A0A087XNE9_POEFO Loading...

Family with sequence similarity 32 member A

AlphaFold DB , UniProt , Accession A0A087XNE9, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 116 aa.

						>A0A087XNE9_POEFO|A0A087XNE9
SNMSEYDQIQKSSLKLKGVGELSAGKKKKKKSKESKHRLEQVVTSQNDDEEVKTKKAYIDKRTPAQIAFDKMQEKRQMERILKKASKTHKHRVEDFNRHLDALTEHYDIPKVSWTK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	51.3	Low	68.1	Low	172 Å²	172	150.5 Å²	150.5	100%	1.203	76%	0.761	S	S	*	*				0	110.7	0	-53.5	0	0	0	0	108.8	M3	S1-M3 PolarHBondContact O-N 3.37Å
2	N	61	Low	68.5	Low	174 Å²	174	146.2 Å²	146.2	93%	0.93	76%	0.755	S	S	*	*			trans	-86.7	107	179.7	-131.2	18.6	0	0	0	107.7	S4	N2-S4 PolarHBondContact O-N 2.91Å
3	M	64.4	Low	68.8	Low	131 Å²	131	142.8 Å²	142.8	65%	0.645	75%	0.752	S	S	*	*			trans	-69.4	126.5	170.7	-85.3	175.4	64.5	0	0	108.2	S1	S1-M3 PolarHBondContact O-N 3.37Å
4	S	74.9	Confident	68.6	Low	66 Å²	66	143.1 Å²	143.1	46%	0.462	75%	0.753	S	S	.	*			trans	-72.1	142.5	176.4	94.1	0	0	0	0	109.9	N2 Y6 D7	N2-S4 PolarHBondContact O-N 2.91Å; S4-Y6 PolarHBondContact O-N 3.34Å; S4-D7 PolarHBondContact O-N 3.49Å; S4-D7 VanDerWaalsContact O-N 3.08Å
5	E	65.8	Low	68.8	Low	177 Å²	177	146.6 Å²	146.6	83%	0.827	76%	0.76	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.8	-12.3	-179	-151	171.8	-168.3	0	0	113.8
6	Y	72.1	Confident	68.6	Low	169 Å²	169	144.7 Å²	144.7	66%	0.663	75%	0.75	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102	-3.1	-177.3	-66.7	-90.6	0	0	0	114.6	S4 Q8 I9	S4-Y6 PolarHBondContact O-N 3.34Å; Y6-Q8 PolarHBondContact O-N 2.88Å; Y6-I9 HydrophobicContact CD1-CD1 3.47Å; Y6-I9 VanDerWaalsContact CD1-CD1 3.47Å; Y6-I9 HydrophobicContact CE1-CD1 4.16Å; Y6-I9 HydrophobicContact CG-CD1 4.27Å
7	D	72.1	Confident	67.8	Low	120 Å²	120	149.5 Å²	149.5	64%	0.642	76%	0.764	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.8	-22.2	-177.8	-100.5	-4.9	0	0	0	113.3	S4	S4-D7 PolarHBondContact O-N 3.49Å; S4-D7 VanDerWaalsContact O-N 3.08Å
8	Q	73.2	Confident	67.3	Low	163 Å²	163	145.6 Å²	145.6	76%	0.762	77%	0.767	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.3	8.9	-174.8	-73.7	175.5	-12.4	0	0	114.7	Y6 Q10	Y6-Q8 PolarHBondContact O-N 2.88Å; Q8-Q10 PolarHBondContact O-N 3.44Å
9	I	73.3	Confident	66.6	Low	98 Å²	98	142.7 Å²	142.7	50%	0.503	76%	0.756	S	S	.	*			trans	-82.2	121.9	-176.5	-54.9	179.5	0	0	0	110.8	Y6 K11	Y6-I9 HydrophobicContact CD1-CD1 3.47Å; Y6-I9 VanDerWaalsContact CD1-CD1 3.47Å; Y6-I9 HydrophobicContact CE1-CD1 4.16Å; Y6-I9 HydrophobicContact CG-CD1 4.27Å; I9-K11 PolarHBondContact O-N 2.96Å; I9-K11 VanDerWaalsContact O-N 3.1Å
10	Q	69.1	Low	66	Low	180 Å²	180	138.2 Å²	138.2	84%	0.841	75%	0.745	S	S	*	*			trans	-65.3	105.6	174.8	-76.7	-173.6	-35.3	0	0	111.6	Q8 S12	Q8-Q10 PolarHBondContact O-N 3.44Å; Q10-S12 PolarHBondContact O-N 3.35Å
11	K	72.4	Confident	65.4	Low	205 Å²	205	141.3 Å²	141.3	89%	0.891	76%	0.755	S	S	*	*			trans	-80.4	52	179.1	-59.6	179	-175.2	174.2	0	113.1	I9	I9-K11 PolarHBondContact O-N 2.96Å; I9-K11 VanDerWaalsContact O-N 3.1Å
12	S	72.4	Confident	65.4	Low	99 Å²	99	136.4 Å²	136.4	69%	0.692	71%	0.714	S	S	*	*			trans	-91.8	143	177	78.5	0	0	0	0	112.2	Q10 L14	Q10-S12 PolarHBondContact O-N 3.35Å; S12-L14 PolarHBondContact O-N 3.08Å
13	S	72	Confident	65.2	Low	103 Å²	103	132 Å²	132	72%	0.72	70%	0.697	S	S	*	*			trans	-67.9	127	173.9	171.5	0	0	0	0	110.2	K15	S13-K15 PolarHBondContact O-N 3.47Å
14	L	67	Low	64.8	Low	146 Å²	146	129.6 Å²	129.6	76%	0.764	70%	0.699	S	S	*	*			trans	-63.2	104.9	179.6	-174.6	67.2	0	0	0	111	S12 L16	S12-L14 PolarHBondContact O-N 3.08Å; L14-L16 HydrophobicContact CD2-CD2 3.93Å; L14-L16 HydrophobicContact CD2-CG 4.42Å; L14-L16 HydrophobicContact CG-CD2 4.06Å; L14-L16 HydrophobicContact CG-CG 4.38Å; L14-L16 PolarHBondContact O-N 2.99Å
15	K	71.1	Confident	63.9	Low	196 Å²	196	129 Å²	129	85%	0.852	70%	0.703	S	S	*	*			trans	-86.2	102.3	173.3	-67.6	-164.4	178.7	179.6	0	110	S13 K17	S13-K15 PolarHBondContact O-N 3.47Å; K15-K17 PolarHBondContact O-N 3.32Å
16	L	65.8	Low	63.3	Low	116 Å²	116	127.1 Å²	127.1	61%	0.607	69%	0.692	S	S	*	*			trans	-77.3	114	174.8	-64.3	174.4	0	0	0	110.1	L14 G18 V19	L14-L16 HydrophobicContact CD2-CD2 3.93Å; L14-L16 HydrophobicContact CD2-CG 4.42Å; L14-L16 HydrophobicContact CG-CD2 4.06Å; L14-L16 HydrophobicContact CG-CG 4.38Å; L14-L16 PolarHBondContact O-N 2.99Å; L16-G18 PolarHBondContact O-N 2.98Å; L16-G18 VanDerWaalsContact O-N 3.15Å; L16-V19 PolarHBondContact O-N 3.48Å
17	K	55.1	Low	62.6	Low	226 Å²	226	125.1 Å²	125.1	98%	0.983	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.2	113.3	175.9	-163.6	166.6	-176.4	177.3	0	108.9	K15	K15-K17 PolarHBondContact O-N 3.32Å
18	G	58.9	Low	61.9	Low	79 Å²	79	127.8 Å²	127.8	81%	0.814	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	128.6	-14.7	-175.1	0	0	0	0	0	114.1	L16	L16-G18 PolarHBondContact O-N 2.98Å; L16-G18 VanDerWaalsContact O-N 3.15Å
19	V	53.7	Low	61.2	Low	92 Å²	92	127.2 Å²	127.2	56%	0.558	69%	0.688	S	S	*	*			trans	-104.2	77.3	172	-171.2	0	0	0	0	108.6	L16	L16-V19 PolarHBondContact O-N 3.48Å
20	G	53.8	Low	60.6	Low	52 Å²	52	129.2 Å²	129.2	54%	0.536	69%	0.692	S	S	.	*			trans	-55.7	158.1	164.5	0	0	0	0	0	110.6	L22	G20-L22 VanDerWaalsContact C-N 3.28Å; G20-L22 WeakPolarHBondContact O-CG 3.27Å; G20-L22 PolarHBondContact O-N 3.19Å
21	E	53.4	Low	60.4	Low	204 Å²	204	128.3 Å²	128.3	95%	0.953	69%	0.686	S	S	*	*			trans	-55.8	86.1	-179.7	-73	176.8	149.7	0	0	111.7	S23	E21-S23 PolarHBondContact O-N 3.03Å
22	L	53	Low	60.1	Low	68 Å²	68	122.2 Å²	122.2	36%	0.356	67%	0.669	S	S	.	*			trans	-89.2	102.4	173.9	-68.5	175.5	0	0	0	107.3	G20 K26 K27	G20-L22 VanDerWaalsContact C-N 3.28Å; G20-L22 WeakPolarHBondContact O-CG 3.27Å; G20-L22 PolarHBondContact O-N 3.19Å; L22-K26 HydrophobicContact CB-CB 4.46Å; L22-K26 HydrophobicContact CD2-CB 4.33Å; L22-K26 HydrophobicContact CD2-CD 3.85Å; L22-K27 HydrophobicContact CB-CG 4.36Å
23	S	55.6	Low	60.1	Low	82 Å²	82	124.3 Å²	124.3	57%	0.573	67%	0.666	S	S	*	*			trans	-42.6	142.7	168.8	62.1	0	0	0	0	111.2	E21 G25 K26 K27	E21-S23 PolarHBondContact O-N 3.03Å; S23-G25 PolarHBondContact O-N 2.96Å; S23-K26 PolarHBondContact O-N 3.36Å; S23-K27 PolarHBondContact O-N 3.47Å
24	A	56.6	Low	60	Low	81 Å²	81	124.4 Å²	124.4	67%	0.669	66%	0.655	S	S	*	*	H	α-helix	trans	-51.8	-27.1	-170.1	0	0	0	0	0	114.2	K28	A24-K28 PolarHBondContact O-N 3.47Å
25	G	55.5	Low	60.1	Low	54 Å²	54	121 Å²	121	56%	0.557	64%	0.643	S	S	*	*	H	α-helix	trans	-66.9	-39.8	174	0	0	0	0	0	114.7	S23 K29	S23-G25 PolarHBondContact O-N 2.96Å; G25-K29 PolarHBondContact O-N 2.94Å
26	K	54.3	Low	60.1	Low	137 Å²	137	117.8 Å²	117.8	60%	0.596	63%	0.629	S	S	*	*	H	α-helix	trans	-70.6	-33.3	176.8	-82.2	-177.5	179.2	173.8	0	111.9	L22 S23 K29 K30	L22-K26 HydrophobicContact CB-CB 4.46Å; L22-K26 HydrophobicContact CD2-CB 4.33Å; L22-K26 HydrophobicContact CD2-CD 3.85Å; S23-K26 PolarHBondContact O-N 3.36Å; K26-K29 PolarHBondContact O-N 3.49Å; K26-K30 WeakPolarHBondContact O-CB 3.4Å; K26-K30 PolarHBondContact O-N 2.97Å
27	K	55.7	Low	60.3	Low	127 Å²	127	117.8 Å²	117.8	55%	0.552	63%	0.626	S	S	*	*	H	α-helix	trans	-63.3	-43.3	175	-80.1	-175.7	178.3	175.7	0	112.6	L22 S23 K30 K31	L22-K27 HydrophobicContact CB-CG 4.36Å; S23-K27 PolarHBondContact O-N 3.47Å; K27-K30 PolarHBondContact O-N 3.49Å; K27-K31 WeakPolarHBondContact O-CB 3.36Å; K27-K31 PolarHBondContact O-N 2.84Å
28	K	58.2	Low	61	Low	175 Å²	175	114.8 Å²	114.8	76%	0.761	61%	0.608	S	S	*	*	H	α-helix	trans	-62.8	-43.1	176.2	-78.9	-173.3	176.2	-179	0	112.1	A24 S32	A24-K28 PolarHBondContact O-N 3.47Å; K28-S32 PolarHBondContact O-N 3.49Å; K28-S32 VanDerWaalsContact O-N 3.08Å
29	K	59.2	Low	61.3	Low	152 Å²	152	116.4 Å²	116.4	66%	0.661	60%	0.598	S	S	*	*	H	α-helix	trans	-69.7	-35.9	179.5	-154.8	172.3	-173.7	174.2	0	112.7	G25 K26 K33	G25-K29 PolarHBondContact O-N 2.94Å; K26-K29 PolarHBondContact O-N 3.49Å; K29-K33 WeakPolarHBondContact O-CG 3.47Å; K29-K33 PolarHBondContact O-N 3.21Å
30	K	61	Low	62	Low	139 Å²	139	116.9 Å²	116.9	60%	0.604	59%	0.594	S	S	*	*	H	α-helix	trans	-69.7	-42.2	175.6	-164.7	176	-178.8	-178.9	0	111.8	K26 K27 S32 K33 E34	K26-K30 WeakPolarHBondContact O-CB 3.4Å; K26-K30 PolarHBondContact O-N 2.97Å; K27-K30 PolarHBondContact O-N 3.49Å; K30-S32 PolarHBondContact O-N 3.49Å; K30-K33 PolarHBondContact O-N 2.83Å; K30-E34 WeakPolarHBondContact O-CB 3.46Å; K30-E34 PolarHBondContact O-N 3.22Å
31	K	64.8	Low	62.5	Low	162 Å²	162	119.6 Å²	119.6	70%	0.704	59%	0.592	S	S	*	*	H	α-helix	trans	-62.8	-40.4	176.2	-171.2	174.7	-178.2	177.3	0	112.5	K27 E34 S35	K27-K31 WeakPolarHBondContact O-CB 3.36Å; K27-K31 PolarHBondContact O-N 2.84Å; K31-E34 PolarHBondContact O-N 2.94Å; K31-S35 WeakPolarHBondContact O-CB 3.47Å; K31-S35 PolarHBondContact O-N 3.46Å
32	S	65.4	Low	63	Low	76 Å²	76	113.8 Å²	113.8	53%	0.531	57%	0.571	S	S	.	*	H	α-helix	trans	-64.8	-42.1	175.6	163.4	0	0	0	0	112.5	K28 K30 S35 K36	K28-S32 PolarHBondContact O-N 3.49Å; K28-S32 VanDerWaalsContact O-N 3.08Å; K30-S32 PolarHBondContact O-N 3.49Å; S32-S35 PolarHBondContact O-N 3.03Å; S32-K36 WeakPolarHBondContact O-CB 3.48Å; S32-K36 PolarHBondContact O-N 3.03Å
33	K	72.2	Confident	63.5	Low	144 Å²	144	113.7 Å²	113.7	63%	0.626	57%	0.573	S	S	*	*	H	α-helix	trans	-65.6	-40	175.7	-75.4	-175.7	176.3	-169.3	0	112.5	K29 K30 K36 H37	K29-K33 WeakPolarHBondContact O-CG 3.47Å; K29-K33 PolarHBondContact O-N 3.21Å; K30-K33 PolarHBondContact O-N 2.83Å; K33-K36 PolarHBondContact O-N 2.88Å; K33-H37 WeakPolarHBondContact O-CB 3.47Å; K33-H37 PolarHBondContact O-N 3.27Å
34	E	69.5	Low	63.7	Low	104 Å²	104	113.4 Å²	113.4	49%	0.486	57%	0.568	S	S	.	*	H	α-helix	trans	-68.8	-38	178.1	-170	176.7	170.3	0	0	112.1	K30 K31 K36 H37 R38	K30-E34 WeakPolarHBondContact O-CB 3.46Å; K30-E34 PolarHBondContact O-N 3.22Å; K31-E34 PolarHBondContact O-N 2.94Å; E34-K36 VanDerWaalsContact C-N 3.34Å; E34-H37 PolarHBondContact O-N 3.13Å; E34-R38 WeakPolarHBondContact O-CB 3.4Å; E34-R38 WeakPolarHBondContact O-CG 3.44Å; E34-R38 PolarHBondContact O-N 3.29Å
35	S	69.3	Low	63.7	Low	75 Å²	75	112.8 Å²	112.8	52%	0.524	56%	0.558	S	S	.	*	H	α-helix	trans	-64.7	-39.2	173.1	126.4	0	0	0	0	111.7	K31 S32 R38 L39	K31-S35 WeakPolarHBondContact O-CB 3.47Å; K31-S35 PolarHBondContact O-N 3.46Å; S32-S35 PolarHBondContact O-N 3.03Å; S35-R38 PolarHBondContact O-N 2.7Å; S35-L39 WeakPolarHBondContact O-CB 3.46Å; S35-L39 PolarHBondContact O-N 2.93Å
36	K	71.3	Confident	63.7	Low	129 Å²	129	116.2 Å²	116.2	56%	0.561	56%	0.56	S	S	*	*	H	α-helix	trans	-68.3	-43	177.8	-163.2	176.3	179.2	-175.8	0	111.6	S32 K33 E34 R38 L39 E40	S32-K36 WeakPolarHBondContact O-CB 3.48Å; S32-K36 PolarHBondContact O-N 3.03Å; K33-K36 PolarHBondContact O-N 2.88Å; E34-K36 VanDerWaalsContact C-N 3.34Å; K36-R38 PolarHBondContact O-N 3.49Å; K36-L39 PolarHBondContact O-N 3.04Å; K36-E40 VanDerWaalsContact CE-OE1 3.27Å; K36-E40 WeakPolarHBondContact CE-OE1 3.5Å; K36-E40 WeakPolarHBondContact O-CB 3.48Å; K36-E40 WeakPolarHBondContact O-CG 3.24Å; K36-E40 PolarHBondContact O-N 3.03Å
37	H	70.8	Confident	63.6	Low	116 Å²	116	114 Å²	114	54%	0.537	56%	0.555	S	S	.	*	H	α-helix	trans	-63.4	-40.3	174.7	-174.9	-79.7	0	0	0	112.4	K33 E34 L39 E40 Q41	K33-H37 WeakPolarHBondContact O-CB 3.47Å; K33-H37 PolarHBondContact O-N 3.27Å; E34-H37 PolarHBondContact O-N 3.13Å; H37-L39 VanDerWaalsContact C-N 3.34Å; H37-E40 PolarHBondContact O-N 2.97Å; H37-Q41 VanDerWaalsContact O-CB 3.27Å; H37-Q41 WeakPolarHBondContact O-CB 3.45Å; H37-Q41 PolarHBondContact O-N 3.32Å
38	R	69.6	Low	63.3	Low	162 Å²	162	113.5 Å²	113.5	61%	0.611	56%	0.558	S	S	*	*	H	α-helix	trans	-64.5	-38.7	173.8	-79	-176	-179.9	-137.9	1.1	112.1	E34 S35 K36 V42	E34-R38 WeakPolarHBondContact O-CB 3.4Å; E34-R38 WeakPolarHBondContact O-CG 3.44Å; E34-R38 PolarHBondContact O-N 3.29Å; S35-R38 PolarHBondContact O-N 2.7Å; K36-R38 PolarHBondContact O-N 3.49Å; R38-V42 VanDerWaalsContact O-CG2 3.23Å; R38-V42 WeakPolarHBondContact O-CG2 3.46Å; R38-V42 PolarHBondContact O-N 3.08Å
39	L	65.3	Low	62.9	Low	113 Å²	113	109.4 Å²	109.4	59%	0.592	55%	0.545	S	S	*	.	H	α-helix	trans	-68.5	-43.9	177.5	-170.7	65.4	0	0	0	111.2	S35 K36 H37 Q41 V42 V43	S35-L39 WeakPolarHBondContact O-CB 3.46Å; S35-L39 PolarHBondContact O-N 2.93Å; K36-L39 PolarHBondContact O-N 3.04Å; H37-L39 VanDerWaalsContact C-N 3.34Å; L39-Q41 VanDerWaalsContact C-N 3.35Å; L39-Q41 PolarHBondContact O-N 3.4Å; L39-V42 PolarHBondContact O-N 2.75Å; L39-V43 WeakPolarHBondContact O-CB 3.42Å; L39-V43 VanDerWaalsContact O-CG2 3.24Å; L39-V43 WeakPolarHBondContact O-CG2 3.45Å; L39-V43 PolarHBondContact O-N 3.1Å
40	E	67.4	Low	62.5	Low	103 Å²	103	108.3 Å²	108.3	48%	0.481	54%	0.542	S	S	.	.	H	α-helix	trans	-61.4	-42.3	174.8	-76.1	169.7	-170.9	0	0	111.3	K36 H37 V42 V43 T44	K36-E40 VanDerWaalsContact CE-OE1 3.27Å; K36-E40 WeakPolarHBondContact CE-OE1 3.5Å; K36-E40 WeakPolarHBondContact O-CB 3.48Å; K36-E40 WeakPolarHBondContact O-CG 3.24Å; K36-E40 PolarHBondContact O-N 3.03Å; H37-E40 PolarHBondContact O-N 2.97Å; E40-V42 PolarHBondContact O-N 3.14Å; E40-V43 PolarHBondContact O-N 3.08Å; E40-T44 WeakPolarHBondContact O-CG2 3.23Å; E40-T44 PolarHBondContact O-N 3.32Å; E40-T44 PolarHBondContact O-OG1 3.01Å
41	Q	64	Low	62	Low	108 Å²	108	109.3 Å²	109.3	51%	0.505	55%	0.549	S	S	.	.	H	α-helix	trans	-63.4	-39.3	176.2	-170.9	175.6	9	0	0	112.7	H37 L39 T44 S45	H37-Q41 VanDerWaalsContact O-CB 3.27Å; H37-Q41 WeakPolarHBondContact O-CB 3.45Å; H37-Q41 PolarHBondContact O-N 3.32Å; L39-Q41 VanDerWaalsContact C-N 3.35Å; L39-Q41 PolarHBondContact O-N 3.4Å; Q41-T44 WeakPolarHBondContact CA-OG1 3.27Å; Q41-T44 PolarHBondContact O-OG1 3.06Å; Q41-S45 WeakPolarHBondContact O-CB 3.36Å; Q41-S45 PolarHBondContact O-N 3.36Å; Q41-S45 PolarHBondContact O-OG 3.16Å; Q41-S45 VanDerWaalsContact O-OG 3.1Å
42	V	64.9	Low	61.2	Low	82 Å²	82	107.8 Å²	107.8	50%	0.497	55%	0.553	S	S	.	*	H	α-helix	trans	-67.5	-39.1	175.2	170.4	0	0	0	0	111	R38 L39 E40 Q46	R38-V42 VanDerWaalsContact O-CG2 3.23Å; R38-V42 WeakPolarHBondContact O-CG2 3.46Å; R38-V42 PolarHBondContact O-N 3.08Å; L39-V42 PolarHBondContact O-N 2.75Å; E40-V42 PolarHBondContact O-N 3.14Å; V42-Q46 WeakPolarHBondContact O-CG 3.38Å; V42-Q46 PolarHBondContact O-N 2.8Å; V42-Q46 VanDerWaalsContact O-N 3.13Å
43	V	63.2	Low	60.5	Low	67 Å²	67	109.9 Å²	109.9	41%	0.406	55%	0.552	S	S	.	*	H	α-helix	trans	-69.1	-42.1	177.7	172.2	0	0	0	0	110.9	L39 E40 Q46 N47	L39-V43 WeakPolarHBondContact O-CB 3.42Å; L39-V43 VanDerWaalsContact O-CG2 3.24Å; L39-V43 WeakPolarHBondContact O-CG2 3.45Å; L39-V43 PolarHBondContact O-N 3.1Å; E40-V43 PolarHBondContact O-N 3.08Å; V43-Q46 PolarHBondContact O-N 3.41Å; V43-N47 WeakPolarHBondContact CG1-ND2 3.43Å; V43-N47 PolarHBondContact O-N 3.4Å; V43-N47 VanDerWaalsContact O-N 3.08Å; V43-N47 PolarHBondContact O-ND2 3.12Å
44	T	59	Low	59.5	Low	75 Å²	75	108 Å²	108	46%	0.46	55%	0.553	S	S	.	*	H	α-helix	trans	-66.8	-40.2	177	48.7	0	0	0	0	112.1	E40 Q41 Q46 N47 D48	E40-T44 WeakPolarHBondContact O-CG2 3.23Å; E40-T44 PolarHBondContact O-N 3.32Å; E40-T44 PolarHBondContact O-OG1 3.01Å; Q41-T44 WeakPolarHBondContact CA-OG1 3.27Å; Q41-T44 PolarHBondContact O-OG1 3.06Å; T44-Q46 VanDerWaalsContact C-N 3.25Å; T44-Q46 PolarHBondContact O-N 3.39Å; T44-N47 PolarHBondContact O-N 3.26Å; T44-N47 VanDerWaalsContact O-N 3.14Å; T44-D48 PolarHBondContact O-N 2.74Å
45	S	57.7	Low	58.8	Low	68 Å²	68	112.2 Å²	112.2	48%	0.476	57%	0.57	S	S	.	*	H	α-helix	trans	-66	-26.3	175.1	-65.1	0	0	0	0	113.3	Q41	Q41-S45 WeakPolarHBondContact O-CB 3.36Å; Q41-S45 PolarHBondContact O-N 3.36Å; Q41-S45 PolarHBondContact O-OG 3.16Å; Q41-S45 VanDerWaalsContact O-OG 3.1Å
46	Q	55.9	Low	58.1	Low	126 Å²	126	117.4 Å²	117.4	59%	0.589	58%	0.583	S	S	*	*	H	α-helix	trans	-78.1	-29.9	172.3	-76.8	-179	-14.6	0	0	113.1	V42 V43 T44 E50	V42-Q46 WeakPolarHBondContact O-CG 3.38Å; V42-Q46 PolarHBondContact O-N 2.8Å; V42-Q46 VanDerWaalsContact O-N 3.13Å; V43-Q46 PolarHBondContact O-N 3.41Å; T44-Q46 VanDerWaalsContact C-N 3.25Å; T44-Q46 PolarHBondContact O-N 3.39Å; Q46-E50 WeakPolarHBondContact O-CG 3.41Å
47	N	51.2	Low	57.6	Low	92 Å²	92	115.6 Å²	115.6	49%	0.492	59%	0.592	S	S	.	*	H	α-helix	trans	-83	-35.9	-179.9	-75	-74.3	0	0	0	112.9	V43 T44 D49 E50 E51	V43-N47 WeakPolarHBondContact CG1-ND2 3.43Å; V43-N47 PolarHBondContact O-N 3.4Å; V43-N47 VanDerWaalsContact O-N 3.08Å; V43-N47 PolarHBondContact O-ND2 3.12Å; T44-N47 PolarHBondContact O-N 3.26Å; T44-N47 VanDerWaalsContact O-N 3.14Å; N47-D49 PolarHBondContact O-N 3.35Å; N47-E50 PolarHBondContact O-N 3.48Å; N47-E50 VanDerWaalsContact O-N 3.08Å; N47-E51 PolarHBondContact O-N 3.15Å
48	D	49.1	Very low	57.5	Low	115 Å²	115	119.2 Å²	119.2	62%	0.615	60%	0.602	S	S	*	*	H	α-helix	trans	-65	-27.3	174.5	-75.5	-32.9	0	0	0	112.2	T44	T44-D48 PolarHBondContact O-N 2.74Å
49	D	49.5	Very low	57.5	Low	90 Å²	90	118 Å²	118	48%	0.481	61%	0.606	S	S	.	*	H	α-helix	trans	-79.3	-17.6	174.8	-100.3	-43.9	0	0	0	113.7	N47 K53	N47-D49 PolarHBondContact O-N 3.35Å; D49-K53 VanDerWaalsContact CG-NZ 3.31Å; D49-K53 WeakPolarHBondContact O-CD 3.12Å; D49-K53 WeakPolarHBondContact O-CE 3.22Å; D49-K53 WeakPolarHBondContact O-CG 3.37Å; D49-K53 PolarHBondContact O-NZ 3.08Å; D49-K53 VanDerWaalsContact O-NZ 3.12Å; D49-K53 IonicContact OD1-NZ 2.85Å; D49-K53 PolarHBondContact OD1-NZ 3.28Å
50	E	51.9	Low	57.9	Low	129 Å²	129	116 Å²	116	60%	0.603	60%	0.596	S	S	*	*	H	α-helix	trans	-97.1	-40.4	-179.6	-78.2	-68.2	155.6	0	0	111.8	Q46 N47 V52 K53	Q46-E50 WeakPolarHBondContact O-CG 3.41Å; N47-E50 PolarHBondContact O-N 3.48Å; N47-E50 VanDerWaalsContact O-N 3.08Å; E50-V52 PolarHBondContact O-N 3.03Å; E50-K53 PolarHBondContact O-N 3.39Å
51	E	49.5	Very low	58.8	Low	160 Å²	160	120.6 Å²	120.6	75%	0.748	62%	0.615	S	S	*	*	H	α-helix	trans	-70.4	-29.3	-177.4	-85.2	-166	156.6	0	0	113.8	N47 T54	N47-E51 PolarHBondContact O-N 3.15Å; E51-T54 PolarHBondContact O-OG1 2.99Å
52	V	47.8	Very low	59.8	Low	129 Å²	129	121 Å²	121	78%	0.782	61%	0.612	S	S	*	*	S	Bend	trans	-88.7	-14	179.4	-172.7	0	0	0	0	112.8	E50	E50-V52 PolarHBondContact O-N 3.03Å
53	K	51.1	Low	61	Low	121 Å²	121	120.3 Å²	120.3	53%	0.526	61%	0.607	S	S	.	*	S	Bend	trans	-92.1	2.2	-178.2	-74.2	-174.3	-162.9	130.4	0	114.9	D49 E50 K55	D49-K53 VanDerWaalsContact CG-NZ 3.31Å; D49-K53 WeakPolarHBondContact O-CD 3.12Å; D49-K53 WeakPolarHBondContact O-CE 3.22Å; D49-K53 WeakPolarHBondContact O-CG 3.37Å; D49-K53 PolarHBondContact O-NZ 3.08Å; D49-K53 VanDerWaalsContact O-NZ 3.12Å; D49-K53 IonicContact OD1-NZ 2.85Å; D49-K53 PolarHBondContact OD1-NZ 3.28Å; E50-K53 PolarHBondContact O-N 3.39Å; K53-K55 PolarHBondContact O-N 3Å; K53-K55 VanDerWaalsContact O-N 3.16Å
54	T	51.4	Low	62.3	Low	105 Å²	105	122.4 Å²	122.4	64%	0.644	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.1	1.8	-177.9	55	0	0	0	0	115.5	E51	E51-T54 PolarHBondContact O-OG1 2.99Å
55	K	54.8	Low	63.8	Low	192 Å²	192	122.3 Å²	122.3	84%	0.835	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-135.8	8.7	-178.1	-64.4	-171	-176.6	179.1	0	117.4	K53	K53-K55 PolarHBondContact O-N 3Å; K53-K55 VanDerWaalsContact O-N 3.16Å
56	K	54.7	Low	65.4	Low	184 Å²	184	123.6 Å²	123.6	80%	0.8	63%	0.628	S	S	*	*	S	Bend	trans	-129.4	104.1	168.8	-67.2	-175.8	-176.6	176.9	0	107.3	Y58	K56-Y58 PolarHBondContact O-N 3.07Å
57	A	61.4	Low	67	Low	90 Å²	90	120.2 Å²	120.2	74%	0.744	61%	0.613	S	S	*	*			trans	-43.3	121.6	167.8	0	0	0	0	0	107.8	I59	A57-I59 VanDerWaalsContact C-N 3.27Å; A57-I59 PolarHBondContact O-N 3.28Å
58	Y	67.8	Low	68.9	Low	192 Å²	192	118.6 Å²	118.6	75%	0.753	61%	0.613	S	S	*	*			trans	-64.4	94.7	178.4	176.3	-95.3	0	0	0	107.4	K56 D60	K56-Y58 PolarHBondContact O-N 3.07Å; Y58-D60 HydrophobicContact CE1-CB 4.47Å; Y58-D60 PolarHBondContact O-N 2.95Å
59	I	70.9	Confident	71	Confident	137 Å²	137	118.4 Å²	118.4	70%	0.703	61%	0.607	S	S	*	*			trans	-76.3	111.3	174.5	-61	168.6	0	0	0	105.6	A57 K61	A57-I59 VanDerWaalsContact C-N 3.27Å; A57-I59 PolarHBondContact O-N 3.28Å; I59-K61 PolarHBondContact O-N 3.31Å; I59-K61 VanDerWaalsContact O-N 3.08Å
60	D	73.2	Confident	73	Confident	72 Å²	72	115.9 Å²	115.9	39%	0.385	59%	0.593	S	S	.	*			trans	-60.9	112.5	173.6	-170.4	0.3	0	0	0	109	Y58 R62	Y58-D60 HydrophobicContact CE1-CB 4.47Å; Y58-D60 PolarHBondContact O-N 2.95Å; D60-R62 PolarHBondContact O-N 3.31Å; D60-R62 WeakPolarHBondContact OD1-CB 3.31Å; D60-R62 WeakPolarHBondContact OD1-CD 2.84Å; D60-R62 WeakPolarHBondContact OD1-CG 3.46Å; D60-R62 PolarHBondContact OD1-N 2.9Å
61	K	85.8	Confident	74.9	Confident	199 Å²	199	115.7 Å²	115.7	87%	0.865	59%	0.59	S	S	*	*			trans	-83.6	1.2	179.5	-60.4	-175.3	-178.2	-178.1	0	112.2	I59	I59-K61 PolarHBondContact O-N 3.31Å; I59-K61 VanDerWaalsContact O-N 3.08Å
62	R	84.9	Confident	76.8	Confident	117 Å²	117	111.5 Å²	111.5	44%	0.442	57%	0.571	S	S	.	*			trans	-67.3	142	-178.9	-71.2	174.7	-173.6	-179.6	9.5	110.8	D60 Q66 I67 D70	D60-R62 PolarHBondContact O-N 3.31Å; D60-R62 WeakPolarHBondContact OD1-CB 3.31Å; D60-R62 WeakPolarHBondContact OD1-CD 2.84Å; D60-R62 WeakPolarHBondContact OD1-CG 3.46Å; D60-R62 PolarHBondContact OD1-N 2.9Å; R62-Q66 VanDerWaalsContact CA-OE1 3.26Å; R62-Q66 HydrophobicContact CB-CB 4Å; R62-Q66 HydrophobicContact CG-CB 4.35Å; R62-I67 HydrophobicContact CB-CD1 4.33Å; R62-I67 HydrophobicContact CB-CG1 3.75Å; R62-D70 WeakPolarHBondContact CD-OD2 3.36Å; R62-D70 IonicContact CZ-OD2 3.96Å; R62-D70 IonicContact NE-OD2 2.64Å; R62-D70 IonicContact NH1-OD2 3.34Å; R62-D70 PolarHBondContact NH1-OD2 3.47Å
63	T	91.2	Very high	78.9	Confident	66 Å²	66	109.3 Å²	109.3	41%	0.405	55%	0.553	S	S	.	*			trans	-70.2	156.9	172.7	67.5	0	0	0	0	110.1	A65 Q66 I67	T63-A65 PolarHBondContact O-N 2.85Å; T63-A65 VanDerWaalsContact O-N 3.12Å; T63-Q66 WeakPolarHBondContact O-CB 3.33Å; T63-Q66 PolarHBondContact O-N 2.95Å; T63-Q66 WeakPolarHBondContact OG1-CG 3.44Å; T63-Q66 PolarHBondContact OG1-N 3.43Å; T63-I67 WeakPolarHBondContact O-CG1 3.35Å; T63-I67 PolarHBondContact O-N 3.41Å
64	P	89.5	Confident	80.8	Confident	112 Å²	112	109.1 Å²	109.1	73%	0.727	55%	0.554	S	S	*	*	H	α-helix	trans	-53.2	-34.8	174.8	-27.8	35.3	0	0	0	113.2	A68	P64-A68 WeakPolarHBondContact O-CB 3.24Å; P64-A68 PolarHBondContact O-N 2.84Å
65	A	90.3	Very high	82.5	Confident	72 Å²	72	111.5 Å²	111.5	60%	0.595	56%	0.555	S	S	*	*	H	α-helix	trans	-66.5	-41.6	175.3	0	0	0	0	0	112.8	T63 A68 F69	T63-A65 PolarHBondContact O-N 2.85Å; T63-A65 VanDerWaalsContact O-N 3.12Å; A65-A68 PolarHBondContact O-N 3.22Å; A65-F69 WeakPolarHBondContact O-CB 3.36Å; A65-F69 PolarHBondContact O-N 3.27Å
66	Q	91.3	Very high	84.3	Confident	96 Å²	96	108 Å²	108	45%	0.449	54%	0.536	S	S	.	.	H	α-helix	trans	-64.9	-44.6	175.8	-74	168.1	-13.3	0	0	111.1	R62 T63 A68 F69 D70	R62-Q66 VanDerWaalsContact CA-OE1 3.26Å; R62-Q66 HydrophobicContact CB-CB 4Å; R62-Q66 HydrophobicContact CG-CB 4.35Å; T63-Q66 WeakPolarHBondContact O-CB 3.33Å; T63-Q66 PolarHBondContact O-N 2.95Å; T63-Q66 WeakPolarHBondContact OG1-CG 3.44Å; T63-Q66 PolarHBondContact OG1-N 3.43Å; Q66-A68 VanDerWaalsContact C-N 3.32Å; Q66-A68 PolarHBondContact O-N 2.93Å; Q66-F69 PolarHBondContact O-N 3.25Å; Q66-D70 VanDerWaalsContact O-CG 3.27Å; Q66-D70 PolarHBondContact O-N 2.64Å
67	I	90.6	Very high	86	Confident	54 Å²	54	103.9 Å²	103.9	28%	0.277	52%	0.52	S	S	.	.	H	α-helix	trans	-60.1	-43.1	176.7	-63.1	168.8	0	0	0	110.9	R62 T63 K71	R62-I67 HydrophobicContact CB-CD1 4.33Å; R62-I67 HydrophobicContact CB-CG1 3.75Å; T63-I67 WeakPolarHBondContact O-CG1 3.35Å; T63-I67 PolarHBondContact O-N 3.41Å; I67-K71 HydrophobicContact CG2-CD 4.16Å; I67-K71 WeakPolarHBondContact O-CB 3.49Å; I67-K71 VanDerWaalsContact O-CG 3.3Å; I67-K71 WeakPolarHBondContact O-CG 3.13Å; I67-K71 PolarHBondContact O-N 2.96Å
68	A	90.6	Very high	87.1	Confident	59 Å²	59	106.2 Å²	106.2	49%	0.488	52%	0.517	S	S	.	.	H	α-helix	trans	-65.3	-40.3	177.5	0	0	0	0	0	112.2	P64 A65 Q66 M72	P64-A68 WeakPolarHBondContact O-CB 3.24Å; P64-A68 PolarHBondContact O-N 2.84Å; A65-A68 PolarHBondContact O-N 3.22Å; Q66-A68 VanDerWaalsContact C-N 3.32Å; Q66-A68 PolarHBondContact O-N 2.93Å; A68-M72 WeakPolarHBondContact O-CB 3.49Å; A68-M72 PolarHBondContact O-N 3.43Å
69	F	93.8	Very high	88	Confident	111 Å²	111	103.6 Å²	103.6	49%	0.487	51%	0.512	S	S	.	.	H	α-helix	trans	-63.3	-46.9	175.8	177.2	-96.3	0	0	0	111.9	A65 Q66 K71 M72 Q73	A65-F69 WeakPolarHBondContact O-CB 3.36Å; A65-F69 PolarHBondContact O-N 3.27Å; Q66-F69 PolarHBondContact O-N 3.25Å; F69-K71 PolarHBondContact O-N 3.41Å; F69-M72 HydrophobicContact CD2-CE 3.98Å; F69-M72 HydrophobicContact CE2-CE 4.42Å; F69-M72 CarbonylContact O-C 3.6Å; F69-M72 WeakPolarHBondContact O-CB 3.36Å; F69-M72 PolarHBondContact O-N 3.48Å; F69-M72 VanDerWaalsContact O-N 3.14Å; F69-Q73 WeakPolarHBondContact O-CB 3.27Å; F69-Q73 PolarHBondContact O-N 3.15Å
70	D	90.8	Very high	88.9	Confident	36 Å²	36	104 Å²	104	19%	0.193	51%	0.505	C	S	.	.	H	α-helix	trans	-62.5	-45.7	179.9	-67.7	-30.5	0	0	0	111.2	R62 Q66 M72 Q73 E74	R62-D70 WeakPolarHBondContact CD-OD2 3.36Å; R62-D70 IonicContact CZ-OD2 3.96Å; R62-D70 IonicContact NE-OD2 2.64Å; R62-D70 IonicContact NH1-OD2 3.34Å; R62-D70 PolarHBondContact NH1-OD2 3.47Å; Q66-D70 VanDerWaalsContact O-CG 3.27Å; Q66-D70 PolarHBondContact O-N 2.64Å; D70-M72 VanDerWaalsContact C-N 3.27Å; D70-M72 PolarHBondContact O-N 2.89Å; D70-Q73 WeakPolarHBondContact O-CB 3.46Å; D70-Q73 PolarHBondContact O-N 3.43Å; D70-E74 WeakPolarHBondContact O-CG 3.36Å; D70-E74 PolarHBondContact O-N 2.8Å
71	K	91.5	Very high	89.7	Confident	125 Å²	125	105.3 Å²	105.3	54%	0.543	51%	0.511	S	S	.	.	H	α-helix	trans	-57.4	-39.8	173.9	-74.7	175.8	179.6	178.4	0	112.3	I67 F69 K75	I67-K71 HydrophobicContact CG2-CD 4.16Å; I67-K71 WeakPolarHBondContact O-CB 3.49Å; I67-K71 VanDerWaalsContact O-CG 3.3Å; I67-K71 WeakPolarHBondContact O-CG 3.13Å; I67-K71 PolarHBondContact O-N 2.96Å; F69-K71 PolarHBondContact O-N 3.41Å; K71-K75 WeakPolarHBondContact O-CG 3.47Å; K71-K75 PolarHBondContact O-N 3.4Å; K71-K75 VanDerWaalsContact O-N 3.15Å
72	M	90	Very high	89.8	Confident	73 Å²	73	102 Å²	102	36%	0.36	50%	0.502	S	S	.	.	H	α-helix	trans	-70	-38.2	176.4	-178.7	179.5	59.7	0	0	111.7	A68 F69 D70 K75 R76	A68-M72 WeakPolarHBondContact O-CB 3.49Å; A68-M72 PolarHBondContact O-N 3.43Å; F69-M72 HydrophobicContact CD2-CE 3.98Å; F69-M72 HydrophobicContact CE2-CE 4.42Å; F69-M72 CarbonylContact O-C 3.6Å; F69-M72 WeakPolarHBondContact O-CB 3.36Å; F69-M72 PolarHBondContact O-N 3.48Å; F69-M72 VanDerWaalsContact O-N 3.14Å; D70-M72 VanDerWaalsContact C-N 3.27Å; D70-M72 PolarHBondContact O-N 2.89Å; M72-K75 PolarHBondContact O-N 3.23Å; M72-R76 WeakPolarHBondContact O-CG 3.48Å; M72-R76 PolarHBondContact O-N 3.49Å; M72-R76 VanDerWaalsContact O-N 3.08Å; M72-R76 PolarHBondContact SD-NH2 3.49Å
73	Q	92.1	Very high	89.9	Confident	83 Å²	83	104.3 Å²	104.3	39%	0.388	52%	0.515	S	S	.	.	H	α-helix	trans	-65.6	-44.4	177	-173.3	179	-47.8	0	0	111.2	F69 D70 R76 Q77	F69-Q73 WeakPolarHBondContact O-CB 3.27Å; F69-Q73 PolarHBondContact O-N 3.15Å; D70-Q73 WeakPolarHBondContact O-CB 3.46Å; D70-Q73 PolarHBondContact O-N 3.43Å; Q73-R76 CarbonylContact O-C 3.54Å; Q73-R76 PolarHBondContact O-N 3.15Å; Q73-Q77 WeakPolarHBondContact O-CB 3.2Å; Q73-Q77 PolarHBondContact O-N 3.05Å
74	E	89.3	Confident	89.7	Confident	117 Å²	117	109 Å²	109	55%	0.547	53%	0.53	S	S	.	.	H	α-helix	trans	-58.4	-46.5	175.1	-74.2	173.6	-177.6	0	0	111.4	D70 R76 Q77	D70-E74 WeakPolarHBondContact O-CG 3.36Å; D70-E74 PolarHBondContact O-N 2.8Å; E74-R76 VanDerWaalsContact C-N 3.35Å; E74-R76 PolarHBondContact O-N 2.82Å; E74-Q77 WeakPolarHBondContact O-CB 3.32Å; E74-Q77 PolarHBondContact O-N 3.06Å; E74-Q77 VanDerWaalsContact O-N 3.15Å
75	K	88.2	Confident	89.5	Confident	154 Å²	154	107.5 Å²	107.5	67%	0.67	53%	0.526	S	S	*	.	H	α-helix	trans	-56.7	-47.5	174.5	-75	178.6	-179	-172.6	0	112	K71 M72 Q77	K71-K75 WeakPolarHBondContact O-CG 3.47Å; K71-K75 PolarHBondContact O-N 3.4Å; K71-K75 VanDerWaalsContact O-N 3.15Å; M72-K75 PolarHBondContact O-N 3.23Å; K75-Q77 VanDerWaalsContact C-N 3.29Å; K75-Q77 PolarHBondContact O-N 3.08Å
76	R	92.4	Very high	89.5	Confident	118 Å²	118	108.1 Å²	108.1	45%	0.445	53%	0.527	S	S	.	.	H	α-helix	trans	-73.5	-19.2	179.6	-69.8	176.5	-178.1	165	1.1	113.4	M72 Q73 E74 M78 E79 R80	M72-R76 WeakPolarHBondContact O-CG 3.48Å; M72-R76 PolarHBondContact O-N 3.49Å; M72-R76 VanDerWaalsContact O-N 3.08Å; M72-R76 PolarHBondContact SD-NH2 3.49Å; Q73-R76 CarbonylContact O-C 3.54Å; Q73-R76 PolarHBondContact O-N 3.15Å; E74-R76 VanDerWaalsContact C-N 3.35Å; E74-R76 PolarHBondContact O-N 2.82Å; R76-M78 VanDerWaalsContact C-N 3.34Å; R76-E79 PolarHBondContact O-N 3.48Å; R76-R80 WeakPolarHBondContact O-CB 3.3Å; R76-R80 VanDerWaalsContact O-CG 3.29Å; R76-R80 WeakPolarHBondContact O-CG 3.39Å; R76-R80 PolarHBondContact O-N 3.1Å
77	Q	90.2	Very high	89.4	Confident	98 Å²	98	108.1 Å²	108.1	46%	0.458	53%	0.525	S	S	.	.	H	α-helix	trans	-64.9	-41.4	-178.7	179.7	173.6	-20.7	0	0	110.8	Q73 E74 K75 E79 R80 I81	Q73-Q77 WeakPolarHBondContact O-CB 3.2Å; Q73-Q77 PolarHBondContact O-N 3.05Å; E74-Q77 WeakPolarHBondContact O-CB 3.32Å; E74-Q77 PolarHBondContact O-N 3.06Å; E74-Q77 VanDerWaalsContact O-N 3.15Å; K75-Q77 VanDerWaalsContact C-N 3.29Å; K75-Q77 PolarHBondContact O-N 3.08Å; Q77-E79 PolarHBondContact O-N 3.29Å; Q77-R80 PolarHBondContact O-N 3Å; Q77-I81 HydrophobicContact CG-CD1 3.76Å; Q77-I81 HydrophobicContact CG-CG1 4.29Å; Q77-I81 WeakPolarHBondContact O-CB 3.45Å; Q77-I81 VanDerWaalsContact O-CG1 3.24Å; Q77-I81 WeakPolarHBondContact O-CG1 3.44Å; Q77-I81 PolarHBondContact O-N 2.97Å
78	M	83.8	Confident	89.6	Confident	140 Å²	140	109.3 Å²	109.3	69%	0.69	54%	0.535	S	S	*	.	H	α-helix	trans	-59.6	-47.2	176.3	-70.1	-170	-75.5	0	0	111.7	R76 R80 I81 L82	R76-M78 VanDerWaalsContact C-N 3.34Å; M78-R80 VanDerWaalsContact C-N 3.34Å; M78-R80 PolarHBondContact O-N 3.11Å; M78-I81 PolarHBondContact O-N 2.89Å; M78-L82 WeakPolarHBondContact O-CB 3.33Å; M78-L82 PolarHBondContact O-N 3.12Å
79	E	87.1	Confident	89.7	Confident	137 Å²	137	112.5 Å²	112.5	64%	0.64	54%	0.54	S	S	*	.	H	α-helix	trans	-61.1	-42.3	176.5	-63.5	176.2	172.4	0	0	112	R76 Q77 L82 K83	R76-E79 PolarHBondContact O-N 3.48Å; Q77-E79 PolarHBondContact O-N 3.29Å; E79-L82 PolarHBondContact O-N 3.48Å; E79-K83 VanDerWaalsContact O-CB 3.27Å; E79-K83 WeakPolarHBondContact O-CB 3.46Å; E79-K83 PolarHBondContact O-N 2.81Å
80	R	90.2	Very high	89.7	Confident	145 Å²	145	114 Å²	114	55%	0.547	55%	0.546	S	S	.	.	H	α-helix	trans	-64.6	-40.8	176.9	-75.1	173.6	176.7	-177	-1	112.2	R76 Q77 M78 K84	R76-R80 WeakPolarHBondContact O-CB 3.3Å; R76-R80 VanDerWaalsContact O-CG 3.29Å; R76-R80 WeakPolarHBondContact O-CG 3.39Å; R76-R80 PolarHBondContact O-N 3.1Å; Q77-R80 PolarHBondContact O-N 3Å; M78-R80 VanDerWaalsContact C-N 3.34Å; M78-R80 PolarHBondContact O-N 3.11Å; R80-K84 WeakPolarHBondContact O-CB 3.29Å; R80-K84 WeakPolarHBondContact O-CG 3.46Å; R80-K84 PolarHBondContact O-N 3.14Å
81	I	89.5	Confident	89.9	Confident	99 Å²	99	117.1 Å²	117.1	51%	0.508	56%	0.559	S	S	.	*	H	α-helix	trans	-63	-50.5	176.5	-71.8	168.2	0	0	0	109.1	Q77 M78 K83 K84 A85	Q77-I81 HydrophobicContact CG-CD1 3.76Å; Q77-I81 HydrophobicContact CG-CG1 4.29Å; Q77-I81 WeakPolarHBondContact O-CB 3.45Å; Q77-I81 VanDerWaalsContact O-CG1 3.24Å; Q77-I81 WeakPolarHBondContact O-CG1 3.44Å; Q77-I81 PolarHBondContact O-N 2.97Å; M78-I81 PolarHBondContact O-N 2.89Å; I81-K83 PolarHBondContact O-N 3.33Å; I81-K84 PolarHBondContact O-N 2.89Å; I81-A85 VanDerWaalsContact O-CB 3.31Å; I81-A85 WeakPolarHBondContact O-CB 3.4Å; I81-A85 PolarHBondContact O-N 3.19Å
82	L	89.4	Confident	90	Very high	129 Å²	129	117.5 Å²	117.5	68%	0.675	56%	0.557	S	S	*	*	H	α-helix	trans	-59.6	-45.2	179.5	-173.4	64.6	0	0	0	111.7	M78 E79 K84 A85 S86	M78-L82 WeakPolarHBondContact O-CB 3.33Å; M78-L82 PolarHBondContact O-N 3.12Å; E79-L82 PolarHBondContact O-N 3.48Å; L82-K84 PolarHBondContact O-N 2.89Å; L82-A85 PolarHBondContact O-N 2.69Å; L82-S86 WeakPolarHBondContact O-CB 3.47Å; L82-S86 PolarHBondContact O-N 3Å
83	K	86.3	Confident	90.3	Very high	166 Å²	166	116.8 Å²	116.8	72%	0.722	56%	0.557	S	S	*	*	H	α-helix	trans	-66.4	-34.2	178.2	-172.9	175.7	-177.7	176.1	0	113.3	E79 I81 S86	E79-K83 VanDerWaalsContact O-CB 3.27Å; E79-K83 WeakPolarHBondContact O-CB 3.46Å; E79-K83 PolarHBondContact O-N 2.81Å; I81-K83 PolarHBondContact O-N 3.33Å; K83-S86 PolarHBondContact O-OG 3.38Å
84	K	86.2	Confident	90.5	Very high	166 Å²	166	116.6 Å²	116.6	72%	0.722	56%	0.556	S	S	*	*	H	α-helix	trans	-74.2	-36.4	174.6	-78.5	-177.6	176.4	-175.2	0	111.7	R80 I81 L82	R80-K84 WeakPolarHBondContact O-CB 3.29Å; R80-K84 WeakPolarHBondContact O-CG 3.46Å; R80-K84 PolarHBondContact O-N 3.14Å; I81-K84 PolarHBondContact O-N 2.89Å; L82-K84 PolarHBondContact O-N 2.89Å
85	A	86.6	Confident	90.8	Very high	79 Å²	79	113.5 Å²	113.5	65%	0.653	54%	0.543	S	S	*	.	H	α-helix	trans	-70.8	-31.3	177.4	0	0	0	0	0	112.3	I81 L82 K87	I81-A85 VanDerWaalsContact O-CB 3.31Å; I81-A85 WeakPolarHBondContact O-CB 3.4Å; I81-A85 PolarHBondContact O-N 3.19Å; L82-A85 PolarHBondContact O-N 2.69Å; A85-K87 VanDerWaalsContact C-N 3.31Å; A85-K87 PolarHBondContact O-N 2.97Å
86	S	88.9	Confident	91.1	Very high	86 Å²	86	111.8 Å²	111.8	60%	0.601	54%	0.536	S	S	*	.	H	α-helix	trans	-66.9	-27.9	-176.8	68.3	0	0	0	0	114.1	L82 K83	L82-S86 WeakPolarHBondContact O-CB 3.47Å; L82-S86 PolarHBondContact O-N 3Å; K83-S86 PolarHBondContact O-OG 3.38Å
87	K	90.8	Very high	91.3	Very high	95 Å²	95	109.9 Å²	109.9	41%	0.413	53%	0.534	S	S	.	.	S	Bend	trans	-112.7	121.8	-179.6	-64.1	-168.8	177.2	-166	0	112	A85 R92 D95	A85-K87 VanDerWaalsContact C-N 3.31Å; A85-K87 PolarHBondContact O-N 2.97Å; K87-R92 HydrophobicContact CB-CG 3.94Å; K87-R92 HydrophobicContact CD-CG 4.39Å; K87-D95 IonicContact NZ-OD2 3.62Å; K87-D95 PolarHBondContact NZ-OD2 3.41Å
88	T	93.8	Very high	91.6	Very high	80 Å²	80	112.9 Å²	112.9	49%	0.491	54%	0.542	S	S	.	.			trans	-63.2	159.6	168.3	68.6	0	0	0	0	110.9	K90 H91 R92	T88-K90 VanDerWaalsContact C-N 3.28Å; T88-K90 PolarHBondContact O-N 3.45Å; T88-H91 PolarHBondContact O-N 2.97Å; T88-H91 PolarHBondContact OG1-N 3.12Å; T88-H91 PolarHBondContact OG1-ND1 3.23Å; T88-R92 PolarHBondContact O-N 3.25Å; T88-R92 VanDerWaalsContact O-N 3.07Å
89	H	92.2	Very high	92.2	Very high	126 Å²	126	111.6 Å²	111.6	58%	0.583	53%	0.534	S	S	*	.	H	α-helix	trans	-58.9	-41.7	176.5	179.3	45.6	0	0	0	111.9	H91 R92 V93	H89-H91 PolarHBondContact O-N 3.07Å; H89-R92 WeakPolarHBondContact O-CB 3.45Å; H89-R92 PolarHBondContact O-N 3.01Å; H89-R92 VanDerWaalsContact O-N 3.12Å; H89-V93 WeakPolarHBondContact O-CG2 3.41Å; H89-V93 PolarHBondContact O-N 2.89Å
90	K	95.4	Very high	92.6	Very high	143 Å²	143	109 Å²	109	62%	0.622	52%	0.524	S	S	*	.	H	α-helix	trans	-56.9	-49.3	176.4	179.7	173.3	172.4	177.6	0	111.8	T88 R92 V93 E94	T88-K90 VanDerWaalsContact C-N 3.28Å; T88-K90 PolarHBondContact O-N 3.45Å; K90-R92 VanDerWaalsContact C-N 3.28Å; K90-R92 PolarHBondContact O-N 3.36Å; K90-V93 PolarHBondContact O-N 3.4Å; K90-V93 VanDerWaalsContact O-N 3.11Å; K90-E94 WeakPolarHBondContact CE-OE1 3.34Å; K90-E94 HydrophobicContact CG-CG 4.5Å; K90-E94 WeakPolarHBondContact CG-OE1 3.44Å; K90-E94 IonicContact NZ-OE1 2.74Å; K90-E94 WeakPolarHBondContact O-CG 3.49Å; K90-E94 PolarHBondContact O-N 3.47Å
91	H	93.6	Very high	92.8	Very high	101 Å²	101	108.7 Å²	108.7	47%	0.468	53%	0.533	S	S	.	.	H	α-helix	trans	-62	-35.9	176.8	-77.8	54.6	0	0	0	112.4	T88 H89 V93 E94 D95	T88-H91 PolarHBondContact O-N 2.97Å; T88-H91 PolarHBondContact OG1-N 3.12Å; T88-H91 PolarHBondContact OG1-ND1 3.23Å; H89-H91 PolarHBondContact O-N 3.07Å; H91-V93 VanDerWaalsContact C-N 3.35Å; H91-E94 PolarHBondContact O-N 2.85Å; H91-D95 WeakPolarHBondContact O-CB 3.47Å; H91-D95 PolarHBondContact O-N 2.85Å
92	R	94.1	Very high	93	Very high	132 Å²	132	107.9 Å²	107.9	50%	0.498	54%	0.541	S	S	.	.	H	α-helix	trans	-65.3	-38.2	174.7	-75.6	-173.8	-80.8	123.9	-6.2	112.5	K87 T88 H89 K90 F96	K87-R92 HydrophobicContact CB-CG 3.94Å; K87-R92 HydrophobicContact CD-CG 4.39Å; T88-R92 PolarHBondContact O-N 3.25Å; T88-R92 VanDerWaalsContact O-N 3.07Å; H89-R92 WeakPolarHBondContact O-CB 3.45Å; H89-R92 PolarHBondContact O-N 3.01Å; H89-R92 VanDerWaalsContact O-N 3.12Å; K90-R92 VanDerWaalsContact C-N 3.28Å; K90-R92 PolarHBondContact O-N 3.36Å; R92-F96 VanDerWaalsContact O-CB 3.27Å; R92-F96 WeakPolarHBondContact O-CB 3.41Å; R92-F96 PolarHBondContact O-N 2.9Å
93	V	95.6	Very high	93.2	Very high	58 Å²	58	104.8 Å²	104.8	35%	0.352	53%	0.525	S	S	.	.	H	α-helix	trans	-69.8	-43.2	176.4	173.1	0	0	0	0	110.6	H89 K90 H91 F96 N97	H89-V93 WeakPolarHBondContact O-CG2 3.41Å; H89-V93 PolarHBondContact O-N 2.89Å; K90-V93 PolarHBondContact O-N 3.4Å; K90-V93 VanDerWaalsContact O-N 3.11Å; H91-V93 VanDerWaalsContact C-N 3.35Å; V93-F96 WeakPolarHBondContact O-CB 3.45Å; V93-F96 PolarHBondContact O-N 3.06Å; V93-N97 WeakPolarHBondContact O-CB 3.27Å; V93-N97 VanDerWaalsContact O-CG 3.24Å; V93-N97 PolarHBondContact O-N 3.03Å; V93-N97 PolarHBondContact O-OD1 3.12Å
94	E	96.3	Very high	93.5	Very high	80 Å²	80	101.1 Å²	101.1	37%	0.374	52%	0.516	S	S	.	.	H	α-helix	trans	-62.2	-46.1	176.2	-71.4	166.4	176.4	0	0	112	K90 H91 F96 N97 R98	K90-E94 WeakPolarHBondContact CE-OE1 3.34Å; K90-E94 HydrophobicContact CG-CG 4.5Å; K90-E94 WeakPolarHBondContact CG-OE1 3.44Å; K90-E94 IonicContact NZ-OE1 2.74Å; K90-E94 WeakPolarHBondContact O-CG 3.49Å; K90-E94 PolarHBondContact O-N 3.47Å; H91-E94 PolarHBondContact O-N 2.85Å; E94-F96 VanDerWaalsContact C-N 3.28Å; E94-F96 PolarHBondContact O-N 3.28Å; E94-N97 PolarHBondContact O-N 3.49Å; E94-R98 WeakPolarHBondContact O-CB 3.49Å; E94-R98 VanDerWaalsContact O-CG 3.29Å; E94-R98 WeakPolarHBondContact O-CG 3.46Å; E94-R98 PolarHBondContact O-N 3.31Å
95	D	95.3	Very high	93.6	Very high	51 Å²	51	101.4 Å²	101.4	27%	0.273	52%	0.52	S	S	.	.	H	α-helix	trans	-60	-39.2	174.4	-80	-19.3	0	0	0	111.9	K87 H91 R98 H99	K87-D95 IonicContact NZ-OD2 3.62Å; K87-D95 PolarHBondContact NZ-OD2 3.41Å; H91-D95 WeakPolarHBondContact O-CB 3.47Å; H91-D95 PolarHBondContact O-N 2.85Å; D95-R98 IonicContact OD1-NH1 2.69Å; D95-R98 PolarHBondContact OD1-NH1 2.86Å; D95-H99 WeakPolarHBondContact O-CB 3.29Å; D95-H99 PolarHBondContact O-N 3.08Å
96	F	96.6	Very high	93.9	Very high	119 Å²	119	104.5 Å²	104.5	52%	0.522	52%	0.521	S	S	.	.	H	α-helix	trans	-67.4	-45.6	177.7	-179.6	-106.7	0	0	0	111.5	R92 V93 E94 R98 H99 L100	R92-F96 VanDerWaalsContact O-CB 3.27Å; R92-F96 WeakPolarHBondContact O-CB 3.41Å; R92-F96 PolarHBondContact O-N 2.9Å; V93-F96 WeakPolarHBondContact O-CB 3.45Å; V93-F96 PolarHBondContact O-N 3.06Å; E94-F96 VanDerWaalsContact C-N 3.28Å; E94-F96 PolarHBondContact O-N 3.28Å; F96-R98 PolarHBondContact O-N 3.25Å; F96-H99 WeakPolarHBondContact O-CB 3.46Å; F96-H99 PolarHBondContact O-N 3.09Å; F96-H99 VanDerWaalsContact O-N 3.12Å; F96-L100 HydrophobicContact CD1-CD1 3.96Å; F96-L100 HydrophobicContact CD1-CG 4.42Å; F96-L100 HydrophobicContact CE1-CD1 3.39Å; F96-L100 HydrophobicContact CE1-CG 4.07Å; F96-L100 HydrophobicContact CE2-CD2 4.42Å; F96-L100 HydrophobicContact CE2-CG 4.42Å; F96-L100 HydrophobicContact CZ-CD1 3.71Å; F96-L100 HydrophobicContact CZ-CD2 4.16Å; F96-L100 HydrophobicContact CZ-CG 4.07Å; F96-L100 WeakPolarHBondContact O-CG 3.32Å; F96-L100 PolarHBondContact O-N 3.5Å
97	N	95.9	Very high	94	Very high	77 Å²	77	109.2 Å²	109.2	41%	0.412	53%	0.527	S	S	.	.	H	α-helix	trans	-62.7	-45	177.2	-68.6	-3.7	0	0	0	111	V93 E94 H99 L100 D101	V93-N97 WeakPolarHBondContact O-CB 3.27Å; V93-N97 VanDerWaalsContact O-CG 3.24Å; V93-N97 PolarHBondContact O-N 3.03Å; V93-N97 PolarHBondContact O-OD1 3.12Å; E94-N97 PolarHBondContact O-N 3.49Å; N97-H99 PolarHBondContact O-N 2.96Å; N97-L100 PolarHBondContact O-N 3.33Å; N97-L100 VanDerWaalsContact O-N 3.09Å; N97-D101 VanDerWaalsContact O-CG 3.29Å; N97-D101 PolarHBondContact O-N 3.25Å
98	R	96.8	Very high	94.1	Very high	162 Å²	162	111.2 Å²	111.2	61%	0.611	54%	0.542	S	S	*	.	H	α-helix	trans	-57.1	-36.6	173.4	-75.5	173.3	54	-120.4	-10.9	112.8	E94 D95 F96 A102	E94-R98 WeakPolarHBondContact O-CB 3.49Å; E94-R98 VanDerWaalsContact O-CG 3.29Å; E94-R98 WeakPolarHBondContact O-CG 3.46Å; E94-R98 PolarHBondContact O-N 3.31Å; D95-R98 IonicContact OD1-NH1 2.69Å; D95-R98 PolarHBondContact OD1-NH1 2.86Å; F96-R98 PolarHBondContact O-N 3.25Å; R98-A102 WeakPolarHBondContact O-CB 3.45Å; R98-A102 PolarHBondContact O-N 3.49Å
99	H	96.5	Very high	93.9	Very high	112 Å²	112	114.3 Å²	114.3	52%	0.519	55%	0.554	S	S	.	*	H	α-helix	trans	-69.8	-40.5	176.8	179.2	52	0	0	0	112	D95 F96 N97 A102 L103	D95-H99 WeakPolarHBondContact O-CB 3.29Å; D95-H99 PolarHBondContact O-N 3.08Å; F96-H99 WeakPolarHBondContact O-CB 3.46Å; F96-H99 PolarHBondContact O-N 3.09Å; F96-H99 VanDerWaalsContact O-N 3.12Å; N97-H99 PolarHBondContact O-N 2.96Å; H99-A102 PolarHBondContact O-N 3.04Å; H99-L103 VanDerWaalsContact CE1-CD1 3.44Å; H99-L103 WeakPolarHBondContact CE1-CD1 3.49Å; H99-L103 WeakPolarHBondContact NE2-CD1 3.44Å; H99-L103 PolarHBondContact O-N 3.34Å
100	L	95.2	Very high	93.7	Very high	84 Å²	84	112.7 Å²	112.7	44%	0.44	56%	0.555	S	S	.	*	H	α-helix	trans	-66.6	-41.1	175.9	-68.2	-176.4	0	0	0	112.2	F96 N97 A102 L103	F96-L100 HydrophobicContact CD1-CD1 3.96Å; F96-L100 HydrophobicContact CD1-CG 4.42Å; F96-L100 HydrophobicContact CE1-CD1 3.39Å; F96-L100 HydrophobicContact CE1-CG 4.07Å; F96-L100 HydrophobicContact CE2-CD2 4.42Å; F96-L100 HydrophobicContact CE2-CG 4.42Å; F96-L100 HydrophobicContact CZ-CD1 3.71Å; F96-L100 HydrophobicContact CZ-CD2 4.16Å; F96-L100 HydrophobicContact CZ-CG 4.07Å; F96-L100 WeakPolarHBondContact O-CG 3.32Å; F96-L100 PolarHBondContact O-N 3.5Å; N97-L100 PolarHBondContact O-N 3.33Å; N97-L100 VanDerWaalsContact O-N 3.09Å; L100-A102 PolarHBondContact O-N 3.21Å; L100-L103 WeakPolarHBondContact O-CB 3.41Å; L100-L103 PolarHBondContact O-N 3.41Å
101	D	93.8	Very high	93.4	Very high	138 Å²	138	113.4 Å²	113.4	74%	0.738	56%	0.558	S	S	*	*	H	α-helix	trans	-63.1	-32.3	177	-68.4	-17.8	0	0	0	112	N97 L103	N97-D101 VanDerWaalsContact O-CG 3.29Å; N97-D101 PolarHBondContact O-N 3.25Å; D101-L103 VanDerWaalsContact C-N 3.31Å
102	A	93.6	Very high	93	Very high	82 Å²	82	116.4 Å²	116.4	68%	0.678	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.1	-10	176.5	0	0	0	0	0	113.2	R98 H99 L100	R98-A102 WeakPolarHBondContact O-CB 3.45Å; R98-A102 PolarHBondContact O-N 3.49Å; H99-A102 PolarHBondContact O-N 3.04Å; L100-A102 PolarHBondContact O-N 3.21Å
103	L	94.9	Very high	92.5	Very high	64 Å²	64	115.1 Å²	115.1	34%	0.335	59%	0.594	S	S	.	*	S	Bend	trans	-80.2	141	-177.8	-131	104.8	0	0	0	110.1	H99 L100 D101 E105 Y107	H99-L103 VanDerWaalsContact CE1-CD1 3.44Å; H99-L103 WeakPolarHBondContact CE1-CD1 3.49Å; H99-L103 WeakPolarHBondContact NE2-CD1 3.44Å; H99-L103 PolarHBondContact O-N 3.34Å; L100-L103 WeakPolarHBondContact O-CB 3.41Å; L100-L103 PolarHBondContact O-N 3.41Å; D101-L103 VanDerWaalsContact C-N 3.31Å; L103-E105 PolarHBondContact O-N 3.33Å; L103-Y107 HydrophobicContact CD2-CE1 4.01Å; L103-Y107 WeakPolarHBondContact CD2-OH 3.05Å
104	T	91.8	Very high	91.4	Very high	88 Å²	88	121.2 Å²	121.2	54%	0.54	61%	0.611	S	S	.	*			trans	-71.2	130.8	-179.9	53.8	0	0	0	0	110.4	H106	T104-H106 WeakPolarHBondContact CB-O 3.45Å; T104-H106 PolarHBondContact O-N 3.46Å; T104-H106 PolarHBondContact OG1-O 3.27Å
105	E	89.1	Confident	90.1	Very high	172 Å²	172	123.5 Å²	123.5	80%	0.804	63%	0.631	S	S	*	*	S	Bend	trans	-63.8	-29.3	175.2	-61.7	-175.4	169.5	0	0	112.2	L103	L103-E105 PolarHBondContact O-N 3.33Å
106	H	91.9	Very high	88.9	Confident	144 Å²	144	133.8 Å²	133.8	67%	0.667	67%	0.673	S	S	*	*			trans	-116.7	129.9	179.3	-57.5	-53.2	0	0	0	110.4	T104	T104-H106 WeakPolarHBondContact CB-O 3.45Å; T104-H106 PolarHBondContact O-N 3.46Å; T104-H106 PolarHBondContact OG1-O 3.27Å
107	Y	91.1	Very high	88.5	Confident	186 Å²	186	134.6 Å²	134.6	73%	0.729	68%	0.68	S	S	*	*	S	Bend	trans	-100.1	3.5	-178.8	-60.3	-85.1	0	0	0	113.1	L103	L103-Y107 HydrophobicContact CD2-CE1 4.01Å; L103-Y107 WeakPolarHBondContact CD2-OH 3.05Å
108	D	92.3	Very high	88.1	Confident	137 Å²	137	137.6 Å²	137.6	73%	0.733	70%	0.695	S	S	*	*	S	Bend	trans	-144.7	156.8	-180	-157.2	-3.5	0	0	0	110.3
109	I	89.4	Confident	87.7	Confident	145 Å²	145	136.2 Å²	136.2	74%	0.744	70%	0.699	S	S	*	*	P	Polyproline II helix	trans	-80.1	128.9	-176.3	-61	170.5	0	0	0	108.4	K111	I109-K111 PolarHBondContact O-N 3.46Å
110	P	88.9	Confident	87.2	Confident	91 Å²	91	137.6 Å²	137.6	59%	0.591	71%	0.71	S	S	*	*	P	Polyproline II helix	trans	-60.8	139.7	177.4	24.9	-32.7	0	0	0	110.8	W114	P110-W114 HydrophobicContact CB-CB 4.41Å
111	K	89.4	Confident	86.6	Confident	159 Å²	159	141 Å²	141	69%	0.691	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-68.3	150.7	178.7	-65.9	-176.8	-178.6	178.5	0	110.7	I109 S113 W114	I109-K111 PolarHBondContact O-N 3.46Å; K111-S113 PolarHBondContact O-N 3.45Å; K111-S113 VanDerWaalsContact O-N 3.1Å; K111-W114 WeakPolarHBondContact O-CB 3.1Å; K111-W114 PolarHBondContact O-N 2.96Å
112	V	84.3	Confident	86.2	Confident	163 Å²	163	141.2 Å²	141.2	99%	0.988	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.5	-23.9	-174.6	-176.1	0	0	0	0	113.4
113	S	83.3	Confident	85.6	Confident	105 Å²	105	145.4 Å²	145.4	73%	0.734	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.9	10.2	173.4	59.3	0	0	0	0	114.4	K111 T115	K111-S113 PolarHBondContact O-N 3.45Å; K111-S113 VanDerWaalsContact O-N 3.1Å; S113-T115 PolarHBondContact O-N 2.85Å; S113-T115 PolarHBondContact O-OG1 3.1Å
114	W	72.9	Confident	84.9	Confident	186 Å²	186	151.7 Å²	151.7	71%	0.705	76%	0.76	S	S	*	*			trans	-68.3	100.5	179.4	-165.1	-81.1	0	0	0	110.1	P110 K111	P110-W114 HydrophobicContact CB-CB 4.41Å; K111-W114 WeakPolarHBondContact O-CB 3.1Å; K111-W114 PolarHBondContact O-N 2.96Å
115	T	69.3	Low	84.4	Confident	129 Å²	129	157 Å²	157	79%	0.791	78%	0.778	S	S	*	*			trans	-94.3	140.8	165.5	8.3	0	0	0	0	108	S113	S113-T115 PolarHBondContact O-N 2.85Å; S113-T115 PolarHBondContact O-OG1 3.1Å
116	K	70.3	Confident	83.9	Confident	267 Å²	267	155.6 Å²	155.6	100%	1.161	78%	0.776	S	S	*	*			trans	-72.1	0	-174.1	-175.7	161.6	-174.7	158.7	0	112.7

Retrieved 116 of 116 residues in 43.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).