondContact O-CB 2.87Å; E63-A67 PolarHBondContact O-N 2.98Å; K64-A67 PolarHBondContact O-N 2.98Å; E65-A67 VanDerWaalsContact C-N 3.35Å; E65-A67 PolarHBondContact O-N 2.95Å; A67-R70 PolarHBondContact O-N 3.47Å; A67-K71 PolarHBondContact O-N 3.35Å
68	A	98.5	Very high	98.6	Very high	59 Å²	59	98.5 Å²	98.5	49%	0.488	50%	0.496	S	S	.	.	H	α-helix	trans	-62.2	-48.7	176	0	0	0	0	0	111.7	K64 E65 R70 K71 E72	K64-A68 PolarHBondContact O-N 3.44Å; E65-A68 PolarHBondContact O-N 2.94Å; A68-R70 PolarHBondContact O-N 3.23Å; A68-K71 WeakPolarHBondContact O-CB 3.38Å; A68-K71 PolarHBondContact O-N 3.45Å; A68-K71 VanDerWaalsContact O-N 3.15Å; A68-E72 PolarHBondContact O-N 2.94Å
69	L	98.8	Very high	98.6	Very high	101 Å²	101	98.9 Å²	98.9	53%	0.529	50%	0.498	S	S	.	.	H	α-helix	trans	-61.8	-42.1	177.7	-71.4	170.7	0	0	0	112.2	E65 N66 K71 E72 V73	E65-L69 WeakPolarHBondContact O-CB 3.42Å; E65-L69 WeakPolarHBondContact O-CG 3.41Å; E65-L69 PolarHBondContact O-N 2.67Å; N66-L69 PolarHBondContact O-N 3.28Å; L69-K71 VanDerWaalsContact C-N 3.28Å; L69-K71 PolarHBondContact O-N 2.86Å; L69-E72 PolarHBondContact O-N 3Å; L69-V73 WeakPolarHBondContact O-CG2 3.46Å; L69-V73 PolarHBondContact O-N 2.99Å
70	R	98.5	Very high	98.5	Very high	178 Å²	178	98.6 Å²	98.6	67%	0.672	50%	0.499	S	S	*	.	H	α-helix	trans	-60.9	-38.4	175.3	-77	176.3	-178.9	-105.8	1.8	112.2	N66 A67 A68 K74	N66-R70 WeakPolarHBondContact O-CB 3.39Å; N66-R70 VanDerWaalsContact O-CG 3.27Å; N66-R70 WeakPolarHBondContact O-CG 3.29Å; N66-R70 PolarHBondContact O-N 3.04Å; N66-R70 WeakPolarHBondContact OD1-CD 3.42Å; N66-R70 PolarHBondContact OD1-NE 2.87Å; A67-R70 PolarHBondContact O-N 3.47Å; A68-R70 PolarHBondContact O-N 3.23Å; R70-K74 WeakPolarHBondContact O-CB 3.35Å; R70-K74 PolarHBondContact O-N 2.75Å
71	K	98.6	Very high	98.5	Very high	134 Å²	134	99.9 Å²	99.9	58%	0.583	51%	0.509	S	S	*	.	H	α-helix	trans	-65.4	-44.7	175.8	-176.5	-175.9	176.3	-173.7	0	111	A67 A68 L69 K74 Q75	A67-K71 PolarHBondContact O-N 3.35Å; A68-K71 WeakPolarHBondContact O-CB 3.38Å; A68-K71 PolarHBondContact O-N 3.45Å; A68-K71 VanDerWaalsContact O-N 3.15Å; L69-K71 VanDerWaalsContact C-N 3.28Å; L69-K71 PolarHBondContact O-N 2.86Å; K71-K74 PolarHBondContact O-N 2.96Å; K71-Q75 WeakPolarHBondContact O-CG 3.43Å; K71-Q75 PolarHBondContact O-N 2.95Å
72	E	98.6	Very high	98.5	Very high	103 Å²	103	103.7 Å²	103.7	48%	0.481	52%	0.518	S	S	.	.	H	α-helix	trans	-61.9	-47.4	177.2	-174.6	177.1	-174	0	0	111.6	A68 L69 K74 Q75 L76	A68-E72 PolarHBondContact O-N 2.94Å; L69-E72 PolarHBondContact O-N 3Å; E72-K74 VanDerWaalsContact C-N 3.28Å; E72-K74 PolarHBondContact O-N 2.77Å; E72-Q75 PolarHBondContact O-N 3.4Å; E72-Q75 VanDerWaalsContact O-N 3.16Å; E72-L76 HydrophobicContact CG-CD1 3.96Å; E72-L76 HydrophobicContact CG-CG 4.43Å; E72-L76 WeakPolarHBondContact O-CG 3.3Å; E72-L76 PolarHBondContact O-N 3.13Å
73	V	98.7	Very high	98.4	Very high	92 Å²	92	104.1 Å²	104.1	56%	0.558	52%	0.52	S	S	*	.	H	α-helix	trans	-55.3	-45.6	174.6	168.7	0	0	0	0	111	L69 T77	L69-V73 WeakPolarHBondContact O-CG2 3.46Å; L69-V73 PolarHBondContact O-N 2.99Å; V73-T77 VanDerWaalsContact O-CB 3.3Å; V73-T77 WeakPolarHBondContact O-CB 3.44Å; V73-T77 PolarHBondContact O-N 3.02Å; V73-T77 PolarHBondContact O-OG1 3.44Å
74	K	98.6	Very high	98.3	Very high	127 Å²	127	101.3 Å²	101.3	55%	0.552	52%	0.515	S	S	*	.	H	α-helix	trans	-60.6	-48.8	177.9	179.3	179.1	171.4	179.9	0	111.4	R70 K71 E72 T77 E78	R70-K74 WeakPolarHBondContact O-CB 3.35Å; R70-K74 PolarHBondContact O-N 2.75Å; K71-K74 PolarHBondContact O-N 2.96Å; E72-K74 VanDerWaalsContact C-N 3.28Å; E72-K74 PolarHBondContact O-N 2.77Å; K74-T77 PolarHBondContact O-N 3.43Å; K74-E78 WeakPolarHBondContact CE-OE1 3.42Å; K74-E78 IonicContact NZ-OE1 3.8Å; K74-E78 WeakPolarHBondContact O-CG 3.36Å; K74-E78 PolarHBondContact O-N 3.42Å
75	Q	98.6	Very high	98.2	Very high	104 Å²	104	98.2 Å²	98.2	49%	0.486	51%	0.511	S	S	.	.	H	α-helix	trans	-60.9	-47.9	-179.8	-74	178.6	-16.7	0	0	112	K71 E72 T77 E78 E79	K71-Q75 WeakPolarHBondContact O-CG 3.43Å; K71-Q75 PolarHBondContact O-N 2.95Å; E72-Q75 PolarHBondContact O-N 3.4Å; E72-Q75 VanDerWaalsContact O-N 3.16Å; Q75-T77 VanDerWaalsContact C-N 3.3Å; Q75-T77 PolarHBondContact O-N 3.45Å; Q75-E78 PolarHBondContact O-N 3.2Å; Q75-E79 PolarHBondContact O-N 2.94Å
76	L	98.8	Very high	98.1	Very high	96 Å²	96	96.6 Å²	96.6	50%	0.503	51%	0.507	S	S	.	.	H	α-helix	trans	-63.4	-37.1	178.1	-69	172.8	0	0	0	112	E72 E79 A80	E72-L76 HydrophobicContact CG-CD1 3.96Å; E72-L76 HydrophobicContact CG-CG 4.43Å; E72-L76 WeakPolarHBondContact O-CG 3.3Å; E72-L76 PolarHBondContact O-N 3.13Å; L76-E79 PolarHBondContact O-N 3.29Å; L76-A80 VanDerWaalsContact O-CB 3.29Å; L76-A80 WeakPolarHBondContact O-CB 3.37Å; L76-A80 PolarHBondContact O-N 2.88Å
77	T	98.3	Very high	97.9	Very high	70 Å²	70	98.5 Å²	98.5	43%	0.429	52%	0.517	S	S	.	.	H	α-helix	trans	-65.7	-43.4	176	-57.2	0	0	0	0	111.2	V73 K74 Q75 A80 N81	V73-T77 VanDerWaalsContact O-CB 3.3Å; V73-T77 WeakPolarHBondContact O-CB 3.44Å; V73-T77 PolarHBondContact O-N 3.02Å; V73-T77 PolarHBondContact O-OG1 3.44Å; K74-T77 PolarHBondContact O-N 3.43Å; Q75-T77 VanDerWaalsContact C-N 3.3Å; Q75-T77 PolarHBondContact O-N 3.45Å; T77-A80 PolarHBondContact O-N 2.9Å; T77-N81 WeakPolarHBondContact O-CB 3.43Å; T77-N81 PolarHBondContact O-N 2.94Å; T77-N81 PolarHBondContact O-ND2 2.95Å; T77-N81 VanDerWaalsContact O-ND2 3.15Å
78	E	98.5	Very high	97.5	Very high	105 Å²	105	99.2 Å²	99.2	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-62.5	-43.5	176	-73.5	171	176.8	0	0	111.4	K74 Q75 N81 Y82	K74-E78 WeakPolarHBondContact CE-OE1 3.42Å; K74-E78 IonicContact NZ-OE1 3.8Å; K74-E78 WeakPolarHBondContact O-CG 3.36Å; K74-E78 PolarHBondContact O-N 3.42Å; Q75-E78 PolarHBondContact O-N 3.2Å; E78-N81 PolarHBondContact O-N 3.08Å; E78-Y82 WeakPolarHBondContact O-CB 3.37Å; E78-Y82 PolarHBondContact O-N 3.37Å
79	E	98.4	Very high	97.1	Very high	113 Å²	113	100 Å²	100	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-64.6	-45.7	176.9	-173.9	173.7	-174.9	0	0	112.1	Q75 L76 N81 Y82 L83	Q75-E79 PolarHBondContact O-N 2.94Å; L76-E79 PolarHBondContact O-N 3.29Å; E79-N81 VanDerWaalsContact C-N 3.33Å; E79-N81 PolarHBondContact O-N 3.46Å; E79-Y82 PolarHBondContact O-N 3.5Å; E79-L83 HydrophobicContact CG-CD1 4.13Å; E79-L83 HydrophobicContact CG-CG 4.48Å; E79-L83 WeakPolarHBondContact O-CG 3.38Å; E79-L83 PolarHBondContact O-N 3.45Å
80	A	98.1	Very high	96.7	Very high	51 Å²	51	99.8 Å²	99.8	42%	0.421	52%	0.517	S	S	.	.	H	α-helix	trans	-60.7	-42.7	176.6	0	0	0	0	0	112	L76 T77 S84	L76-A80 VanDerWaalsContact O-CB 3.29Å; L76-A80 WeakPolarHBondContact O-CB 3.37Å; L76-A80 PolarHBondContact O-N 2.88Å; T77-A80 PolarHBondContact O-N 2.9Å; A80-S84 VanDerWaalsContact O-CB 3.28Å; A80-S84 WeakPolarHBondContact O-CB 3.47Å; A80-S84 PolarHBondContact O-N 3.35Å; A80-S84 PolarHBondContact O-OG 2.85Å
81	N	98.1	Very high	96.1	Very high	104 Å²	104	98.3 Å²	98.3	56%	0.556	52%	0.517	S	S	*	.	H	α-helix	trans	-64.3	-42.6	175.7	-72.7	-25.3	0	0	0	111.6	T77 E78 E79 S84 S85	T77-N81 WeakPolarHBondContact O-CB 3.43Å; T77-N81 PolarHBondContact O-N 2.94Å; T77-N81 PolarHBondContact O-ND2 2.95Å; T77-N81 VanDerWaalsContact O-ND2 3.15Å; E78-N81 PolarHBondContact O-N 3.08Å; E79-N81 VanDerWaalsContact C-N 3.33Å; E79-N81 PolarHBondContact O-N 3.46Å; N81-S84 PolarHBondContact O-N 2.81Å; N81-S85 WeakPolarHBondContact O-CB 3.34Å; N81-S85 PolarHBondContact O-N 3.21Å
82	Y	98.1	Very high	95.3	Very high	158 Å²	158	97 Å²	97	62%	0.62	52%	0.523	S	S	*	.	H	α-helix	trans	-60.8	-51.4	176.8	172.4	-104	0	0	0	111.5	E78 E79 S84 S85 V86	E78-Y82 WeakPolarHBondContact O-CB 3.37Å; E78-Y82 PolarHBondContact O-N 3.37Å; E79-Y82 PolarHBondContact O-N 3.5Å; Y82-S84 VanDerWaalsContact C-N 3.33Å; Y82-S84 PolarHBondContact O-N 3.32Å; Y82-S85 WeakPolarHBondContact O-CB 3.37Å; Y82-S85 PolarHBondContact O-N 3.47Å; Y82-S85 VanDerWaalsContact O-N 3.16Å; Y82-V86 HydrophobicContact CD1-CG2 4.47Å; Y82-V86 HydrophobicContact CD2-CG2 4.4Å; Y82-V86 HydrophobicContact CE1-CG2 4.04Å; Y82-V86 HydrophobicContact CE2-CG2 3.96Å; Y82-V86 WeakPolarHBondContact O-CG2 3.3Å; Y82-V86 PolarHBondContact O-N 3.49Å
83	L	97.4	Very high	94.6	Very high	87 Å²	87	98.3 Å²	98.3	46%	0.455	53%	0.532	S	S	.	.	H	α-helix	trans	-61.2	-42.3	178.3	-68.2	173.9	0	0	0	111.7	E79 S85 V86 L87	E79-L83 HydrophobicContact CG-CD1 4.13Å; E79-L83 HydrophobicContact CG-CG 4.48Å; E79-L83 WeakPolarHBondContact O-CG 3.38Å; E79-L83 PolarHBondContact O-N 3.45Å; L83-S85 VanDerWaalsContact C-N 3.31Å; L83-S85 PolarHBondContact O-N 2.92Å; L83-V86 PolarHBondContact O-N 2.89Å; L83-L87 WeakPolarHBondContact O-CG 3.41Å; L83-L87 PolarHBondContact O-N 2.82Å
84	S	96.1	Very high	93.6	Very high	66 Å²	66	96.1 Å²	96.1	46%	0.462	52%	0.52	S	S	.	.	H	α-helix	trans	-60.9	-41.3	175.7	-59.6	0	0	0	0	111.7	A80 N81 Y82 L87 S88	A80-S84 VanDerWaalsContact O-CB 3.28Å; A80-S84 WeakPolarHBondContact O-CB 3.47Å; A80-S84 PolarHBondContact O-N 3.35Å; A80-S84 PolarHBondContact O-OG 2.85Å; N81-S84 PolarHBondContact O-N 2.81Å; Y82-S84 VanDerWaalsContact C-N 3.33Å; Y82-S84 PolarHBondContact O-N 3.32Å; S84-L87 PolarHBondContact O-N 3.48Å; S84-S88 WeakPolarHBondContact O-CB 3.49Å; S84-S88 PolarHBondContact O-N 3.23Å; S84-S88 PolarHBondContact O-OG 2.8Å
85	S	96.4	Very high	91.9	Very high	78 Å²	78	97.3 Å²	97.3	55%	0.545	54%	0.538	S	S	.	.	H	α-helix	trans	-64.6	-43.4	175.5	-175.7	0	0	0	0	112	N81 Y82 L83 S88 S89	N81-S85 WeakPolarHBondContact O-CB 3.34Å; N81-S85 PolarHBondContact O-N 3.21Å; Y82-S85 WeakPolarHBondContact O-CB 3.37Å; Y82-S85 PolarHBondContact O-N 3.47Å; Y82-S85 VanDerWaalsContact O-N 3.16Å; L83-S85 VanDerWaalsContact C-N 3.31Å; L83-S85 PolarHBondContact O-N 2.92Å; S85-S88 PolarHBondContact O-N 3.28Å; S85-S89 WeakPolarHBondContact O-CB 3.38Å; S85-S89 PolarHBondContact O-N 3.37Å; S85-S89 PolarHBondContact O-OG 2.86Å
86	V	95.6	Very high	90	Very high	63 Å²	63	95.3 Å²	95.3	38%	0.382	55%	0.546	S	S	.	.	H	α-helix	trans	-60.8	-48.3	177	171	0	0	0	0	110.1	Y82 L83 S89 H90	Y82-V86 HydrophobicContact CD1-CG2 4.47Å; Y82-V86 HydrophobicContact CD2-CG2 4.4Å; Y82-V86 HydrophobicContact CE1-CG2 4.04Å; Y82-V86 HydrophobicContact CE2-CG2 3.96Å; Y82-V86 WeakPolarHBondContact O-CG2 3.3Å; Y82-V86 PolarHBondContact O-N 3.49Å; L83-V86 PolarHBondContact O-N 2.89Å; V86-S89 PolarHBondContact O-N 3.42Å; V86-S89 PolarHBondContact O-OG 3Å; V86-H90 PolarHBondContact O-N 3.32Å; V86-H90 VanDerWaalsContact O-N 3.07Å
87	L	93.9	Very high	87.8	Confident	120 Å²	120	97 Å²	97	63%	0.628	56%	0.555	S	S	*	*	H	α-helix	trans	-61	-46.5	177.8	-71.2	173.7	0	0	0	112.1	L83 S84 S89 H90 E91	L83-L87 WeakPolarHBondContact O-CG 3.41Å; L83-L87 PolarHBondContact O-N 2.82Å; S84-L87 PolarHBondContact O-N 3.48Å; L87-S89 VanDerWaalsContact C-N 3.27Å; L87-S89 PolarHBondContact O-N 3.49Å; L87-H90 PolarHBondContact O-N 2.91Å; L87-H90 VanDerWaalsContact O-N 3.09Å; L87-E91 PolarHBondContact O-N 3.15Å
88	S	91.1	Very high	85.5	Confident	74 Å²	74	97.6 Å²	97.6	52%	0.517	57%	0.567	S	S	.	*	H	α-helix	trans	-61.4	-36.6	178.7	-55.6	0	0	0	0	111.9	S84 S85 H90 P92	S84-S88 WeakPolarHBondContact O-CB 3.49Å; S84-S88 PolarHBondContact O-N 3.23Å; S84-S88 PolarHBondContact O-OG 2.8Å; S85-S88 PolarHBondContact O-N 3.28Å; S88-H90 VanDerWaalsContact C-N 3.34Å; S88-P92 WeakPolarHBondContact O-CD 3.37Å
89	S	90.7	Very high	83.1	Confident	75 Å²	75	98.7 Å²	98.7	52%	0.524	58%	0.583	S	S	.	*	H	α-helix	trans	-71.8	-28.5	176.6	74.7	0	0	0	0	113.4	S85 V86 L87 P92	S85-S89 WeakPolarHBondContact O-CB 3.38Å; S85-S89 PolarHBondContact O-N 3.37Å; S85-S89 PolarHBondContact O-OG 2.86Å; V86-S89 PolarHBondContact O-N 3.42Å; V86-S89 PolarHBondContact O-OG 3Å; L87-S89 VanDerWaalsContact C-N 3.27Å; L87-S89 PolarHBondContact O-N 3.49Å; S89-P92 WeakPolarHBondContact O-CD 3.46Å
90	H	90	Very high	80.7	Confident	98 Å²	98	100.9 Å²	100.9	45%	0.454	59%	0.593	S	S	.	*	H	α-helix	trans	-83.9	-31.9	179.3	177.4	-87.2	0	0	0	112.7	V86 L87 S88 P92 L93 C94	V86-H90 PolarHBondContact O-N 3.32Å; V86-H90 VanDerWaalsContact O-N 3.07Å; L87-H90 PolarHBondContact O-N 2.91Å; L87-H90 VanDerWaalsContact O-N 3.09Å; S88-H90 VanDerWaalsContact C-N 3.34Å; H90-P92 VanDerWaalsContact C-CD 3.45Å; H90-L93 WeakPolarHBondContact O-CA 3.43Å; H90-L93 WeakPolarHBondContact O-CB 3.34Å; H90-L93 PolarHBondContact O-N 3.32Å; H90-C94 PolarHBondContact O-N 3Å; H90-C94 VanDerWaalsContact O-N 3.16Å
91	E	84.6	Confident	78.2	Confident	147 Å²	147	103 Å²	103	69%	0.687	60%	0.6	S	S	*	*	G	3₁₀ helix	trans	-42.2	-50.2	179.1	-168.9	-178.4	-174.3	0	0	114.3	L87 L93 C94	L87-E91 PolarHBondContact O-N 3.15Å; E91-L93 PolarHBondContact O-N 2.95Å; E91-C94 PolarHBondContact O-N 3.44Å
92	P	83.6	Confident	76	Confident	107 Å²	107	104.7 Å²	104.7	70%	0.695	62%	0.618	S	S	*	*	G	3₁₀ helix	trans	-69.4	-16.4	179.7	28.1	-37.1	0	0	0	114.7	S88 S89 H90	S88-P92 WeakPolarHBondContact O-CD 3.37Å; S89-P92 WeakPolarHBondContact O-CD 3.46Å; H90-P92 VanDerWaalsContact C-CD 3.45Å
93	L	82.8	Confident	73.8	Confident	130 Å²	130	104 Å²	104	68%	0.681	63%	0.625	S	S	*	*	G	3₁₀ helix	trans	-94.2	-13.2	178.3	-56.5	175.7	0	0	0	112.2	H90 E91 T95	H90-L93 WeakPolarHBondContact O-CA 3.43Å; H90-L93 WeakPolarHBondContact O-CB 3.34Å; H90-L93 PolarHBondContact O-N 3.32Å; E91-L93 PolarHBondContact O-N 2.95Å; L93-T95 PolarHBondContact O-N 3.01Å; L93-T95 VanDerWaalsContact O-N 3.15Å
94	C	77.9	Confident	71.6	Confident	45 Å²	45	107.2 Å²	107.2	30%	0.304	64%	0.641	S	S	.	*			trans	-85.2	84.5	-176.5	-162.5	0	0	0	0	110.8	H90 E91 G96	H90-C94 PolarHBondContact O-N 3Å; H90-C94 VanDerWaalsContact O-N 3.16Å; E91-C94 PolarHBondContact O-N 3.44Å; C94-G96 PolarHBondContact O-N 3.39Å
95	T	63.2	Low	69.6	Low	152 Å²	152	111.6 Å²	111.6	93%	0.933	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	30	-177.1	-27	0	0	0	0	115.2	L93	L93-T95 PolarHBondContact O-N 3.01Å; L93-T95 VanDerWaalsContact O-N 3.15Å
96	G	58.1	Low	67.2	Low	63 Å²	63	117.5 Å²	117.5	65%	0.649	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-138	-5.2	-174.9	0	0	0	0	0	116.3	C94	C94-G96 PolarHBondContact O-N 3.39Å
97	L	53.6	Low	65.3	Low	132 Å²	132	119 Å²	119	69%	0.691	68%	0.681	S	S	*	*			trans	-127	62	-177.2	-61.1	175.4	0	0	0	111
98	A	48.3	Very low	63.2	Low	82 Å²	82	119 Å²	119	68%	0.678	69%	0.688	S	S	*	*	S	Bend	trans	-62	153.4	152.2	0	0	0	0	0	108.6	Q100	A98-Q100 PolarHBondContact O-N 3Å
99	P	49.3	Very low	61.6	Low	127 Å²	127	122.4 Å²	122.4	83%	0.825	70%	0.696	S	S	*	*			trans	-68.1	93.5	-142.1	28.8	-35.5	0	0	0	112.9	T101	P99-T101 VanDerWaalsContact C-N 3.33Å; P99-T101 PolarHBondContact O-N 3.46Å; P99-T101 VanDerWaalsContact O-N 3.1Å
100	Q	47.2	Very low	59.8	Low	160 Å²	160	127.1 Å²	127.1	75%	0.748	71%	0.71	S	S	*	*			trans	-81.4	89.1	166	-58.1	-71.8	53.1	0	0	107.5	A98	A98-Q100 PolarHBondContact O-N 3Å
101	T	46.8	Very low	57.9	Low	94 Å²	94	126.7 Å²	126.7	58%	0.577	72%	0.718	S	S	*	*			trans	51.1	112.2	152.5	60.9	0	0	0	0	117.5	P99 D103	P99-T101 VanDerWaalsContact C-N 3.33Å; P99-T101 PolarHBondContact O-N 3.46Å; P99-T101 VanDerWaalsContact O-N 3.1Å; T101-D103 PolarHBondContact O-N 2.67Å
102	P	50.4	Low	56.2	Low	141 Å²	141	124.9 Å²	124.9	92%	0.916	72%	0.721	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.4	22.3	178.6	35.6	-35.3	0	0	0	113.9
103	D	52	Low	54.6	Low	144 Å²	144	129.3 Å²	129.3	77%	0.77	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.8	1.4	-162.2	-119	-3.8	0	0	0	115.9	T101	T101-D103 PolarHBondContact O-N 2.67Å
104	L	52.7	Low	53.2	Low	154 Å²	154	130.4 Å²	130.4	81%	0.806	73%	0.727	S	S	*	*	S	Bend	trans	-125.4	14.2	-172.1	-67.8	-177	0	0	0	117
105	L	52.7	Low	52.1	Low	158 Å²	158	136.7 Å²	136.7	83%	0.827	74%	0.744	S	S	*	*	S	Bend	trans	-109.8	3.2	-174.5	-104.1	158.9	0	0	0	118
106	Y	47.4	Very low	51.7	Low	202 Å²	202	137.2 Å²	137.2	79%	0.792	74%	0.736	S	S	*	*			trans	-141.2	109.6	160.7	-102.3	-90.7	0	0	0	110
107	P	54	Low	51.5	Low	93 Å²	93	141.2 Å²	141.2	60%	0.604	74%	0.737	S	S	*	*			trans	-50.3	141.5	155.1	-17.5	29.8	0	0	0	106.9	H109	P107-H109 PolarHBondContact O-N 3.18Å
108	P	50.6	Low	51.7	Low	120 Å²	120	141.3 Å²	141.3	78%	0.779	74%	0.737	S	S	*	*			trans	-63.6	97.6	167.6	28.6	-29.4	0	0	0	104.7	Q110	P108-Q110 PolarHBondContact O-N 3.19Å
109	H	57.8	Low	52.1	Low	147 Å²	147	141.5 Å²	141.5	68%	0.681	74%	0.739	S	S	*	*			trans	-57.6	88.8	149.9	-87.9	-86.8	0	0	0	103.3	P107 S111	P107-H109 PolarHBondContact O-N 3.18Å; H109-S111 PolarHBondContact O-N 2.74Å
110	Q	52.3	Low	52.4	Low	174 Å²	174	141.3 Å²	141.3	81%	0.813	74%	0.735	S	S	*	*			trans	-43.6	105.9	150.9	-82.4	-179.1	3.8	0	0	102.9	P108 S112	P108-Q110 PolarHBondContact O-N 3.19Å; Q110-S112 PolarHBondContact O-N 3.4Å
111	S	51.1	Low	52.9	Low	88 Å²	88	137.4 Å²	137.4	62%	0.615	72%	0.724	S	S	*	*			trans	-61.3	90.1	-177.5	-73.3	0	0	0	0	105.8	H109 Y113 H114	H109-S111 PolarHBondContact O-N 2.74Å; S111-Y113 CarbonylContact O-C 3.3Å; S111-Y113 VanDerWaalsContact O-C 3.3Å; S111-Y113 PolarHBondContact O-N 2.96Å; S111-H114 PolarHBondContact O-N 2.78Å
112	S	48.2	Very low	53.5	Low	109 Å²	109	140.5 Å²	140.5	76%	0.762	73%	0.731	S	S	*	*			trans	-69.7	1.6	167	57.4	0	0	0	0	110.6	Q110 H114	Q110-S112 PolarHBondContact O-N 3.4Å; S112-H114 PolarHBondContact O-N 3.41Å
113	Y	50.2	Low	53.9	Low	201 Å²	201	140.8 Å²	140.8	79%	0.788	72%	0.715	S	S	*	*			trans	-61.8	63.4	141.4	-45.2	-68.1	0	0	0	109.7	S111 R115	S111-Y113 CarbonylContact O-C 3.3Å; S111-Y113 VanDerWaalsContact O-C 3.3Å; S111-Y113 PolarHBondContact O-N 2.96Å; Y113-R115 PolarHBondContact O-N 3.48Å
114	H	54.2	Low	53.9	Low	152 Å²	152	142.1 Å²	142.1	70%	0.704	72%	0.717	S	S	*	*			trans	-56.1	88.9	140.6	-172.9	50.5	0	0	0	104.3	S111 S112 Q116	S111-H114 PolarHBondContact O-N 2.78Å; S112-H114 PolarHBondContact O-N 3.41Å; H114-Q116 PolarHBondContact O-N 3.3Å
115	R	53.6	Low	53.4	Low	178 Å²	178	150 Å²	150	67%	0.672	74%	0.736	S	S	*	*			trans	-53.3	98.2	166.5	-172	-177.6	-162	-84	-0.3	102.8	Y113 H117	Y113-R115 PolarHBondContact O-N 3.48Å; R115-H117 PolarHBondContact O-CD2 3.35Å; R115-H117 PolarHBondContact O-N 2.94Å
116	Q	55.7	Low	53.4	Low	163 Å²	163	149.6 Å²	149.6	76%	0.762	73%	0.731	S	S	*	*			trans	-56	104.1	168.3	-68.9	-171.4	-1.2	0	0	102.8	H114 I118	H114-Q116 PolarHBondContact O-N 3.3Å; Q116-I118 PolarHBondContact O-N 3.15Å
117	H	54.4	Low	53.8	Low	146 Å²	146	146.8 Å²	146.8	68%	0.676	73%	0.728	S	S	*	*			trans	-54.8	116.2	171.8	-76.1	-95.8	0	0	0	103.4	R115 A119	R115-H117 PolarHBondContact O-CD2 3.35Å; R115-H117 PolarHBondContact O-N 2.94Å; H117-A119 PolarHBondContact O-N 3.47Å
118	I	56.2	Low	53.7	Low	135 Å²	135	149.8 Å²	149.8	69%	0.692	74%	0.735	S	S	*	*			trans	-55.9	100.3	168.2	-62.4	171.4	0	0	0	103.5	Q116 V120	Q116-I118 PolarHBondContact O-N 3.15Å; I118-V120 PolarHBondContact O-N 3.13Å
119	A	57.8	Low	53.9	Low	86 Å²	86	151.6 Å²	151.6	71%	0.711	73%	0.732	S	S	*	*			trans	-67.7	95.7	175.5	0	0	0	0	0	104.2	H117 P121	H117-A119 PolarHBondContact O-N 3.47Å; A119-P121 WeakPolarHBondContact O-CD 3.37Å
120	V	54.4	Low	53.7	Low	123 Å²	123	151.9 Å²	151.9	75%	0.745	74%	0.735	S	S	*	*			trans	-60.3	112.7	170.4	-178.7	0	0	0	0	104.8	I118 H122	I118-V120 PolarHBondContact O-N 3.13Å; V120-H122 PolarHBondContact O-N 2.97Å
121	P	58	Low	53.8	Low	78 Å²	78	150.4 Å²	150.4	51%	0.506	73%	0.73	S	S	.	*			trans	-60.8	113.5	178.3	22.8	-29.2	0	0	0	107.1	A119 Y123	A119-P121 WeakPolarHBondContact O-CD 3.37Å; P121-Y123 VanDerWaalsContact C-N 3.32Å; P121-Y123 HydrophobicContact CB-CE2 4.44Å; P121-Y123 HydrophobicContact CG-CE2 3.92Å; P121-Y123 WeakPolarHBondContact O-CD2 3.46Å; P121-Y123 PolarHBondContact O-N 2.96Å
122	H	60	Low	54	Low	158 Å²	158	154.9 Å²	154.9	73%	0.731	74%	0.738	S	S	*	*			trans	-64.3	96.6	172.1	178.9	-67.4	0	0	0	107.3	V120 Q124	V120-H122 PolarHBondContact O-N 2.97Å; H122-Q124 PolarHBondContact O-N 3.49Å
123	Y	58.1	Low	54.4	Low	147 Å²	147	158.4 Å²	158.4	58%	0.576	74%	0.737	S	S	*	*			trans	-67.7	101.8	171.5	-73.4	-78.7	0	0	0	108.4	P121 R125	P121-Y123 VanDerWaalsContact C-N 3.32Å; P121-Y123 HydrophobicContact CB-CE2 4.44Å; P121-Y123 HydrophobicContact CG-CE2 3.92Å; P121-Y123 WeakPolarHBondContact O-CD2 3.46Å; P121-Y123 PolarHBondContact O-N 2.96Å; Y123-R125 PolarHBondContact O-N 3.38Å
124	Q	51.5	Low	54.8	Low	172 Å²	172	154.8 Å²	154.8	80%	0.804	73%	0.732	S	S	*	*			trans	-58.8	131.3	164.6	-90.4	169.6	-21.1	0	0	108.9	H122	H122-Q124 PolarHBondContact O-N 3.49Å
125	R	43.3	Very low	54.8	Low	320 Å²	320	155.1 Å²	155.1	100%	1.208	74%	0.735	S	S	*	*			trans	-63.4	0	174.4	-100.6	-168.5	-171	-160.4	4.9	111.8	Y123	Y123-R125 PolarHBondContact O-N 3.38Å

Retrieved 125 of 125 residues in 46.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).