A0A087XP02_POEFO Loading...

Nuclear transport factor 2

Has a role in nuclear-cytoplasmic transport of proteins and mRNAs.

AlphaFold DB , UniProt , Accession A0A087XP02, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 127 aa.

						>A0A087XP02_POEFO|A0A087XP02
MAEQPLWEQIGSSFVQHYYQMFDSDRSQLGSIYIDTSCLTWEGQPYQGKIAIVEKLTSLPFTKIAHSITAQDHQPTPDNCILSMVVGQLKADEDPIMGFHQSFILKNINDAWVCTNDMFRLAIHNFG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.2	Low	88.4	Confident	243 Å²	243	96.1 Å²	96.1	100%	1.197	49%	0.494	S	S	*	.				0	129.2	0	-69.8	173.2	-134.2	0	0	106
2	A	65.6	Low	89.2	Confident	101 Å²	101	90.4 Å²	90.4	84%	0.835	47%	0.469	S	S	*	.	P	Polyproline II helix	trans	-64.1	139.5	173.4	0	0	0	0	0	108.5	Q4	A2-Q4 PolarHBondContact O-N 3.27Å
3	E	82.9	Confident	89.9	Confident	174 Å²	174	88.9 Å²	88.9	81%	0.813	47%	0.471	S	S	*	.	P	Polyproline II helix	trans	-64.4	132.2	174.8	-165.6	174.1	-178	0	0	108.7
4	Q	89.3	Confident	90.6	Very high	104 Å²	104	83.7 Å²	83.7	49%	0.486	44%	0.443	S	S	.	.	P	Polyproline II helix	trans	-61.8	136.8	177.3	-85	-179.7	-35.2	0	0	109.6	A2 E8 Q9	A2-Q4 PolarHBondContact O-N 3.27Å; Q4-E8 PolarHBondContact NE2-OE1 3.17Å; Q4-Q9 HydrophobicContact CB-CG 4.06Å; Q4-Q9 PolarHBondContact O-NE2 2.71Å
5	P	96.2	Very high	91.1	Very high	45 Å²	45	78.3 Å²	78.3	29%	0.292	41%	0.414	S	S	.	.	P	Polyproline II helix	trans	-57.2	147.8	175.6	-23	32.7	0	0	0	112.7	W7 E8 Q9	P5-W7 VanDerWaalsContact C-N 3.27Å; P5-W7 HydrophobicContact CB-CD2 3.59Å; P5-W7 HydrophobicContact CB-CE3 3.89Å; P5-W7 HydrophobicContact CB-CG 4.32Å; P5-W7 HydrophobicContact CB-CH2 3.57Å; P5-W7 HydrophobicContact CB-CZ2 3.23Å; P5-W7 HydrophobicContact CB-CZ3 3.87Å; P5-W7 HydrophobicContact CG-CH2 4.18Å; P5-W7 HydrophobicContact CG-CZ2 3.61Å; P5-W7 PolarHBondContact O-N 3.17Å; P5-E8 WeakPolarHBondContact CD-OE2 3.49Å; P5-E8 WeakPolarHBondContact O-CB 3.4Å; P5-E8 PolarHBondContact O-N 2.6Å; P5-Q9 PolarHBondContact O-N 2.87Å; P5-Q9 VanDerWaalsContact O-N 3.15Å
6	L	95.5	Very high	91.5	Very high	117 Å²	117	81.9 Å²	81.9	61%	0.613	43%	0.428	S	S	*	.	H	α-helix	trans	-55.1	-40.2	-176.9	178.8	61.8	0	0	0	113.2	E8 Q9 I10	L6-E8 VanDerWaalsContact C-N 3.3Å; L6-E8 PolarHBondContact O-N 3.13Å; L6-Q9 PolarHBondContact O-N 3.07Å; L6-I10 HydrophobicContact CD1-CD1 3.83Å; L6-I10 HydrophobicContact CD1-CG1 4.22Å; L6-I10 HydrophobicContact CD2-CD1 4.4Å; L6-I10 HydrophobicContact CG-CD1 3.71Å; L6-I10 WeakPolarHBondContact O-CD1 3.37Å; L6-I10 WeakPolarHBondContact O-CG1 3.38Å; L6-I10 PolarHBondContact O-N 2.77Å
7	W	97.3	Very high	91.9	Very high	100 Å²	100	82.1 Å²	82.1	38%	0.379	43%	0.426	S	S	.	.	H	α-helix	trans	-65.6	-32.7	178.3	57.8	83.5	0	0	0	112.8	P5 G11 P75 I81	P5-W7 VanDerWaalsContact C-N 3.27Å; P5-W7 HydrophobicContact CB-CD2 3.59Å; P5-W7 HydrophobicContact CB-CE3 3.89Å; P5-W7 HydrophobicContact CB-CG 4.32Å; P5-W7 HydrophobicContact CB-CH2 3.57Å; P5-W7 HydrophobicContact CB-CZ2 3.23Å; P5-W7 HydrophobicContact CB-CZ3 3.87Å; P5-W7 HydrophobicContact CG-CH2 4.18Å; P5-W7 HydrophobicContact CG-CZ2 3.61Å; P5-W7 PolarHBondContact O-N 3.17Å; W7-G11 PolarHBondContact O-N 3.43Å; W7-P75 HydrophobicContact CB-CB 4.5Å; W7-P75 HydrophobicContact CD2-CB 4.36Å; W7-P75 HydrophobicContact CD2-CG 3.9Å; W7-P75 HydrophobicContact CE3-CB 4.34Å; W7-P75 HydrophobicContact CE3-CG 4Å; W7-P75 HydrophobicContact CG-CB 4.44Å; W7-P75 HydrophobicContact CG-CG 4.28Å; W7-P75 HydrophobicContact CZ3-CG 4.37Å; W7-I81 HydrophobicContact CB-CD1 4.06Å; W7-I81 HydrophobicContact CB-CG1 4.03Å; W7-I81 HydrophobicContact CB-CG2 4.49Å
8	E	97.9	Very high	92.3	Very high	64 Å²	64	77.6 Å²	77.6	30%	0.299	40%	0.402	S	S	.	.	H	α-helix	trans	-70.3	-41.1	176.9	-168.3	180	143.2	0	0	110.3	Q4 P5 L6 S12	Q4-E8 PolarHBondContact NE2-OE1 3.17Å; P5-E8 WeakPolarHBondContact CD-OE2 3.49Å; P5-E8 WeakPolarHBondContact O-CB 3.4Å; P5-E8 PolarHBondContact O-N 2.6Å; L6-E8 VanDerWaalsContact C-N 3.3Å; L6-E8 PolarHBondContact O-N 3.13Å; E8-S12 WeakPolarHBondContact O-CB 3.49Å; E8-S12 PolarHBondContact O-N 2.94Å; E8-S12 PolarHBondContact O-OG 3.43Å
9	Q	97.7	Very high	92.6	Very high	79 Å²	79	74.1 Å²	74.1	37%	0.369	38%	0.384	S	S	.	.	H	α-helix	trans	-62.4	-47.4	175.4	-61.1	-179.9	33.4	0	0	111.8	Q4 P5 L6 S13	Q4-Q9 HydrophobicContact CB-CG 4.06Å; Q4-Q9 PolarHBondContact O-NE2 2.71Å; P5-Q9 PolarHBondContact O-N 2.87Å; P5-Q9 VanDerWaalsContact O-N 3.15Å; L6-Q9 PolarHBondContact O-N 3.07Å; Q9-S13 WeakPolarHBondContact O-CB 3.28Å; Q9-S13 PolarHBondContact O-N 3.1Å; Q9-S13 PolarHBondContact O-OG 3.45Å
10	I	97.8	Very high	92.9	Very high	30 Å²	30	76.5 Å²	76.5	15%	0.154	39%	0.393	C	S	.	.	H	α-helix	trans	-66.8	-48.3	179.4	-65.9	161.5	0	0	0	110.6	L6 S12 S13 F14 I81 W112	L6-I10 HydrophobicContact CD1-CD1 3.83Å; L6-I10 HydrophobicContact CD1-CG1 4.22Å; L6-I10 HydrophobicContact CD2-CD1 4.4Å; L6-I10 HydrophobicContact CG-CD1 3.71Å; L6-I10 WeakPolarHBondContact O-CD1 3.37Å; L6-I10 WeakPolarHBondContact O-CG1 3.38Å; L6-I10 PolarHBondContact O-N 2.77Å; I10-S12 PolarHBondContact O-N 3.22Å; I10-S13 PolarHBondContact O-N 3.17Å; I10-F14 WeakPolarHBondContact O-CB 3.19Å; I10-F14 PolarHBondContact O-N 3Å; I10-I81 HydrophobicContact CB-CD1 3.69Å; I10-I81 HydrophobicContact CD1-CD1 4.02Å; I10-I81 HydrophobicContact CG1-CD1 4.49Å; I10-I81 HydrophobicContact CG2-CD1 3.53Å; I10-W112 HydrophobicContact CD1-CZ2 3.73Å; I10-W112 HydrophobicContact CG2-CB 4.49Å; I10-W112 HydrophobicContact CG2-CD2 3.8Å; I10-W112 HydrophobicContact CG2-CE3 4.41Å; I10-W112 HydrophobicContact CG2-CG 3.81Å
11	G	98.3	Very high	93.1	Very high	0 Å²	0	73.7 Å²	73.7	0%	0	38%	0.379	C	S	.	.	H	α-helix	trans	-59.5	-46.6	179.6	0	0	0	0	0	112.3	W7 F14 V15	W7-G11 PolarHBondContact O-N 3.43Å; G11-F14 PolarHBondContact O-N 3.29Å; G11-V15 WeakPolarHBondContact O-CG2 3.26Å; G11-V15 PolarHBondContact O-N 2.89Å
12	S	98.3	Very high	95.2	Very high	28 Å²	28	62.3 Å²	62.3	20%	0.196	32%	0.322	C	S	.	.	H	α-helix	trans	-63.8	-42.6	177.9	-60.3	0	0	0	0	111.8	E8 I10 V15 Q16 H73	E8-S12 WeakPolarHBondContact O-CB 3.49Å; E8-S12 PolarHBondContact O-N 2.94Å; E8-S12 PolarHBondContact O-OG 3.43Å; I10-S12 PolarHBondContact O-N 3.22Å; S12-V15 PolarHBondContact O-N 3.48Å; S12-Q16 WeakPolarHBondContact O-CB 3.32Å; S12-Q16 PolarHBondContact O-N 3.11Å; S12-H73 PolarHBondContact N-NE2 3.06Å; S12-H73 PolarHBondContact OG-NE2 2.93Å
13	S	98.2	Very high	96.7	Very high	71 Å²	71	60.1 Å²	60.1	50%	0.497	30%	0.297	S	S	.	.	H	α-helix	trans	-64	-42.2	177.8	-59.7	0	0	0	0	111.5	Q9 I10 H17	Q9-S13 WeakPolarHBondContact O-CB 3.28Å; Q9-S13 PolarHBondContact O-N 3.1Å; Q9-S13 PolarHBondContact O-OG 3.45Å; I10-S13 PolarHBondContact O-N 3.17Å; S13-H17 VanDerWaalsContact O-CB 3.31Å; S13-H17 WeakPolarHBondContact O-CB 3.39Å; S13-H17 PolarHBondContact O-N 3.32Å
14	F	98.6	Very high	97.4	Very high	16 Å²	16	56.2 Å²	56.2	7%	0.07	29%	0.289	C	S	.	.	H	α-helix	trans	-61.9	-48	175.2	175.5	-86.6	0	0	0	111.3	I10 G11 Q16 H17 Y18 I32 F103 L105 C114	I10-F14 WeakPolarHBondContact O-CB 3.19Å; I10-F14 PolarHBondContact O-N 3Å; G11-F14 PolarHBondContact O-N 3.29Å; F14-Q16 PolarHBondContact O-N 2.75Å; F14-H17 PolarHBondContact O-N 3.34Å; F14-Y18 HydrophobicContact CE1-CD2 4.37Å; F14-Y18 HydrophobicContact CZ-CD2 4.29Å; F14-Y18 VanDerWaalsContact O-CB 3.31Å; F14-Y18 WeakPolarHBondContact O-CB 3.38Å; F14-Y18 PolarHBondContact O-N 3.01Å; F14-I32 HydrophobicContact CE2-CB 4.15Å; F14-I32 HydrophobicContact CE2-CD1 4.23Å; F14-I32 HydrophobicContact CE2-CG2 4.3Å; F14-I32 HydrophobicContact CZ-CD1 3.98Å; F14-F103 HydrophobicContact CE1-CB 4.14Å; F14-F103 AromaticContact CE1-CD1 3.82Å; F14-F103 HydrophobicContact CE1-CD1 3.82Å; F14-F103 HydrophobicContact CE1-CD2 4.15Å; F14-F103 HydrophobicContact CE1-CE1 4.17Å; F14-F103 HydrophobicContact CE1-CE2 4.49Å; F14-F103 AromaticContact CE1-CG 3.77Å; F14-F103 HydrophobicContact CE1-CG 3.77Å; F14-F103 HydrophobicContact CE1-CZ 4.48Å; F14-F103 HydrophobicContact CZ-CD1 4.33Å; F14-L105 HydrophobicContact CB-CD1 3.61Å; F14-L105 HydrophobicContact CD1-CD1 3.94Å; F14-L105 HydrophobicContact CD1-CD2 3.63Å; F14-L105 HydrophobicContact CD1-CG 4.37Å; F14-L105 HydrophobicContact CD2-CD1 4.08Å; F14-L105 HydrophobicContact CD2-CD2 3.63Å; F14-L105 HydrophobicContact CE1-CD2 3.6Å; F14-L105 HydrophobicContact CE2-CD2 3.57Å; F14-L105 HydrophobicContact CG-CD1 3.58Å; F14-L105 HydrophobicContact CG-CD2 3.66Å; F14-L105 HydrophobicContact CG-CG 4.28Å; F14-L105 HydrophobicContact CZ-CD2 3.56Å; F14-C114 HydrophobicContact CE2-CB 4.06Å; F14-C114 HydrophobicContact CZ-CB 3.72Å
15	V	98.6	Very high	97.6	Very high	2 Å²	2	54.5 Å²	54.5	1%	0.012	28%	0.283	C	S	.	.	H	α-helix	trans	-58.7	-48.6	179.1	160.6	0	0	0	0	110.7	G11 S12 H17 Y18 Y19 I68 Q71 V85 F103	G11-V15 WeakPolarHBondContact O-CG2 3.26Å; G11-V15 PolarHBondContact O-N 2.89Å; S12-V15 PolarHBondContact O-N 3.48Å; V15-H17 VanDerWaalsContact C-N 3.33Å; V15-H17 PolarHBondContact O-N 2.9Å; V15-Y18 PolarHBondContact O-N 3.06Å; V15-Y19 HydrophobicContact CG1-CD2 3.84Å; V15-Y19 HydrophobicContact CG1-CE2 3.77Å; V15-Y19 WeakPolarHBondContact O-CD2 3.42Å; V15-Y19 PolarHBondContact O-N 3.29Å; V15-Y19 VanDerWaalsContact O-N 3.13Å; V15-I68 HydrophobicContact CG1-CG1 4.46Å; V15-Q71 VanDerWaalsContact CB-OE1 3.26Å; V15-V85 HydrophobicContact CG1-CG2 4.26Å; V15-V85 HydrophobicContact CG2-CG2 3.68Å; V15-F103 HydrophobicContact CG2-CD2 4.5Å; V15-F103 HydrophobicContact CG2-CE2 4.47Å
16	Q	98.3	Very high	97.5	Very high	136 Å²	136	54.2 Å²	54.2	64%	0.636	28%	0.276	S	S	*	.	H	α-helix	trans	-57	-47.8	176.4	-178.5	178.7	2	0	0	111.5	S12 F14 Q20	S12-Q16 WeakPolarHBondContact O-CB 3.32Å; S12-Q16 PolarHBondContact O-N 3.11Å; F14-Q16 PolarHBondContact O-N 2.75Å; Q16-Q20 VanDerWaalsContact O-CB 3.27Å; Q16-Q20 WeakPolarHBondContact O-CB 3.34Å; Q16-Q20 PolarHBondContact O-N 3.26Å
17	H	98.1	Very high	97.5	Very high	86 Å²	86	51.2 Å²	51.2	40%	0.398	26%	0.264	S	S	.	.	H	α-helix	trans	-64.7	-42.6	-179.3	-174.1	49.9	0	0	0	112.4	S13 F14 V15 Q20 M21	S13-H17 VanDerWaalsContact O-CB 3.31Å; S13-H17 WeakPolarHBondContact O-CB 3.39Å; S13-H17 PolarHBondContact O-N 3.32Å; F14-H17 PolarHBondContact O-N 3.34Å; V15-H17 VanDerWaalsContact C-N 3.33Å; V15-H17 PolarHBondContact O-N 2.9Å; H17-Q20 PolarHBondContact O-N 3.34Å; H17-M21 WeakPolarHBondContact CD2-CE 3.35Å; H17-M21 WeakPolarHBondContact NE2-CE 3.19Å; H17-M21 PolarHBondContact O-N 3.45Å
18	Y	98.6	Very high	97.4	Very high	0 Å²	0	51.5 Å²	51.5	0%	0	27%	0.27	C	S	.	.	H	α-helix	trans	-55.9	-57.4	177.7	176.8	-87.2	0	0	0	111.3	F14 V15 Q20 M21 F22 L29 I32 Y33 Q101 F103	F14-Y18 HydrophobicContact CE1-CD2 4.37Å; F14-Y18 HydrophobicContact CZ-CD2 4.29Å; F14-Y18 VanDerWaalsContact O-CB 3.31Å; F14-Y18 WeakPolarHBondContact O-CB 3.38Å; F14-Y18 PolarHBondContact O-N 3.01Å; V15-Y18 PolarHBondContact O-N 3.06Å; Y18-Q20 PolarHBondContact O-N 2.86Å; Y18-M21 PolarHBondContact O-N 2.63Å; Y18-F22 HydrophobicContact CE1-CB 4.5Å; Y18-F22 AromaticContact CE1-CD2 3.82Å; Y18-F22 HydrophobicContact CE1-CD2 3.82Å; Y18-F22 AromaticContact CZ-CD2 3.73Å; Y18-F22 WeakPolarHBondContact O-CB 3.32Å; Y18-F22 PolarHBondContact O-N 2.97Å; Y18-F22 WeakPolarHBondContact OH-CD2 3.26Å; Y18-F22 WeakPolarHBondContact OH-CE2 3.24Å; Y18-L29 HydrophobicContact CD2-CD2 3.95Å; Y18-L29 HydrophobicContact CE2-CD2 3.99Å; Y18-I32 HydrophobicContact CD2-CD1 3.4Å; Y18-I32 VanDerWaalsContact CD2-CD1 3.4Å; Y18-I32 HydrophobicContact CE2-CD1 3.92Å; Y18-Y33 WeakPolarHBondContact CE2-OH 3.16Å; Y18-Q101 PolarHBondContact OH-NE2 3.32Å; Y18-F103 HydrophobicContact CD1-CE1 4.32Å; Y18-F103 AromaticContact CD1-CZ 3.75Å; Y18-F103 HydrophobicContact CD1-CZ 3.75Å; Y18-F103 AromaticContact CD2-CE1 3.84Å; Y18-F103 HydrophobicContact CD2-CE1 3.84Å; Y18-F103 HydrophobicContact CD2-CZ 4.06Å; Y18-F103 HydrophobicContact CE1-CE1 4.19Å; Y18-F103 AromaticContact CE1-CZ 3.76Å; Y18-F103 HydrophobicContact CE1-CZ 3.76Å; Y18-F103 AromaticContact CE2-CE1 3.69Å; Y18-F103 HydrophobicContact CE2-CE1 3.69Å; Y18-F103 HydrophobicContact CE2-CZ 4.09Å; Y18-F103 HydrophobicContact CG-CE1 4.19Å; Y18-F103 AromaticContact CG-CZ 3.93Å; Y18-F103 HydrophobicContact CG-CZ 3.93Å; Y18-F103 AromaticContact CZ-CE1 3.89Å; Y18-F103 AromaticContact CZ-CZ 3.96Å
19	Y	98.5	Very high	97.3	Very high	11 Å²	11	48.4 Å²	48.4	4%	0.043	26%	0.256	C	S	.	.	H	α-helix	trans	-70.5	-32.8	-176.2	-68.3	-71.2	0	0	0	112.3	V15 M21 F22 D23 H66 I68 V85 F99 Q101	V15-Y19 HydrophobicContact CG1-CD2 3.84Å; V15-Y19 HydrophobicContact CG1-CE2 3.77Å; V15-Y19 WeakPolarHBondContact O-CD2 3.42Å; V15-Y19 PolarHBondContact O-N 3.29Å; V15-Y19 VanDerWaalsContact O-N 3.13Å; Y19-M21 VanDerWaalsContact C-N 3.34Å; Y19-M21 PolarHBondContact O-N 3.39Å; Y19-F22 PolarHBondContact O-N 2.87Å; Y19-D23 WeakPolarHBondContact O-CB 3.46Å; Y19-D23 VanDerWaalsContact O-CG 3.25Å; Y19-D23 PolarHBondContact O-N 2.91Å; Y19-H66 HydrophobicContact CD1-CB 3.61Å; Y19-H66 AromaticContact CD1-CD2 3.71Å; Y19-H66 AromaticContact CD1-CG 3.43Å; Y19-H66 VanDerWaalsContact CD1-CG 3.43Å; Y19-H66 AromaticContact CD1-ND1 3.79Å; Y19-H66 HydrophobicContact CE1-CB 4.23Å; Y19-H66 AromaticContact CE1-CD2 3.66Å; Y19-H66 AromaticContact CE1-CG 3.88Å; Y19-H66 HydrophobicContact CG-CB 4.14Å; Y19-I68 HydrophobicContact CD1-CD1 4.39Å; Y19-I68 HydrophobicContact CD2-CD1 3.5Å; Y19-I68 HydrophobicContact CD2-CG1 4.17Å; Y19-I68 HydrophobicContact CE1-CD1 4.33Å; Y19-I68 HydrophobicContact CE2-CD1 3.46Å; Y19-I68 VanDerWaalsContact CE2-CD1 3.46Å; Y19-I68 HydrophobicContact CE2-CG1 4.4Å; Y19-I68 HydrophobicContact CG-CD1 4Å; Y19-V85 HydrophobicContact CE2-CG1 4Å; Y19-V85 HydrophobicContact CE2-CG2 4.46Å; Y19-V85 WeakPolarHBondContact OH-CG1 3.4Å; Y19-F99 HydrophobicContact CE1-CE2 4.01Å; Y19-F99 AromaticContact CE1-CZ 3.84Å; Y19-F99 HydrophobicContact CE1-CZ 3.84Å; Y19-F99 AromaticContact CZ-CE2 3.86Å; Y19-F99 AromaticContact CZ-CZ 3.85Å; Y19-F99 WeakPolarHBondContact OH-CE2 3.49Å; Y19-Q101 WeakPolarHBondContact OH-CB 3.42Å; Y19-Q101 PolarHBondContact OH-OE1 3.37Å
20	Q	97.9	Very high	97.2	Very high	123 Å²	123	44.9 Å²	44.9	58%	0.575	24%	0.241	S	C	*	.	H	α-helix	trans	-60.1	-44.9	172.9	-176	179.3	1.6	0	0	111.6	Q16 H17 Y18 S24	Q16-Q20 VanDerWaalsContact O-CB 3.27Å; Q16-Q20 WeakPolarHBondContact O-CB 3.34Å; Q16-Q20 PolarHBondContact O-N 3.26Å; H17-Q20 PolarHBondContact O-N 3.34Å; Y18-Q20 PolarHBondContact O-N 2.86Å; Q20-S24 WeakPolarHBondContact O-CB 3.4Å; Q20-S24 PolarHBondContact O-N 2.81Å; Q20-S24 PolarHBondContact O-OG 3.2Å
21	M	97.4	Very high	97.1	Very high	18 Å²	18	47.1 Å²	47.1	9%	0.089	26%	0.259	C	S	.	.	H	α-helix	trans	-67.4	-42.3	175.1	-75.3	-172	-68.6	0	0	111.7	H17 Y18 Y19 D23 S24 D25 R26 Q28 L29 I32	H17-M21 WeakPolarHBondContact CD2-CE 3.35Å; H17-M21 WeakPolarHBondContact NE2-CE 3.19Å; H17-M21 PolarHBondContact O-N 3.45Å; Y18-M21 PolarHBondContact O-N 2.63Å; Y19-M21 VanDerWaalsContact C-N 3.34Å; Y19-M21 PolarHBondContact O-N 3.39Å; M21-D23 VanDerWaalsContact C-N 3.32Å; M21-D23 PolarHBondContact O-N 3.32Å; M21-S24 PolarHBondContact O-N 3.21Å; M21-S24 PolarHBondContact O-OG 3.24Å; M21-D25 CarbonylContact O-C 3.58Å; M21-D25 PolarHBondContact O-N 2.99Å; M21-R26 PolarHBondContact O-N 3.07Å; M21-Q28 HydrophobicContact SD-CB 4.33Å; M21-L29 HydrophobicContact CB-CD2 3.85Å; M21-L29 HydrophobicContact CB-CG 4.33Å; M21-L29 HydrophobicContact CE-CD2 4.08Å; M21-I32 HydrophobicContact CE-CG2 3.72Å
22	F	98	Very high	97	Very high	3 Å²	3	47.7 Å²	47.7	1%	0.013	26%	0.262	C	S	.	.	H	α-helix	trans	-58.6	-44.4	-179.9	-158.1	-67.9	0	0	0	112.1	Y18 Y19 L29 W41 L56 L59 F61 I64 H66	Y18-F22 HydrophobicContact CE1-CB 4.5Å; Y18-F22 AromaticContact CE1-CD2 3.82Å; Y18-F22 HydrophobicContact CE1-CD2 3.82Å; Y18-F22 AromaticContact CZ-CD2 3.73Å; Y18-F22 WeakPolarHBondContact O-CB 3.32Å; Y18-F22 PolarHBondContact O-N 2.97Å; Y18-F22 WeakPolarHBondContact OH-CD2 3.26Å; Y18-F22 WeakPolarHBondContact OH-CE2 3.24Å; Y19-F22 PolarHBondContact O-N 2.87Å; F22-L29 HydrophobicContact CB-CD1 4.14Å; F22-L29 HydrophobicContact CD2-CD1 3.41Å; F22-L29 VanDerWaalsContact CD2-CD1 3.41Å; F22-L29 HydrophobicContact CE2-CD1 4.08Å; F22-L29 HydrophobicContact CG-CD1 4.01Å; F22-W41 HydrophobicContact CE2-CH2 4.17Å; F22-W41 HydrophobicContact CE2-CZ3 4.08Å; F22-W41 AromaticContact CZ-CH2 3.74Å; F22-W41 HydrophobicContact CZ-CH2 3.74Å; F22-W41 HydrophobicContact CZ-CZ3 4.12Å; F22-L56 HydrophobicContact CE2-CD1 4.49Å; F22-L56 HydrophobicContact CE2-CD2 3.9Å; F22-L56 HydrophobicContact CZ-CD2 4.36Å; F22-L59 HydrophobicContact CZ-CD1 3.89Å; F22-F61 HydrophobicContact CE1-CE2 4.16Å; F22-F61 AromaticContact CE1-CZ 3.81Å; F22-F61 HydrophobicContact CE1-CZ 3.81Å; F22-F61 HydrophobicContact CZ-CZ 4.3Å; F22-I64 HydrophobicContact CD1-CG2 3.79Å; F22-I64 HydrophobicContact CE1-CD1 4.1Å; F22-I64 HydrophobicContact CE1-CG2 3.99Å; F22-H66 AromaticContact CD1-CE1 3.54Å; F22-H66 AromaticContact CE1-CE1 3.83Å
23	D	97.6	Very high	97.1	Very high	55 Å²	55	46.6 Å²	46.6	29%	0.294	25%	0.253	S	S	.	.	H	α-helix	trans	-75.7	-26.3	-177.1	-69.3	-2	0	0	0	113	Y19 M21 A65 H66	Y19-D23 WeakPolarHBondContact O-CB 3.46Å; Y19-D23 VanDerWaalsContact O-CG 3.25Å; Y19-D23 PolarHBondContact O-N 2.91Å; M21-D23 VanDerWaalsContact C-N 3.32Å; M21-D23 PolarHBondContact O-N 3.32Å; D23-A65 WeakPolarHBondContact OD2-CA 3.47Å; D23-H66 IonicContact OD1-CE1 3.51Å; D23-H66 IonicContact OD1-CG 3.74Å; D23-H66 IonicContact OD1-ND1 2.67Å; D23-H66 PolarHBondContact OD1-ND1 3.38Å; D23-H66 PolarHBondContact OD2-N 3.11Å; D23-H66 IonicContact OD2-ND1 3.91Å
24	S	96.6	Very high	97.1	Very high	93 Å²	93	45.2 Å²	45.2	65%	0.65	24%	0.24	S	C	*	.	H	α-helix	trans	-97.3	-57.2	-177	58.5	0	0	0	0	113.6	Q20 M21	Q20-S24 WeakPolarHBondContact O-CB 3.4Å; Q20-S24 PolarHBondContact O-N 2.81Å; Q20-S24 PolarHBondContact O-OG 3.2Å; M21-S24 PolarHBondContact O-N 3.21Å; M21-S24 PolarHBondContact O-OG 3.24Å
25	D	94.9	Very high	97	Very high	67 Å²	67	50.6 Å²	50.6	36%	0.358	27%	0.269	S	S	.	.	H	α-helix	trans	-152.3	88	178.7	-178.5	6.3	0	0	0	110.5	M21 S27 Q28	M21-D25 CarbonylContact O-C 3.58Å; M21-D25 PolarHBondContact O-N 2.99Å; D25-S27 VanDerWaalsContact CG-OG 3.22Å; D25-S27 PolarHBondContact O-N 2.95Å; D25-S27 VanDerWaalsContact OD1-CB 3.28Å; D25-S27 WeakPolarHBondContact OD1-CB 3.29Å; D25-S27 PolarHBondContact OD1-N 3.3Å; D25-S27 PolarHBondContact OD1-OG 2.81Å; D25-S27 PolarHBondContact OD2-OG 3.03Å; D25-Q28 HydrophobicContact CB-CG 4.12Å; D25-Q28 WeakPolarHBondContact O-CB 3.4Å; D25-Q28 PolarHBondContact O-N 3.08Å; D25-Q28 WeakPolarHBondContact OD2-CG 3.27Å; D25-Q28 PolarHBondContact OD2-NE2 3.46Å; D25-Q28 VanDerWaalsContact OD2-NE2 3.13Å
26	R	93.9	Very high	97	Very high	40 Å²	40	55.2 Å²	55.2	15%	0.151	30%	0.298	C	S	.	.	G	3₁₀ helix	trans	-61.8	-13.4	179.3	58.8	-172	179.5	-104.3	6.5	114.7	M21 Q28 L29 L56 L59 F61	M21-R26 PolarHBondContact O-N 3.07Å; R26-Q28 PolarHBondContact O-N 3.48Å; R26-L29 HydrophobicContact CB-CD1 3.83Å; R26-L29 WeakPolarHBondContact O-CB 3.33Å; R26-L29 PolarHBondContact O-N 3.13Å; R26-L56 WeakPolarHBondContact CD-O 3.46Å; R26-L56 PolarHBondContact NE-O 3.23Å; R26-L56 VanDerWaalsContact NE-O 3.11Å; R26-L59 PolarHBondContact NH2-O 2.78Å; R26-F61 VanDerWaalsContact NH1-CD2 3.29Å; R26-F61 PolarHBondContact NH2-O 2.9Å
27	S	94	Very high	97	Very high	53 Å²	53	48.8 Å²	48.8	37%	0.371	27%	0.268	S	S	.	.	G	3₁₀ helix	trans	-66.3	-24.1	172.3	76.2	0	0	0	0	112.4	D25 L29	D25-S27 VanDerWaalsContact CG-OG 3.22Å; D25-S27 PolarHBondContact O-N 2.95Å; D25-S27 VanDerWaalsContact OD1-CB 3.28Å; D25-S27 WeakPolarHBondContact OD1-CB 3.29Å; D25-S27 PolarHBondContact OD1-N 3.3Å; D25-S27 PolarHBondContact OD1-OG 2.81Å; D25-S27 PolarHBondContact OD2-OG 3.03Å; S27-L29 VanDerWaalsContact C-N 3.3Å; S27-L29 PolarHBondContact O-N 3.46Å
28	Q	95.4	Very high	97.1	Very high	106 Å²	106	46.9 Å²	46.9	50%	0.495	26%	0.264	S	S	.	.	G	3₁₀ helix	trans	-78.3	-11.5	178.6	-56.4	-57.6	-36.8	0	0	113.7	M21 D25 R26 G30 S31	M21-Q28 HydrophobicContact SD-CB 4.33Å; D25-Q28 HydrophobicContact CB-CG 4.12Å; D25-Q28 WeakPolarHBondContact O-CB 3.4Å; D25-Q28 PolarHBondContact O-N 3.08Å; D25-Q28 WeakPolarHBondContact OD2-CG 3.27Å; D25-Q28 PolarHBondContact OD2-NE2 3.46Å; D25-Q28 VanDerWaalsContact OD2-NE2 3.13Å; R26-Q28 PolarHBondContact O-N 3.48Å; Q28-G30 PolarHBondContact O-N 3.25Å; Q28-S31 WeakPolarHBondContact O-CB 3.34Å; Q28-S31 PolarHBondContact O-N 3.02Å; Q28-S31 PolarHBondContact O-OG 3.27Å
29	L	96.2	Very high	97.1	Very high	0 Å²	0	47 Å²	47	0%	0	26%	0.264	C	S	.	.	G	3₁₀ helix	trans	-61.6	-15.7	178.9	-71.7	168.2	0	0	0	112.7	Y18 M21 F22 R26 S27 S31 I32 Y33 L56	Y18-L29 HydrophobicContact CD2-CD2 3.95Å; Y18-L29 HydrophobicContact CE2-CD2 3.99Å; M21-L29 HydrophobicContact CB-CD2 3.85Å; M21-L29 HydrophobicContact CB-CG 4.33Å; M21-L29 HydrophobicContact CE-CD2 4.08Å; F22-L29 HydrophobicContact CB-CD1 4.14Å; F22-L29 HydrophobicContact CD2-CD1 3.41Å; F22-L29 VanDerWaalsContact CD2-CD1 3.41Å; F22-L29 HydrophobicContact CE2-CD1 4.08Å; F22-L29 HydrophobicContact CG-CD1 4.01Å; R26-L29 HydrophobicContact CB-CD1 3.83Å; R26-L29 WeakPolarHBondContact O-CB 3.33Å; R26-L29 PolarHBondContact O-N 3.13Å; S27-L29 VanDerWaalsContact C-N 3.3Å; S27-L29 PolarHBondContact O-N 3.46Å; L29-S31 PolarHBondContact O-N 3.45Å; L29-S31 VanDerWaalsContact O-N 3.08Å; L29-I32 HydrophobicContact CD2-CD1 3.83Å; L29-I32 HydrophobicContact CD2-CG1 4.46Å; L29-I32 WeakPolarHBondContact O-CG1 3.33Å; L29-I32 PolarHBondContact O-N 3.03Å; L29-Y33 HydrophobicContact CB-CE2 4.18Å; L29-Y33 WeakPolarHBondContact O-CD2 3.28Å; L29-L56 HydrophobicContact CB-CD1 4.26Å; L29-L56 HydrophobicContact CD1-CD1 3.66Å
30	G	95.8	Very high	97.1	Very high	5 Å²	5	48.8 Å²	48.8	5%	0.052	28%	0.276	C	S	.	.	G	3₁₀ helix	trans	-58.6	-20.5	170.9	0	0	0	0	0	114.2	Q28 I32 K49	Q28-G30 PolarHBondContact O-N 3.25Å; G30-I32 VanDerWaalsContact C-N 3.32Å; G30-I32 PolarHBondContact O-N 2.83Å; G30-K49 VanDerWaalsContact O-CD 3.27Å; G30-K49 WeakPolarHBondContact O-CD 3.32Å; G30-K49 WeakPolarHBondContact O-CE 3.27Å; G30-K49 PolarHBondContact O-NZ 2.63Å
31	S	95.9	Very high	97.1	Very high	77 Å²	77	44 Å²	44	54%	0.538	25%	0.253	S	S	.	.	G	3₁₀ helix	trans	-69.4	-26	179.5	59.2	0	0	0	0	114.1	Q28 L29	Q28-S31 WeakPolarHBondContact O-CB 3.34Å; Q28-S31 PolarHBondContact O-N 3.02Å; Q28-S31 PolarHBondContact O-OG 3.27Å; L29-S31 PolarHBondContact O-N 3.45Å; L29-S31 VanDerWaalsContact O-N 3.08Å
32	I	97.2	Very high	97.1	Very high	11 Å²	11	46.4 Å²	46.4	6%	0.056	26%	0.264	C	S	.	.	T	Hydrogen-bonded Turn	trans	-95.9	-12	-177.4	55.1	160.8	0	0	0	113.5	F14 Y18 M21 L29 G30 C114	F14-I32 HydrophobicContact CE2-CB 4.15Å; F14-I32 HydrophobicContact CE2-CD1 4.23Å; F14-I32 HydrophobicContact CE2-CG2 4.3Å; F14-I32 HydrophobicContact CZ-CD1 3.98Å; Y18-I32 HydrophobicContact CD2-CD1 3.4Å; Y18-I32 VanDerWaalsContact CD2-CD1 3.4Å; Y18-I32 HydrophobicContact CE2-CD1 3.92Å; M21-I32 HydrophobicContact CE-CG2 3.72Å; L29-I32 HydrophobicContact CD2-CD1 3.83Å; L29-I32 HydrophobicContact CD2-CG1 4.46Å; L29-I32 WeakPolarHBondContact O-CG1 3.33Å; L29-I32 PolarHBondContact O-N 3.03Å; G30-I32 VanDerWaalsContact C-N 3.32Å; G30-I32 PolarHBondContact O-N 2.83Å; I32-C114 PolarHBondContact O-N 3.48Å
33	Y	98.5	Very high	97.1	Very high	6 Å²	6	48.1 Å²	48.1	2%	0.024	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	158.1	177.9	-60.1	-69.7	0	0	0	111.7	Y18 L29 I52 L56 C114 D117	Y18-Y33 WeakPolarHBondContact CE2-OH 3.16Å; L29-Y33 HydrophobicContact CB-CE2 4.18Å; L29-Y33 WeakPolarHBondContact O-CD2 3.28Å; Y33-I52 HydrophobicContact CD1-CD1 4.06Å; Y33-I52 HydrophobicContact CD1-CG2 4.42Å; Y33-I52 HydrophobicContact CD2-CG2 3.63Å; Y33-I52 HydrophobicContact CE1-CD1 4.44Å; Y33-I52 HydrophobicContact CE1-CG2 4.23Å; Y33-I52 HydrophobicContact CE2-CG2 3.42Å; Y33-I52 VanDerWaalsContact CE2-CG2 3.42Å; Y33-I52 HydrophobicContact CG-CD1 4.22Å; Y33-I52 HydrophobicContact CG-CG2 4.14Å; Y33-L56 HydrophobicContact CE2-CD1 4.11Å; Y33-C114 HydrophobicContact CD1-CB 3.92Å; Y33-C114 HydrophobicContact CE1-CB 3.94Å; Y33-D117 HydrophobicContact CE1-CB 4.16Å; Y33-D117 PolarHBondContact OH-OD2 3.28Å
34	I	98.4	Very high	97.1	Very high	41 Å²	41	50.9 Å²	50.9	21%	0.21	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	171.8	175.7	58.7	172.1	0	0	0	110.6	T36 S37 K49 I108 V113 T115	I34-T36 VanDerWaalsContact CD1-OG1 3.27Å; I34-T36 WeakPolarHBondContact CD1-OG1 2.97Å; I34-T36 PolarHBondContact O-N 3.05Å; I34-T36 VanDerWaalsContact O-N 3.12Å; I34-S37 VanDerWaalsContact CG1-OG 3.27Å; I34-S37 WeakPolarHBondContact CG1-OG 3.47Å; I34-S37 PolarHBondContact N-OG 2.91Å; I34-S37 VanDerWaalsContact O-CB 3.32Å; I34-S37 WeakPolarHBondContact O-CB 2.95Å; I34-S37 PolarHBondContact O-N 3.28Å; I34-S37 PolarHBondContact O-OG 2.88Å; I34-K49 PolarHBondContact O-N 3.46Å; I34-I108 HydrophobicContact CD1-CD1 3.7Å; I34-V113 HydrophobicContact CD1-CG2 4.24Å; I34-V113 HydrophobicContact CG2-CB 4.05Å; I34-V113 HydrophobicContact CG2-CG1 4.03Å; I34-V113 HydrophobicContact CG2-CG2 3.96Å; I34-T115 HydrophobicContact CD1-CG2 4.3Å
35	D	98.1	Very high	97.2	Very high	129 Å²	129	51.1 Å²	51.1	69%	0.69	29%	0.293	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-63.5	-20.8	-176.7	-63.6	-22.1	0	0	0	113.5	G48	D35-G48 WeakPolarHBondContact O-CA 3.09Å
36	T	97.9	Very high	97.4	Very high	100 Å²	100	50.8 Å²	50.8	61%	0.613	29%	0.287	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.5	7.3	176.5	62.2	0	0	0	0	113.6	I34	I34-T36 VanDerWaalsContact CD1-OG1 3.27Å; I34-T36 WeakPolarHBondContact CD1-OG1 2.97Å; I34-T36 PolarHBondContact O-N 3.05Å; I34-T36 VanDerWaalsContact O-N 3.12Å
37	S	98.8	Very high	97.6	Very high	0 Å²	0	55.8 Å²	55.8	0%	0	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.5	148.7	178	-64.7	0	0	0	0	111.4	I34 G48 C114 T115	I34-S37 VanDerWaalsContact CG1-OG 3.27Å; I34-S37 WeakPolarHBondContact CG1-OG 3.47Å; I34-S37 PolarHBondContact N-OG 2.91Å; I34-S37 VanDerWaalsContact O-CB 3.32Å; I34-S37 WeakPolarHBondContact O-CB 2.95Å; I34-S37 PolarHBondContact O-N 3.28Å; I34-S37 PolarHBondContact O-OG 2.88Å; S37-G48 PolarHBondContact O-N 2.89Å; S37-C114 WeakPolarHBondContact CB-O 3.47Å; S37-C114 PolarHBondContact OG-O 2.67Å; S37-T115 CarbonylContact C-O 3.58Å; S37-T115 VanDerWaalsContact CA-O 3.29Å; S37-T115 WeakPolarHBondContact CA-O 3.33Å
38	C	98.8	Very high	97.8	Very high	46 Å²	46	53.8 Å²	53.8	31%	0.311	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	123.4	176.5	-66.4	0	0	0	0	110.3	T115 N116 D117	C38-T115 PolarHBondContact N-O 3.15Å; C38-N116 CarbonylContact O-C 3.53Å; C38-N116 WeakPolarHBondContact O-CA 3.38Å; C38-D117 PolarHBondContact O-N 2.97Å
39	L	98.9	Very high	97.9	Very high	2 Å²	2	52.5 Å²	52.5	1%	0.01	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	138.2	169.1	171.2	65	0	0	0	109.6	W41 P45 Y46 I52 K55 L56 D117	L39-W41 HydrophobicContact CD1-CB 4.4Å; L39-W41 HydrophobicContact CD1-CE3 4.36Å; L39-W41 HydrophobicContact CD2-CB 4.17Å; L39-W41 HydrophobicContact CG-CB 4.19Å; L39-P45 CarbonylContact O-C 3.48Å; L39-P45 WeakPolarHBondContact O-CA 3.27Å; L39-Y46 HydrophobicContact CD2-CD2 4.22Å; L39-Y46 HydrophobicContact CG-CD2 4.34Å; L39-Y46 PolarHBondContact N-O 3.2Å; L39-Y46 PolarHBondContact O-N 3.22Å; L39-I52 HydrophobicContact CB-CD1 4.11Å; L39-I52 HydrophobicContact CB-CG1 3.75Å; L39-I52 HydrophobicContact CB-CG2 4.38Å; L39-I52 HydrophobicContact CD2-CG2 4.1Å; L39-K55 HydrophobicContact CD2-CG 4.35Å; L39-L56 HydrophobicContact CD2-CD2 4.02Å; L39-L56 HydrophobicContact CD2-CG 4.35Å; L39-D117 CarbonylContact C-O 3.52Å; L39-D117 VanDerWaalsContact CA-O 3.28Å; L39-D117 WeakPolarHBondContact CA-O 3.48Å; L39-D117 HydrophobicContact CD1-CB 3.82Å
40	T	98.8	Very high	98	Very high	49 Å²	49	58.2 Å²	58.2	30%	0.301	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	111.7	159.8	-57.4	0	0	0	0	108.6	Q44 D117 M118 F119	T40-Q44 CarbonylContact C-O 3.02Å; T40-Q44 WeakPolarHBondContact CA-O 3.24Å; T40-D117 PolarHBondContact N-O 2.95Å; T40-M118 WeakPolarHBondContact O-CA 3.16Å; T40-F119 PolarHBondContact O-N 3.3Å
41	W	98.5	Very high	98.1	Very high	22 Å²	22	59.4 Å²	59.4	8%	0.083	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.6	115.6	-179.2	-174.7	-78.5	0	0	0	109.8	F22 L39 G43 Q44 Y46 L56 L59 F119	F22-W41 HydrophobicContact CE2-CH2 4.17Å; F22-W41 HydrophobicContact CE2-CZ3 4.08Å; F22-W41 AromaticContact CZ-CH2 3.74Å; F22-W41 HydrophobicContact CZ-CH2 3.74Å; F22-W41 HydrophobicContact CZ-CZ3 4.12Å; L39-W41 HydrophobicContact CD1-CB 4.4Å; L39-W41 HydrophobicContact CD1-CE3 4.36Å; L39-W41 HydrophobicContact CD2-CB 4.17Å; L39-W41 HydrophobicContact CG-CB 4.19Å; W41-G43 PolarHBondContact O-N 2.79Å; W41-Q44 PolarHBondContact N-O 3Å; W41-Q44 WeakPolarHBondContact O-CB 3.44Å; W41-Q44 PolarHBondContact O-N 2.78Å; W41-Y46 HydrophobicContact CB-CD2 4.44Å; W41-Y46 HydrophobicContact CB-CE2 4.06Å; W41-L56 HydrophobicContact CE3-CD2 3.75Å; W41-L56 HydrophobicContact CZ3-CD2 3.74Å; W41-L59 HydrophobicContact CH2-CD1 3.77Å; W41-L59 HydrophobicContact CZ2-CD1 3.51Å; W41-L59 HydrophobicContact CZ2-CD2 4.01Å; W41-L59 HydrophobicContact CZ2-CG 4.44Å; W41-L59 HydrophobicContact CZ3-CD1 4.46Å; W41-F119 HydrophobicContact CD2-CB 4.28Å; W41-F119 AromaticContact CD2-CD1 3.69Å; W41-F119 HydrophobicContact CD2-CD1 3.69Å; W41-F119 HydrophobicContact CD2-CE1 4.39Å; W41-F119 HydrophobicContact CD2-CG 4.18Å; W41-F119 AromaticContact CE2-CD1 3.63Å; W41-F119 AromaticContact CE2-CE1 3.86Å; W41-F119 HydrophobicContact CE3-CB 3.64Å; W41-F119 AromaticContact CE3-CD1 3.71Å; W41-F119 HydrophobicContact CE3-CD1 3.71Å; W41-F119 AromaticContact CE3-CG 3.71Å; W41-F119 HydrophobicContact CE3-CG 3.71Å; W41-F119 HydrophobicContact CG-CD1 4.4Å; W41-F119 AromaticContact CH2-CD1 3.63Å; W41-F119 HydrophobicContact CH2-CD1 3.63Å; W41-F119 HydrophobicContact CH2-CD2 4.02Å; W41-F119 AromaticContact CH2-CE1 3.71Å; W41-F119 HydrophobicContact CH2-CE1 3.71Å; W41-F119 HydrophobicContact CH2-CE2 4.07Å; W41-F119 AromaticContact CH2-CG 3.8Å; W41-F119 HydrophobicContact CH2-CG 3.8Å; W41-F119 AromaticContact CH2-CZ 3.93Å; W41-F119 HydrophobicContact CH2-CZ 3.93Å; W41-F119 AromaticContact CZ2-CD1 3.62Å; W41-F119 HydrophobicContact CZ2-CD1 3.62Å; W41-F119 AromaticContact CZ2-CE1 3.51Å; W41-F119 HydrophobicContact CZ2-CE1 3.51Å; W41-F119 HydrophobicContact CZ2-CG 4.27Å; W41-F119 HydrophobicContact CZ2-CZ 4.06Å; W41-F119 HydrophobicContact CZ3-CB 3.81Å; W41-F119 AromaticContact CZ3-CD1 3.68Å; W41-F119 HydrophobicContact CZ3-CD1 3.68Å; W41-F119 AromaticContact CZ3-CD2 3.92Å; W41-F119 HydrophobicContact CZ3-CD2 3.92Å; W41-F119 HydrophobicContact CZ3-CE1 4.25Å; W41-F119 HydrophobicContact CZ3-CE2 4.43Å; W41-F119 AromaticContact CZ3-CG 3.5Å; W41-F119 HydrophobicContact CZ3-CG 3.5Å
42	E	97.4	Very high	98.3	Very high	69 Å²	69	55.8 Å²	55.8	32%	0.322	31%	0.306	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.7	37.4	-177.8	-69.2	-63.2	136.7	0	0	112.4	Q44 F119 R120 L121	E42-Q44 VanDerWaalsContact C-N 3.3Å; E42-Q44 PolarHBondContact O-N 3.12Å; E42-F119 PolarHBondContact N-O 2.85Å; E42-R120 VanDerWaalsContact OE1-CA 3.3Å; E42-R120 WeakPolarHBondContact OE1-CA 3.49Å; E42-L121 WeakPolarHBondContact OE1-CB 3.3Å; E42-L121 WeakPolarHBondContact OE1-CG 3.42Å; E42-L121 PolarHBondContact OE1-N 2.91Å
43	G	96.9	Very high	98.3	Very high	39 Å²	39	56.6 Å²	56.6	40%	0.402	31%	0.312	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.2	-2.5	-178.7	0	0	0	0	0	115.8	W41	W41-G43 PolarHBondContact O-N 2.79Å
44	Q	98.3	Very high	98.3	Very high	114 Å²	114	62.1 Å²	62.1	53%	0.533	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	127.1	176.2	-60.4	-58.4	-45.3	0	0	111	T40 W41 E42 Y46	T40-Q44 CarbonylContact C-O 3.02Å; T40-Q44 WeakPolarHBondContact CA-O 3.24Å; W41-Q44 PolarHBondContact N-O 3Å; W41-Q44 WeakPolarHBondContact O-CB 3.44Å; W41-Q44 PolarHBondContact O-N 2.78Å; E42-Q44 VanDerWaalsContact C-N 3.3Å; E42-Q44 PolarHBondContact O-N 3.12Å; Q44-Y46 HydrophobicContact CB-CE2 3.67Å; Q44-Y46 VanDerWaalsContact O-CD2 3.28Å; Q44-Y46 WeakPolarHBondContact O-CD2 3.47Å; Q44-Y46 WeakPolarHBondContact O-CE2 3.19Å
45	P	98.4	Very high	98.3	Very high	98 Å²	98	62.2 Å²	62.2	64%	0.636	34%	0.337	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.2	142.3	-179.7	33.4	-34.1	0	0	0	112.5	L39	L39-P45 CarbonylContact O-C 3.48Å; L39-P45 WeakPolarHBondContact O-CA 3.27Å
46	Y	98.7	Very high	98.3	Very high	59 Å²	59	56.1 Å²	56.1	23%	0.231	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	124.5	173.8	-54.8	-94.7	0	0	0	108.6	L39 W41 Q44 K55	L39-Y46 HydrophobicContact CD2-CD2 4.22Å; L39-Y46 HydrophobicContact CG-CD2 4.34Å; L39-Y46 PolarHBondContact N-O 3.2Å; L39-Y46 PolarHBondContact O-N 3.22Å; W41-Y46 HydrophobicContact CB-CD2 4.44Å; W41-Y46 HydrophobicContact CB-CE2 4.06Å; Q44-Y46 HydrophobicContact CB-CE2 3.67Å; Q44-Y46 VanDerWaalsContact O-CD2 3.28Å; Q44-Y46 WeakPolarHBondContact O-CD2 3.47Å; Q44-Y46 WeakPolarHBondContact O-CE2 3.19Å; Y46-K55 HydrophobicContact CD1-CB 3.74Å; Y46-K55 HydrophobicContact CD1-CG 4.08Å; Y46-K55 HydrophobicContact CD2-CB 4.35Å; Y46-K55 HydrophobicContact CD2-CG 3.96Å; Y46-K55 HydrophobicContact CE1-CB 3.77Å; Y46-K55 HydrophobicContact CE1-CD 3.73Å; Y46-K55 HydrophobicContact CE1-CG 3.76Å; Y46-K55 HydrophobicContact CE2-CB 4.4Å; Y46-K55 HydrophobicContact CE2-CD 3.92Å; Y46-K55 HydrophobicContact CE2-CG 3.67Å; Y46-K55 HydrophobicContact CG-CB 4.06Å; Y46-K55 HydrophobicContact CG-CG 4.18Å; Y46-K55 WeakPolarHBondContact OH-CD 3.3Å; Y46-K55 VanDerWaalsContact OH-CE 3.28Å; Y46-K55 WeakPolarHBondContact OH-CE 3.35Å; Y46-K55 PolarHBondContact OH-NZ 3.34Å
47	Q	98.6	Very high	98.2	Very high	145 Å²	145	54.2 Å²	54.2	68%	0.678	29%	0.292	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.1	134.3	-177.2	-172.8	176.3	9.2	0	0	111.1	A51	Q47-A51 WeakPolarHBondContact O-CB 3.5Å
48	G	98.4	Very high	98.1	Very high	11 Å²	11	57.9 Å²	57.9	11%	0.113	32%	0.318	C	S	.	.	S	Bend	trans	83.7	147.8	178.1	0	0	0	0	0	113.5	D35 S37 I50 A51 I52	D35-G48 WeakPolarHBondContact O-CA 3.09Å; S37-G48 PolarHBondContact O-N 2.89Å; G48-I50 VanDerWaalsContact C-N 3.26Å; G48-I50 PolarHBondContact O-N 2.84Å; G48-I50 VanDerWaalsContact O-N 3.13Å; G48-A51 PolarHBondContact O-N 2.89Å; G48-I52 VanDerWaalsContact O-CG1 3.29Å; G48-I52 WeakPolarHBondContact O-CG1 3.39Å; G48-I52 PolarHBondContact O-N 3.4Å
49	K	98.2	Very high	98	Very high	79 Å²	79	56.3 Å²	56.3	34%	0.343	31%	0.306	S	S	.	.	H	α-helix	trans	-45.6	-45	-177.4	170.9	175.7	169.2	156.9	0	114.1	G30 I34 I52 V53	G30-K49 VanDerWaalsContact O-CD 3.27Å; G30-K49 WeakPolarHBondContact O-CD 3.32Å; G30-K49 WeakPolarHBondContact O-CE 3.27Å; G30-K49 PolarHBondContact O-NZ 2.63Å; I34-K49 PolarHBondContact O-N 3.46Å; K49-I52 PolarHBondContact O-N 2.96Å; K49-V53 WeakPolarHBondContact O-CG2 3.48Å; K49-V53 PolarHBondContact O-N 2.61Å
50	I	97.9	Very high	97.9	Very high	120 Å²	120	62.4 Å²	62.4	62%	0.615	35%	0.346	S	S	*	.	H	α-helix	trans	-62.8	-54.6	-177	-62.8	174.4	0	0	0	110.6	G48 I52 V53 E54	G48-I50 VanDerWaalsContact C-N 3.26Å; G48-I50 PolarHBondContact O-N 2.84Å; G48-I50 VanDerWaalsContact O-N 3.13Å; I50-I52 VanDerWaalsContact C-N 3.26Å; I50-I52 PolarHBondContact O-N 3.18Å; I50-V53 PolarHBondContact O-N 3.24Å; I50-E54 HydrophobicContact CG2-CG 4.44Å; I50-E54 WeakPolarHBondContact O-CB 3.28Å; I50-E54 WeakPolarHBondContact O-CG 3.42Å; I50-E54 PolarHBondContact O-N 3.05Å
51	A	98.5	Very high	97.7	Very high	31 Å²	31	61.4 Å²	61.4	26%	0.256	34%	0.338	S	S	.	.	H	α-helix	trans	-62.7	-34.6	-179	0	0	0	0	0	112.3	Q47 G48 K55	Q47-A51 WeakPolarHBondContact O-CB 3.5Å; G48-A51 PolarHBondContact O-N 2.89Å; A51-K55 WeakPolarHBondContact O-CB 3.42Å; A51-K55 PolarHBondContact O-N 2.91Å
52	I	98.7	Very high	97.4	Very high	0 Å²	0	66.1 Å²	66.1	0%	0	37%	0.369	C	S	.	.	H	α-helix	trans	-62.9	-53.9	174.9	-67.1	172.1	0	0	0	110.4	Y33 L39 G48 K49 I50 E54 K55 L56	Y33-I52 HydrophobicContact CD1-CD1 4.06Å; Y33-I52 HydrophobicContact CD1-CG2 4.42Å; Y33-I52 HydrophobicContact CD2-CG2 3.63Å; Y33-I52 HydrophobicContact CE1-CD1 4.44Å; Y33-I52 HydrophobicContact CE1-CG2 4.23Å; Y33-I52 HydrophobicContact CE2-CG2 3.42Å; Y33-I52 VanDerWaalsContact CE2-CG2 3.42Å; Y33-I52 HydrophobicContact CG-CD1 4.22Å; Y33-I52 HydrophobicContact CG-CG2 4.14Å; L39-I52 HydrophobicContact CB-CD1 4.11Å; L39-I52 HydrophobicContact CB-CG1 3.75Å; L39-I52 HydrophobicContact CB-CG2 4.38Å; L39-I52 HydrophobicContact CD2-CG2 4.1Å; G48-I52 VanDerWaalsContact O-CG1 3.29Å; G48-I52 WeakPolarHBondContact O-CG1 3.39Å; G48-I52 PolarHBondContact O-N 3.4Å; K49-I52 PolarHBondContact O-N 2.96Å; I50-I52 VanDerWaalsContact C-N 3.26Å; I50-I52 PolarHBondContact O-N 3.18Å; I52-E54 VanDerWaalsContact C-N 3.34Å; I52-E54 PolarHBondContact O-N 2.7Å; I52-K55 PolarHBondContact O-N 2.78Å; I52-L56 HydrophobicContact CG2-CD1 3.98Å; I52-L56 HydrophobicContact CG2-CG 4.4Å; I52-L56 WeakPolarHBondContact O-CG 3.28Å; I52-L56 PolarHBondContact O-N 2.82Å
53	V	97.9	Very high	97.3	Very high	29 Å²	29	70.4 Å²	70.4	18%	0.176	39%	0.387	C	S	.	.	H	α-helix	trans	-62.8	-41.6	-179.2	173.7	0	0	0	0	111.3	K49 I50 K55 L56 T57	K49-V53 WeakPolarHBondContact O-CG2 3.48Å; K49-V53 PolarHBondContact O-N 2.61Å; I50-V53 PolarHBondContact O-N 3.24Å; V53-K55 VanDerWaalsContact C-N 3.32Å; V53-K55 PolarHBondContact O-N 2.8Å; V53-L56 PolarHBondContact O-N 2.88Å; V53-T57 HydrophobicContact CG1-CG2 4.12Å; V53-T57 WeakPolarHBondContact O-CB 3.48Å; V53-T57 VanDerWaalsContact O-CG2 3.32Å; V53-T57 WeakPolarHBondContact O-CG2 3.31Å; V53-T57 PolarHBondContact O-N 2.98Å; V53-T57 PolarHBondContact O-OG1 3.13Å
54	E	98.1	Very high	97.3	Very high	122 Å²	122	69.2 Å²	69.2	57%	0.57	37%	0.371	S	S	*	.	H	α-helix	trans	-56.5	-46.9	174	-75.7	176.6	174.4	0	0	111.2	I50 I52 T57 S58	I50-E54 HydrophobicContact CG2-CG 4.44Å; I50-E54 WeakPolarHBondContact O-CB 3.28Å; I50-E54 WeakPolarHBondContact O-CG 3.42Å; I50-E54 PolarHBondContact O-N 3.05Å; I52-E54 VanDerWaalsContact C-N 3.34Å; I52-E54 PolarHBondContact O-N 2.7Å; E54-T57 PolarHBondContact O-OG1 3Å; E54-T57 VanDerWaalsContact O-OG1 3.06Å; E54-S58 VanDerWaalsContact O-CB 3.26Å; E54-S58 WeakPolarHBondContact O-CB 3.36Å; E54-S58 PolarHBondContact O-N 2.94Å
55	K	98.2	Very high	97.3	Very high	43 Å²	43	66.4 Å²	66.4	19%	0.187	37%	0.367	C	S	.	.	H	α-helix	trans	-61.9	-48.3	177.3	174.4	55.4	-179.6	178.9	0	112.5	L39 Y46 A51 I52 V53 T57 S58	L39-K55 HydrophobicContact CD2-CG 4.35Å; Y46-K55 HydrophobicContact CD1-CB 3.74Å; Y46-K55 HydrophobicContact CD1-CG 4.08Å; Y46-K55 HydrophobicContact CD2-CB 4.35Å; Y46-K55 HydrophobicContact CD2-CG 3.96Å; Y46-K55 HydrophobicContact CE1-CB 3.77Å; Y46-K55 HydrophobicContact CE1-CD 3.73Å; Y46-K55 HydrophobicContact CE1-CG 3.76Å; Y46-K55 HydrophobicContact CE2-CB 4.4Å; Y46-K55 HydrophobicContact CE2-CD 3.92Å; Y46-K55 HydrophobicContact CE2-CG 3.67Å; Y46-K55 HydrophobicContact CG-CB 4.06Å; Y46-K55 HydrophobicContact CG-CG 4.18Å; Y46-K55 WeakPolarHBondContact OH-CD 3.3Å; Y46-K55 VanDerWaalsContact OH-CE 3.28Å; Y46-K55 WeakPolarHBondContact OH-CE 3.35Å; Y46-K55 PolarHBondContact OH-NZ 3.34Å; A51-K55 WeakPolarHBondContact O-CB 3.42Å; A51-K55 PolarHBondContact O-N 2.91Å; I52-K55 PolarHBondContact O-N 2.78Å; V53-K55 VanDerWaalsContact C-N 3.32Å; V53-K55 PolarHBondContact O-N 2.8Å; K55-T57 VanDerWaalsContact C-N 3.33Å; K55-T57 PolarHBondContact O-N 3.4Å; K55-S58 PolarHBondContact O-N 2.88Å; K55-S58 PolarHBondContact O-OG 2.83Å; K55-S58 VanDerWaalsContact O-OG 3.1Å
56	L	97.5	Very high	97.3	Very high	0 Å²	0	63 Å²	63	0%	0	34%	0.343	C	S	.	.	H	α-helix	trans	-66	-38.9	-176.8	-64.2	-179	0	0	0	111.3	F22 R26 L29 Y33 L39 W41 I52 V53 L59	F22-L56 HydrophobicContact CE2-CD1 4.49Å; F22-L56 HydrophobicContact CE2-CD2 3.9Å; F22-L56 HydrophobicContact CZ-CD2 4.36Å; R26-L56 WeakPolarHBondContact CD-O 3.46Å; R26-L56 PolarHBondContact NE-O 3.23Å; R26-L56 VanDerWaalsContact NE-O 3.11Å; L29-L56 HydrophobicContact CB-CD1 4.26Å; L29-L56 HydrophobicContact CD1-CD1 3.66Å; Y33-L56 HydrophobicContact CE2-CD1 4.11Å; L39-L56 HydrophobicContact CD2-CD2 4.02Å; L39-L56 HydrophobicContact CD2-CG 4.35Å; W41-L56 HydrophobicContact CE3-CD2 3.75Å; W41-L56 HydrophobicContact CZ3-CD2 3.74Å; I52-L56 HydrophobicContact CG2-CD1 3.98Å; I52-L56 HydrophobicContact CG2-CG 4.4Å; I52-L56 WeakPolarHBondContact O-CG 3.28Å; I52-L56 PolarHBondContact O-N 2.82Å; V53-L56 PolarHBondContact O-N 2.88Å; L56-L59 HydrophobicContact CD2-CD1 4.37Å; L56-L59 WeakPolarHBondContact O-CG 3.49Å
57	T	96.7	Very high	97.3	Very high	60 Å²	60	63.5 Å²	63.5	37%	0.368	36%	0.355	S	S	.	.	H	α-helix	trans	-71.5	-30.1	176.3	54.5	0	0	0	0	112.8	V53 E54 K55 L59	V53-T57 HydrophobicContact CG1-CG2 4.12Å; V53-T57 WeakPolarHBondContact O-CB 3.48Å; V53-T57 VanDerWaalsContact O-CG2 3.32Å; V53-T57 WeakPolarHBondContact O-CG2 3.31Å; V53-T57 PolarHBondContact O-N 2.98Å; V53-T57 PolarHBondContact O-OG1 3.13Å; E54-T57 PolarHBondContact O-OG1 3Å; E54-T57 VanDerWaalsContact O-OG1 3.06Å; K55-T57 VanDerWaalsContact C-N 3.33Å; K55-T57 PolarHBondContact O-N 3.4Å; T57-L59 PolarHBondContact O-N 3.47Å
58	S	97.2	Very high	97.3	Very high	78 Å²	78	59.4 Å²	59.4	55%	0.545	34%	0.337	S	S	.	.	T	Hydrogen-bonded Turn	trans	-75.2	-2.8	178.6	89.4	0	0	0	0	114.7	E54 K55	E54-S58 VanDerWaalsContact O-CB 3.26Å; E54-S58 WeakPolarHBondContact O-CB 3.36Å; E54-S58 PolarHBondContact O-N 2.94Å; K55-S58 PolarHBondContact O-N 2.88Å; K55-S58 PolarHBondContact O-OG 2.83Å; K55-S58 VanDerWaalsContact O-OG 3.1Å
59	L	96.9	Very high	97.3	Very high	12 Å²	12	63.6 Å²	63.6	6%	0.063	36%	0.361	C	S	.	.	S	Bend	trans	-66.2	135.5	-177.4	-63.7	172.4	0	0	0	110.9	F22 R26 W41 L56 T57 F61	F22-L59 HydrophobicContact CZ-CD1 3.89Å; R26-L59 PolarHBondContact NH2-O 2.78Å; W41-L59 HydrophobicContact CH2-CD1 3.77Å; W41-L59 HydrophobicContact CZ2-CD1 3.51Å; W41-L59 HydrophobicContact CZ2-CD2 4.01Å; W41-L59 HydrophobicContact CZ2-CG 4.44Å; W41-L59 HydrophobicContact CZ3-CD1 4.46Å; L56-L59 HydrophobicContact CD2-CD1 4.37Å; L56-L59 WeakPolarHBondContact O-CG 3.49Å; T57-L59 PolarHBondContact O-N 3.47Å; L59-F61 HydrophobicContact CB-CD1 3.9Å; L59-F61 HydrophobicContact CB-CE1 3.29Å; L59-F61 HydrophobicContact CB-CE2 4.46Å; L59-F61 HydrophobicContact CB-CZ 3.59Å; L59-F61 HydrophobicContact CD1-CE1 3.7Å; L59-F61 HydrophobicContact CD1-CZ 3.55Å; L59-F61 HydrophobicContact CG-CE1 4.04Å; L59-F61 HydrophobicContact CG-CZ 4.21Å; L59-F61 PolarHBondContact O-N 2.95Å
60	P	95.4	Very high	97.3	Very high	131 Å²	131	62 Å²	62	85%	0.851	36%	0.362	S	S	*	.	S	Bend	trans	-83.6	53	-166.2	36.6	-39.1	0	0	0	113
61	F	94.5	Very high	97.3	Very high	27 Å²	27	59.5 Å²	59.5	12%	0.118	35%	0.348	C	S	.	.			trans	-139.5	151.7	173.9	50.6	-101.7	0	0	0	111.2	F22 R26 L59 I64 A91 D92	F22-F61 HydrophobicContact CE1-CE2 4.16Å; F22-F61 AromaticContact CE1-CZ 3.81Å; F22-F61 HydrophobicContact CE1-CZ 3.81Å; F22-F61 HydrophobicContact CZ-CZ 4.3Å; R26-F61 VanDerWaalsContact NH1-CD2 3.29Å; R26-F61 PolarHBondContact NH2-O 2.9Å; L59-F61 HydrophobicContact CB-CD1 3.9Å; L59-F61 HydrophobicContact CB-CE1 3.29Å; L59-F61 HydrophobicContact CB-CE2 4.46Å; L59-F61 HydrophobicContact CB-CZ 3.59Å; L59-F61 HydrophobicContact CD1-CE1 3.7Å; L59-F61 HydrophobicContact CD1-CZ 3.55Å; L59-F61 HydrophobicContact CG-CE1 4.04Å; L59-F61 HydrophobicContact CG-CZ 4.21Å; L59-F61 PolarHBondContact O-N 2.95Å; F61-I64 HydrophobicContact CD2-CB 3.87Å; F61-I64 HydrophobicContact CD2-CD1 4.44Å; F61-I64 HydrophobicContact CD2-CG2 4.18Å; F61-I64 HydrophobicContact CE1-CD1 4.08Å; F61-I64 HydrophobicContact CE2-CB 3.7Å; F61-I64 HydrophobicContact CE2-CD1 3.86Å; F61-I64 HydrophobicContact CE2-CG1 4.39Å; F61-I64 HydrophobicContact CE2-CG2 3.61Å; F61-I64 HydrophobicContact CZ-CB 4.42Å; F61-I64 HydrophobicContact CZ-CD1 3.69Å; F61-I64 HydrophobicContact CZ-CG2 4.4Å; F61-A91 HydrophobicContact CB-CB 4.02Å; F61-A91 HydrophobicContact CD1-CB 4.27Å; F61-A91 HydrophobicContact CG-CB 4.19Å; F61-D92 WeakPolarHBondContact CA-OD2 3.39Å; F61-D92 WeakPolarHBondContact CB-OD2 3.44Å
62	T	93	Very high	97.3	Very high	121 Å²	121	62.5 Å²	62.5	74%	0.742	36%	0.36	S	S	*	.	S	Bend	trans	-89.7	-48.9	178.2	-53.6	0	0	0	0	110.9	D92	T62-D92 WeakPolarHBondContact CB-OD1 3.31Å; T62-D92 PolarHBondContact N-OD1 3.45Å; T62-D92 PolarHBondContact N-OD2 2.89Å
63	K	94.8	Very high	97.3	Very high	159 Å²	159	63.4 Å²	63.4	69%	0.691	36%	0.364	S	S	*	.			trans	-119.2	145.3	179.3	-65.2	-179.1	-177.7	176.7	0	109.8	A91 D92	K63-A91 WeakPolarHBondContact O-CA 3.35Å; K63-D92 PolarHBondContact N-OD1 2.85Å; K63-D92 PolarHBondContact O-N 3.13Å
64	I	97.5	Very high	97.4	Very high	15 Å²	15	68 Å²	68	8%	0.077	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.8	147.2	171.4	-168.8	162.4	0	0	0	108.5	F22 F61 H66 L89 K90 A91	F22-I64 HydrophobicContact CD1-CG2 3.79Å; F22-I64 HydrophobicContact CE1-CD1 4.1Å; F22-I64 HydrophobicContact CE1-CG2 3.99Å; F61-I64 HydrophobicContact CD2-CB 3.87Å; F61-I64 HydrophobicContact CD2-CD1 4.44Å; F61-I64 HydrophobicContact CD2-CG2 4.18Å; F61-I64 HydrophobicContact CE1-CD1 4.08Å; F61-I64 HydrophobicContact CE2-CB 3.7Å; F61-I64 HydrophobicContact CE2-CD1 3.86Å; F61-I64 HydrophobicContact CE2-CG1 4.39Å; F61-I64 HydrophobicContact CE2-CG2 3.61Å; F61-I64 HydrophobicContact CZ-CB 4.42Å; F61-I64 HydrophobicContact CZ-CD1 3.69Å; F61-I64 HydrophobicContact CZ-CG2 4.4Å; I64-H66 VanDerWaalsContact CD1-CE1 3.48Å; I64-H66 WeakPolarHBondContact CD1-CE1 3.19Å; I64-L89 HydrophobicContact CD1-CD1 4.39Å; I64-K90 CarbonylContact C-O 3.59Å; I64-K90 VanDerWaalsContact CA-O 3.32Å; I64-K90 WeakPolarHBondContact CA-O 3.16Å; I64-A91 HydrophobicContact CD1-CB 4.45Å; I64-A91 HydrophobicContact CG1-CB 4.47Å
65	A	98.1	Very high	97.4	Very high	55 Å²	55	65.6 Å²	65.6	46%	0.455	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	126	172.5	0	0	0	0	0	109.1	D23 L89 K90	D23-A65 WeakPolarHBondContact OD2-CA 3.47Å; A65-L89 CarbonylContact O-C 3.51Å; A65-L89 VanDerWaalsContact O-CA 3.24Å; A65-L89 WeakPolarHBondContact O-CA 3.38Å; A65-K90 PolarHBondContact N-O 2.79Å; A65-K90 PolarHBondContact O-N 3.35Å
66	H	98.6	Very high	97.3	Very high	25 Å²	25	65.4 Å²	65.4	12%	0.116	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	139	173.6	-64.1	83.5	0	0	0	110.8	Y19 F22 D23 I64 F99	Y19-H66 HydrophobicContact CD1-CB 3.61Å; Y19-H66 AromaticContact CD1-CD2 3.71Å; Y19-H66 AromaticContact CD1-CG 3.43Å; Y19-H66 VanDerWaalsContact CD1-CG 3.43Å; Y19-H66 AromaticContact CD1-ND1 3.79Å; Y19-H66 HydrophobicContact CE1-CB 4.23Å; Y19-H66 AromaticContact CE1-CD2 3.66Å; Y19-H66 AromaticContact CE1-CG 3.88Å; Y19-H66 HydrophobicContact CG-CB 4.14Å; F22-H66 AromaticContact CD1-CE1 3.54Å; F22-H66 AromaticContact CE1-CE1 3.83Å; D23-H66 IonicContact OD1-CE1 3.51Å; D23-H66 IonicContact OD1-CG 3.74Å; D23-H66 IonicContact OD1-ND1 2.67Å; D23-H66 PolarHBondContact OD1-ND1 3.38Å; D23-H66 PolarHBondContact OD2-N 3.11Å; D23-H66 IonicContact OD2-ND1 3.91Å; I64-H66 VanDerWaalsContact CD1-CE1 3.48Å; I64-H66 WeakPolarHBondContact CD1-CE1 3.19Å; H66-F99 AromaticContact CD2-CE1 3.69Å; H66-F99 AromaticContact CD2-CZ 3.89Å
67	S	98.2	Very high	97.3	Very high	71 Å²	71	71.6 Å²	71.6	50%	0.497	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	113.2	171.9	179.6	0	0	0	0	108.9	T69 G87 Q88	S67-T69 PolarHBondContact O-N 2.9Å; S67-G87 VanDerWaalsContact O-CA 3.27Å; S67-G87 WeakPolarHBondContact O-CA 3.49Å; S67-Q88 PolarHBondContact N-O 2.9Å; S67-Q88 PolarHBondContact O-N 3.32Å
68	I	98.5	Very high	97.2	Very high	58 Å²	58	75 Å²	75	30%	0.297	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	121.3	-177.6	-50.1	-48.1	0	0	0	109.1	V15 Y19 Q71 V85 F99	V15-I68 HydrophobicContact CG1-CG1 4.46Å; Y19-I68 HydrophobicContact CD1-CD1 4.39Å; Y19-I68 HydrophobicContact CD2-CD1 3.5Å; Y19-I68 HydrophobicContact CD2-CG1 4.17Å; Y19-I68 HydrophobicContact CE1-CD1 4.33Å; Y19-I68 HydrophobicContact CE2-CD1 3.46Å; Y19-I68 VanDerWaalsContact CE2-CD1 3.46Å; Y19-I68 HydrophobicContact CE2-CG1 4.4Å; Y19-I68 HydrophobicContact CG-CD1 4Å; I68-Q71 HydrophobicContact CG2-CB 4.33Å; I68-V85 HydrophobicContact CD1-CG1 3.89Å; I68-V85 HydrophobicContact CG2-CG1 3.97Å; I68-F99 HydrophobicContact CD1-CZ 4.01Å
69	T	98.2	Very high	97.1	Very high	100 Å²	100	77.7 Å²	77.7	61%	0.613	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.5	-44	176.6	-56.5	0	0	0	0	110.6	S67 V86	S67-T69 PolarHBondContact O-N 2.9Å; T69-V86 WeakPolarHBondContact CB-O 3.3Å; T69-V86 PolarHBondContact N-O 2.88Å
70	A	98.4	Very high	97.1	Very high	44 Å²	44	77.8 Å²	77.8	36%	0.364	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.2	149.7	177.3	0	0	0	0	0	110.2	V86	A70-V86 PolarHBondContact N-O 3.3Å; A70-V86 PolarHBondContact O-N 3.49Å; A70-V86 VanDerWaalsContact O-O 3.09Å
71	Q	98.7	Very high	97.3	Very high	69 Å²	69	71.9 Å²	71.9	32%	0.322	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	135.8	170.5	60.7	-173.7	-36.3	0	0	108.7	V15 I68 H73 M84 V85	V15-Q71 VanDerWaalsContact CB-OE1 3.26Å; I68-Q71 HydrophobicContact CG2-CB 4.33Å; Q71-H73 PolarHBondContact OE1-NE2 2.93Å; Q71-M84 CarbonylContact C-O 3.55Å; Q71-M84 VanDerWaalsContact CA-O 3.27Å; Q71-M84 WeakPolarHBondContact CA-O 3.47Å; Q71-V85 HydrophobicContact CB-CG2 4.36Å
72	D	98.7	Very high	97.5	Very high	94 Å²	94	73.8 Å²	73.8	50%	0.503	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	138.3	-179.9	-63.1	-65.4	0	0	0	109.1	S83 M84	D72-S83 CarbonylContact O-C 3.59Å; D72-S83 WeakPolarHBondContact O-CA 3.29Å; D72-M84 PolarHBondContact N-O 2.75Å; D72-M84 PolarHBondContact O-N 2.87Å
73	H	98.6	Very high	97.8	Very high	19 Å²	19	68 Å²	68	9%	0.088	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	133.1	-174.5	-52.2	-70.3	0	0	0	111.1	S12 Q71 L82 S83	S12-H73 PolarHBondContact N-NE2 3.06Å; S12-H73 PolarHBondContact OG-NE2 2.93Å; Q71-H73 PolarHBondContact OE1-NE2 2.93Å; H73-L82 CarbonylContact C-O 3.57Å; H73-L82 WeakPolarHBondContact CA-O 3.27Å; H73-S83 WeakPolarHBondContact ND1-CB 3.37Å; H73-S83 PolarHBondContact ND1-OG 3.07Å
74	Q	98.6	Very high	98	Very high	126 Å²	126	64.7 Å²	64.7	59%	0.589	37%	0.371	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-134.5	140	176.9	-67.9	-175	-6.2	0	0	111.2	I81 L82	Q74-I81 WeakPolarHBondContact O-CA 3.45Å; Q74-L82 PolarHBondContact N-O 3.39Å; Q74-L82 PolarHBondContact O-N 2.91Å
75	P	98.1	Very high	98	Very high	70 Å²	70	64 Å²	64	46%	0.455	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.7	143	165.9	32.1	-31.9	0	0	0	109.4	W7 C80	W7-P75 HydrophobicContact CB-CB 4.5Å; W7-P75 HydrophobicContact CD2-CB 4.36Å; W7-P75 HydrophobicContact CD2-CG 3.9Å; W7-P75 HydrophobicContact CE3-CB 4.34Å; W7-P75 HydrophobicContact CE3-CG 4Å; W7-P75 HydrophobicContact CG-CB 4.44Å; W7-P75 HydrophobicContact CG-CG 4.28Å; W7-P75 HydrophobicContact CZ3-CG 4.37Å; P75-C80 WeakPolarHBondContact CA-O 3.33Å
76	T	97.9	Very high	98.1	Very high	39 Å²	39	64.6 Å²	64.6	24%	0.239	37%	0.366	C	S	.	.			trans	-98.8	161.4	171.5	79.9	0	0	0	0	110.7	D78 N79 C80 L82	T76-D78 PolarHBondContact O-N 3Å; T76-D78 VanDerWaalsContact O-N 3.13Å; T76-D78 PolarHBondContact OG1-N 2.86Å; T76-N79 PolarHBondContact O-N 3.28Å; T76-C80 HydrophobicContact CG2-CB 4.14Å; T76-C80 PolarHBondContact N-O 2.81Å; T76-C80 VanDerWaalsContact OG1-CB 3.29Å; T76-C80 WeakPolarHBondContact OG1-CB 3.47Å; T76-C80 PolarHBondContact OG1-N 2.88Å; T76-L82 HydrophobicContact CG2-CB 4.22Å
77	P	96.6	Very high	98	Very high	130 Å²	130	63.5 Å²	63.5	84%	0.844	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.3	-26.2	175	-27.2	36.4	0	0	0	114.6	N79	P77-N79 VanDerWaalsContact C-N 3.32Å; P77-N79 PolarHBondContact O-N 3.13Å
78	D	95.2	Very high	98	Very high	131 Å²	131	64.6 Å²	64.6	70%	0.701	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.2	27.3	-176.7	-61.5	-45	0	0	0	113.2	T76 C80	T76-D78 PolarHBondContact O-N 3Å; T76-D78 VanDerWaalsContact O-N 3.13Å; T76-D78 PolarHBondContact OG1-N 2.86Å; D78-C80 PolarHBondContact O-N 3.05Å; D78-C80 VanDerWaalsContact O-N 3.16Å; D78-C80 PolarHBondContact O-SG 2.77Å
79	N	94.1	Very high	98	Very high	136 Å²	136	62.2 Å²	62.2	73%	0.727	35%	0.347	S	S	*	.	S	Bend	trans	54.4	32	-177.7	-62.6	-36.1	0	0	0	113.8	T76 P77	T76-N79 PolarHBondContact O-N 3.28Å; P77-N79 VanDerWaalsContact C-N 3.32Å; P77-N79 PolarHBondContact O-N 3.13Å
80	C	98.3	Very high	98	Very high	14 Å²	14	61.2 Å²	61.2	10%	0.095	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	168.7	169.7	-56.5	0	0	0	0	109.8	P75 T76 D78 I104 L105	P75-C80 WeakPolarHBondContact CA-O 3.33Å; T76-C80 HydrophobicContact CG2-CB 4.14Å; T76-C80 PolarHBondContact N-O 2.81Å; T76-C80 VanDerWaalsContact OG1-CB 3.29Å; T76-C80 WeakPolarHBondContact OG1-CB 3.47Å; T76-C80 PolarHBondContact OG1-N 2.88Å; D78-C80 PolarHBondContact O-N 3.05Å; D78-C80 VanDerWaalsContact O-N 3.16Å; D78-C80 PolarHBondContact O-SG 2.77Å; C80-I104 HydrophobicContact CB-CG2 3.92Å; C80-L105 CarbonylContact C-O 3.55Å; C80-L105 WeakPolarHBondContact CA-O 3.44Å; C80-L105 WeakPolarHBondContact CB-O 3.25Å
81	I	98.7	Very high	97.9	Very high	6 Å²	6	59.4 Å²	59.4	3%	0.031	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	123.6	171.1	-61.5	168.3	0	0	0	107.8	W7 I10 Q74 I104 L105 W112	W7-I81 HydrophobicContact CB-CD1 4.06Å; W7-I81 HydrophobicContact CB-CG1 4.03Å; W7-I81 HydrophobicContact CB-CG2 4.49Å; I10-I81 HydrophobicContact CB-CD1 3.69Å; I10-I81 HydrophobicContact CD1-CD1 4.02Å; I10-I81 HydrophobicContact CG1-CD1 4.49Å; I10-I81 HydrophobicContact CG2-CD1 3.53Å; Q74-I81 WeakPolarHBondContact O-CA 3.45Å; I81-I104 WeakPolarHBondContact O-CA 3.19Å; I81-L105 HydrophobicContact CB-CB 4.23Å; I81-L105 HydrophobicContact CB-CD1 4.47Å; I81-L105 PolarHBondContact N-O 2.88Å; I81-L105 PolarHBondContact O-N 2.86Å; I81-W112 HydrophobicContact CD1-CE3 4.24Å; I81-W112 HydrophobicContact CD1-CH2 3.67Å; I81-W112 HydrophobicContact CD1-CZ2 4.05Å; I81-W112 HydrophobicContact CD1-CZ3 3.77Å; I81-W112 HydrophobicContact CG1-CH2 3.95Å; I81-W112 HydrophobicContact CG1-CZ3 3.91Å
82	L	98.8	Very high	97.8	Very high	67 Å²	67	58.7 Å²	58.7	35%	0.351	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.5	124.2	167.4	175.2	62.4	0	0	0	108.3	H73 Q74 T76 F103 I104	H73-L82 CarbonylContact C-O 3.57Å; H73-L82 WeakPolarHBondContact CA-O 3.27Å; Q74-L82 PolarHBondContact N-O 3.39Å; Q74-L82 PolarHBondContact O-N 2.91Å; T76-L82 HydrophobicContact CG2-CB 4.22Å; L82-F103 WeakPolarHBondContact CA-O 3.33Å; L82-I104 HydrophobicContact CD1-CG1 4.15Å
83	S	98.8	Very high	97.6	Very high	0 Å²	0	62.4 Å²	62.4	0%	0	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	125.4	173.2	-61.5	0	0	0	0	109.3	D72 H73 S102 F103	D72-S83 CarbonylContact O-C 3.59Å; D72-S83 WeakPolarHBondContact O-CA 3.29Å; H73-S83 WeakPolarHBondContact ND1-CB 3.37Å; H73-S83 PolarHBondContact ND1-OG 3.07Å; S83-S102 CarbonylContact O-C 3.58Å; S83-S102 VanDerWaalsContact O-CA 3.28Å; S83-S102 WeakPolarHBondContact O-CA 3.27Å; S83-F103 PolarHBondContact N-O 2.81Å; S83-F103 PolarHBondContact O-N 2.88Å
84	M	98.8	Very high	97.4	Very high	89 Å²	89	65.7 Å²	65.7	44%	0.438	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	134.3	171.2	-173.4	178.5	69.3	0	0	108.8	Q71 D72	Q71-M84 CarbonylContact C-O 3.55Å; Q71-M84 VanDerWaalsContact CA-O 3.27Å; Q71-M84 WeakPolarHBondContact CA-O 3.47Å; D72-M84 PolarHBondContact N-O 2.75Å; D72-M84 PolarHBondContact O-N 2.87Å
85	V	98.9	Very high	97.2	Very high	0 Å²	0	64.6 Å²	64.6	0%	0	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	132.9	-176	-176.9	0	0	0	0	109.2	V15 Y19 I68 Q71 F99 H100 Q101 F103	V15-V85 HydrophobicContact CG1-CG2 4.26Å; V15-V85 HydrophobicContact CG2-CG2 3.68Å; Y19-V85 HydrophobicContact CE2-CG1 4Å; Y19-V85 HydrophobicContact CE2-CG2 4.46Å; Y19-V85 WeakPolarHBondContact OH-CG1 3.4Å; I68-V85 HydrophobicContact CD1-CG1 3.89Å; I68-V85 HydrophobicContact CG2-CG1 3.97Å; Q71-V85 HydrophobicContact CB-CG2 4.36Å; V85-F99 HydrophobicContact CG1-CE2 4.16Å; V85-F99 HydrophobicContact CG1-CZ 4.22Å; V85-H100 WeakPolarHBondContact O-CA 3.32Å; V85-Q101 HydrophobicContact CB-CB 4.49Å; V85-Q101 PolarHBondContact N-O 2.95Å; V85-Q101 PolarHBondContact O-N 2.86Å; V85-F103 HydrophobicContact CG2-CD2 4.34Å; V85-F103 HydrophobicContact CG2-CE2 4.02Å
86	V	98.6	Very high	97.1	Very high	68 Å²	68	66.4 Å²	66.4	41%	0.412	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	132.9	168.7	177.8	0	0	0	0	107.9	T69 A70	T69-V86 WeakPolarHBondContact CB-O 3.3Å; T69-V86 PolarHBondContact N-O 2.88Å; A70-V86 PolarHBondContact N-O 3.3Å; A70-V86 PolarHBondContact O-N 3.49Å; A70-V86 VanDerWaalsContact O-O 3.09Å
87	G	98.3	Very high	97	Very high	3 Å²	3	67.2 Å²	67.2	3%	0.031	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.2	-168.7	-178.4	0	0	0	0	0	113.4	S67 G98 F99	S67-G87 VanDerWaalsContact O-CA 3.27Å; S67-G87 WeakPolarHBondContact O-CA 3.49Å; G87-G98 CarbonylContact O-C 3.59Å; G87-G98 WeakPolarHBondContact O-CA 3.36Å; G87-F99 VanDerWaalsContact C-CD1 3.43Å; G87-F99 VanDerWaalsContact C-CE1 3.41Å; G87-F99 PolarHBondContact N-O 2.94Å; G87-F99 VanDerWaalsContact N-O 3.13Å; G87-F99 WeakPolarHBondContact O-CD1 3.28Å; G87-F99 PolarHBondContact O-N 2.97Å
88	Q	98.1	Very high	97.1	Very high	94 Å²	94	62.1 Å²	62.1	44%	0.439	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	149.6	173.2	-66.1	-178.6	-39.4	0	0	109.5	S67 I96 M97	S67-Q88 PolarHBondContact N-O 2.9Å; S67-Q88 PolarHBondContact O-N 3.32Å; Q88-I96 HydrophobicContact CB-CG2 3.77Å; Q88-I96 HydrophobicContact CG-CG2 4.17Å; Q88-M97 CarbonylContact C-O 3.59Å; Q88-M97 VanDerWaalsContact CA-O 3.25Å; Q88-M97 WeakPolarHBondContact CA-O 3.27Å
89	L	97.6	Very high	97.2	Very high	8 Å²	8	56 Å²	56	4%	0.042	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	153.6	172.5	63	82.2	0	0	0	110.9	I64 A65 I96 M97 F99 F119 L121	I64-L89 HydrophobicContact CD1-CD1 4.39Å; A65-L89 CarbonylContact O-C 3.51Å; A65-L89 VanDerWaalsContact O-CA 3.24Å; A65-L89 WeakPolarHBondContact O-CA 3.38Å; L89-I96 WeakPolarHBondContact O-CA 3.18Å; L89-M97 HydrophobicContact CD1-CB 4.35Å; L89-M97 HydrophobicContact CD1-CE 3.98Å; L89-M97 PolarHBondContact N-O 2.95Å; L89-M97 PolarHBondContact O-N 3.36Å; L89-F99 HydrophobicContact CB-CD1 4.13Å; L89-F99 HydrophobicContact CB-CE1 4.47Å; L89-F99 HydrophobicContact CD2-CB 3.93Å; L89-F99 HydrophobicContact CD2-CD1 3.82Å; L89-F99 HydrophobicContact CD2-CG 3.96Å; L89-F99 HydrophobicContact CG-CD1 4.11Å; L89-F119 HydrophobicContact CD2-CE2 4Å; L89-F119 HydrophobicContact CD2-CZ 3.78Å; L89-L121 HydrophobicContact CD1-CD2 4.23Å; L89-L121 HydrophobicContact CD2-CD2 3.89Å; L89-L121 HydrophobicContact CG-CD2 4.31Å
90	K	97.8	Very high	97.5	Very high	78 Å²	78	53.1 Å²	53.1	34%	0.339	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	116.8	170	-177.5	174.3	172.3	65.4	0	108.4	I64 A65 D92 D94 I96	I64-K90 CarbonylContact C-O 3.59Å; I64-K90 VanDerWaalsContact CA-O 3.32Å; I64-K90 WeakPolarHBondContact CA-O 3.16Å; A65-K90 PolarHBondContact N-O 2.79Å; A65-K90 PolarHBondContact O-N 3.35Å; K90-D92 VanDerWaalsContact CE-O 3.26Å; K90-D92 WeakPolarHBondContact CE-O 3.48Å; K90-D94 PolarHBondContact NZ-O 3.05Å; K90-I96 HydrophobicContact CB-CG1 4.35Å; K90-I96 HydrophobicContact CD-CG1 4.44Å
91	A	96.9	Very high	97.5	Very high	6 Å²	6	52.5 Å²	52.5	5%	0.05	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	124.1	172.3	0	0	0	0	0	108.7	F61 K63 I64 E93 D94	F61-A91 HydrophobicContact CB-CB 4.02Å; F61-A91 HydrophobicContact CD1-CB 4.27Å; F61-A91 HydrophobicContact CG-CB 4.19Å; K63-A91 WeakPolarHBondContact O-CA 3.35Å; I64-A91 HydrophobicContact CD1-CB 4.45Å; I64-A91 HydrophobicContact CG1-CB 4.47Å; A91-E93 PolarHBondContact O-N 2.74Å; A91-D94 VanDerWaalsContact O-CB 3.24Å; A91-D94 WeakPolarHBondContact O-CB 3.28Å; A91-D94 PolarHBondContact O-N 2.95Å
92	D	96.6	Very high	97.5	Very high	55 Å²	55	53.5 Å²	53.5	29%	0.294	28%	0.284	S	S	.	.	T	Hydrogen-bonded Turn	trans	43.5	-123	-178.1	-62.7	-39.6	0	0	0	112.9	F61 T62 K63 K90	F61-D92 WeakPolarHBondContact CA-OD2 3.39Å; F61-D92 WeakPolarHBondContact CB-OD2 3.44Å; T62-D92 WeakPolarHBondContact CB-OD1 3.31Å; T62-D92 PolarHBondContact N-OD1 3.45Å; T62-D92 PolarHBondContact N-OD2 2.89Å; K63-D92 PolarHBondContact N-OD1 2.85Å; K63-D92 PolarHBondContact O-N 3.13Å; K90-D92 VanDerWaalsContact CE-O 3.26Å; K90-D92 WeakPolarHBondContact CE-O 3.48Å
93	E	94.8	Very high	97.5	Very high	172 Å²	172	50.3 Å²	50.3	80%	0.804	27%	0.267	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95	3.1	178.3	-62.2	-55	145.1	0	0	113.4	A91	A91-E93 PolarHBondContact O-N 2.74Å
94	D	93.4	Very high	97.5	Very high	88 Å²	88	53 Å²	53	47%	0.471	28%	0.281	S	S	.	.	S	Bend	trans	-63.8	157.7	-179.3	-67.2	-23.9	0	0	0	111.6	K90 A91	K90-D94 PolarHBondContact NZ-O 3.05Å; A91-D94 VanDerWaalsContact O-CB 3.24Å; A91-D94 WeakPolarHBondContact O-CB 3.28Å; A91-D94 PolarHBondContact O-N 2.95Å
95	P	94.8	Very high	97.5	Very high	102 Å²	102	48.8 Å²	48.8	66%	0.662	26%	0.26	S	S	*	.	P	Polyproline II helix	trans	-55.4	150.9	171.9	-24.4	34.7	0	0	0	112	M97	P95-M97 PolarHBondContact O-N 3.32Å
96	I	96.4	Very high	97.5	Very high	108 Å²	108	53.4 Å²	53.4	55%	0.554	28%	0.28	S	S	*	.	P	Polyproline II helix	trans	-64.1	127.1	171.4	-62.6	174.5	0	0	0	108.1	Q88 L89 K90	Q88-I96 HydrophobicContact CB-CG2 3.77Å; Q88-I96 HydrophobicContact CG-CG2 4.17Å; L89-I96 WeakPolarHBondContact O-CA 3.18Å; K90-I96 HydrophobicContact CB-CG1 4.35Å; K90-I96 HydrophobicContact CD-CG1 4.44Å
97	M	96.6	Very high	97.4	Very high	56 Å²	56	53 Å²	53	28%	0.276	28%	0.276	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	140.8	178.1	-67.1	-176.3	-74.1	0	0	110	Q88 L89 P95 L121	Q88-M97 CarbonylContact C-O 3.59Å; Q88-M97 VanDerWaalsContact CA-O 3.25Å; Q88-M97 WeakPolarHBondContact CA-O 3.27Å; L89-M97 HydrophobicContact CD1-CB 4.35Å; L89-M97 HydrophobicContact CD1-CE 3.98Å; L89-M97 PolarHBondContact N-O 2.95Å; L89-M97 PolarHBondContact O-N 3.36Å; P95-M97 PolarHBondContact O-N 3.32Å; M97-L121 HydrophobicContact CB-CD2 4.17Å; M97-L121 HydrophobicContact CE-CD1 4.17Å; M97-L121 HydrophobicContact CE-CD2 4.29Å; M97-L121 HydrophobicContact SD-CD1 4Å; M97-L121 HydrophobicContact SD-CD2 4.4Å
98	G	97.7	Very high	97.3	Very high	24 Å²	24	55.8 Å²	55.8	25%	0.247	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.7	154.3	165.7	0	0	0	0	0	110.3	G87 A122	G87-G98 CarbonylContact O-C 3.59Å; G87-G98 WeakPolarHBondContact O-CA 3.36Å; G98-A122 WeakPolarHBondContact O-CB 3.34Å; G98-A122 PolarHBondContact O-N 2.82Å
99	F	98.4	Very high	97.1	Very high	2 Å²	2	58.7 Å²	58.7	1%	0.009	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.4	160.6	172.1	78.2	-87.6	0	0	0	110.7	Y19 H66 I68 V85 G87 L89 Q101 F119 R120 L121	Y19-F99 HydrophobicContact CE1-CE2 4.01Å; Y19-F99 AromaticContact CE1-CZ 3.84Å; Y19-F99 HydrophobicContact CE1-CZ 3.84Å; Y19-F99 AromaticContact CZ-CE2 3.86Å; Y19-F99 AromaticContact CZ-CZ 3.85Å; Y19-F99 WeakPolarHBondContact OH-CE2 3.49Å; H66-F99 AromaticContact CD2-CE1 3.69Å; H66-F99 AromaticContact CD2-CZ 3.89Å; I68-F99 HydrophobicContact CD1-CZ 4.01Å; V85-F99 HydrophobicContact CG1-CE2 4.16Å; V85-F99 HydrophobicContact CG1-CZ 4.22Å; G87-F99 VanDerWaalsContact C-CD1 3.43Å; G87-F99 VanDerWaalsContact C-CE1 3.41Å; G87-F99 PolarHBondContact N-O 2.94Å; G87-F99 VanDerWaalsContact N-O 3.13Å; G87-F99 WeakPolarHBondContact O-CD1 3.28Å; G87-F99 PolarHBondContact O-N 2.97Å; L89-F99 HydrophobicContact CB-CD1 4.13Å; L89-F99 HydrophobicContact CB-CE1 4.47Å; L89-F99 HydrophobicContact CD2-CB 3.93Å; L89-F99 HydrophobicContact CD2-CD1 3.82Å; L89-F99 HydrophobicContact CD2-CG 3.96Å; L89-F99 HydrophobicContact CG-CD1 4.11Å; F99-Q101 HydrophobicContact CD2-CB 4.26Å; F99-Q101 HydrophobicContact CE2-CB 4.1Å; F99-F119 HydrophobicContact CB-CE2 3.83Å; F99-F119 HydrophobicContact CB-CZ 4.04Å; F99-F119 HydrophobicContact CD2-CD2 4.19Å; F99-F119 AromaticContact CD2-CE2 3.74Å; F99-F119 HydrophobicContact CD2-CE2 3.74Å; F99-F119 AromaticContact CG-CE2 3.95Å; F99-F119 HydrophobicContact CG-CE2 3.95Å; F99-R120 WeakPolarHBondContact CA-O 3.39Å; F99-L121 HydrophobicContact CB-CD2 4.26Å
100	H	98.4	Very high	96.8	Very high	76 Å²	76	65.8 Å²	65.8	35%	0.352	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	141.6	166.3	52.6	-82.5	0	0	0	109.7	V85 R120	V85-H100 WeakPolarHBondContact O-CA 3.32Å; H100-R120 VanDerWaalsContact CE1-CB 3.48Å; H100-R120 WeakPolarHBondContact CE1-CB 3.43Å; H100-R120 VanDerWaalsContact CE1-CD 3.44Å; H100-R120 WeakPolarHBondContact CE1-CD 3.44Å; H100-R120 WeakPolarHBondContact CE1-CG 3.36Å; H100-R120 PolarHBondContact CE1-O 2.97Å; H100-R120 PolarHBondContact N-O 2.9Å; H100-R120 PolarHBondContact ND1-O 3.2Å; H100-R120 VanDerWaalsContact NE2-CB 3.28Å; H100-R120 WeakPolarHBondContact NE2-CB 3.34Å; H100-R120 WeakPolarHBondContact NE2-CD 3.45Å; H100-R120 PolarHBondContact O-N 2.85Å
101	Q	98.8	Very high	96.7	Very high	1 Å²	1	64.4 Å²	64.4	1%	0.005	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	144.3	174.8	-159.5	165.6	4.2	0	0	110.7	Y18 Y19 V85 F99 F103 D117 M118 F119	Y18-Q101 PolarHBondContact OH-NE2 3.32Å; Y19-Q101 WeakPolarHBondContact OH-CB 3.42Å; Y19-Q101 PolarHBondContact OH-OE1 3.37Å; V85-Q101 HydrophobicContact CB-CB 4.49Å; V85-Q101 PolarHBondContact N-O 2.95Å; V85-Q101 PolarHBondContact O-N 2.86Å; F99-Q101 HydrophobicContact CD2-CB 4.26Å; F99-Q101 HydrophobicContact CE2-CB 4.1Å; Q101-F103 HydrophobicContact CB-CE2 4.26Å; Q101-F103 HydrophobicContact CB-CZ 4.28Å; Q101-F103 HydrophobicContact CG-CE1 3.96Å; Q101-F103 HydrophobicContact CG-CE2 3.91Å; Q101-F103 HydrophobicContact CG-CZ 3.53Å; Q101-F103 VanDerWaalsContact NE2-CE1 3.32Å; Q101-D117 PolarHBondContact NE2-OD1 3.41Å; Q101-D117 PolarHBondContact NE2-OD2 3.16Å; Q101-M118 CarbonylContact C-O 3.5Å; Q101-M118 WeakPolarHBondContact CA-O 3.18Å; Q101-M118 WeakPolarHBondContact CG-O 3.29Å; Q101-F119 HydrophobicContact CB-CD2 4.33Å; Q101-F119 HydrophobicContact CG-CB 4.12Å; Q101-F119 HydrophobicContact CG-CD2 4.25Å
102	S	98.8	Very high	96.7	Very high	27 Å²	27	68.2 Å²	68.2	19%	0.189	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.6	135.9	175.7	-63	0	0	0	0	110.6	S83 D117 M118	S83-S102 CarbonylContact O-C 3.58Å; S83-S102 VanDerWaalsContact O-CA 3.28Å; S83-S102 WeakPolarHBondContact O-CA 3.27Å; S102-D117 CarbonylContact O-C 3.5Å; S102-D117 WeakPolarHBondContact O-CA 3.27Å; S102-M118 PolarHBondContact N-O 3.21Å; S102-M118 PolarHBondContact O-N 3.39Å
103	F	98.9	Very high	96.8	Very high	0 Å²	0	66.3 Å²	66.3	0%	0	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	140.1	179.9	-52.6	-81.3	0	0	0	110.7	F14 V15 Y18 L82 S83 V85 Q101 L105 N116 D117	F14-F103 HydrophobicContact CE1-CB 4.14Å; F14-F103 AromaticContact CE1-CD1 3.82Å; F14-F103 HydrophobicContact CE1-CD1 3.82Å; F14-F103 HydrophobicContact CE1-CD2 4.15Å; F14-F103 HydrophobicContact CE1-CE1 4.17Å; F14-F103 HydrophobicContact CE1-CE2 4.49Å; F14-F103 AromaticContact CE1-CG 3.77Å; F14-F103 HydrophobicContact CE1-CG 3.77Å; F14-F103 HydrophobicContact CE1-CZ 4.48Å; F14-F103 HydrophobicContact CZ-CD1 4.33Å; V15-F103 HydrophobicContact CG2-CD2 4.5Å; V15-F103 HydrophobicContact CG2-CE2 4.47Å; Y18-F103 HydrophobicContact CD1-CE1 4.32Å; Y18-F103 AromaticContact CD1-CZ 3.75Å; Y18-F103 HydrophobicContact CD1-CZ 3.75Å; Y18-F103 AromaticContact CD2-CE1 3.84Å; Y18-F103 HydrophobicContact CD2-CE1 3.84Å; Y18-F103 HydrophobicContact CD2-CZ 4.06Å; Y18-F103 HydrophobicContact CE1-CE1 4.19Å; Y18-F103 AromaticContact CE1-CZ 3.76Å; Y18-F103 HydrophobicContact CE1-CZ 3.76Å; Y18-F103 AromaticContact CE2-CE1 3.69Å; Y18-F103 HydrophobicContact CE2-CE1 3.69Å; Y18-F103 HydrophobicContact CE2-CZ 4.09Å; Y18-F103 HydrophobicContact CG-CE1 4.19Å; Y18-F103 AromaticContact CG-CZ 3.93Å; Y18-F103 HydrophobicContact CG-CZ 3.93Å; Y18-F103 AromaticContact CZ-CE1 3.89Å; Y18-F103 AromaticContact CZ-CZ 3.96Å; L82-F103 WeakPolarHBondContact CA-O 3.33Å; S83-F103 PolarHBondContact N-O 2.81Å; S83-F103 PolarHBondContact O-N 2.88Å; V85-F103 HydrophobicContact CG2-CD2 4.34Å; V85-F103 HydrophobicContact CG2-CE2 4.02Å; Q101-F103 HydrophobicContact CB-CE2 4.26Å; Q101-F103 HydrophobicContact CB-CZ 4.28Å; Q101-F103 HydrophobicContact CG-CE1 3.96Å; Q101-F103 HydrophobicContact CG-CE2 3.91Å; Q101-F103 HydrophobicContact CG-CZ 3.53Å; Q101-F103 VanDerWaalsContact NE2-CE1 3.32Å; F103-L105 HydrophobicContact CB-CD2 4.13Å; F103-N116 CarbonylContact C-O 3.57Å; F103-N116 VanDerWaalsContact CA-O 3.27Å; F103-N116 WeakPolarHBondContact CA-O 3.42Å; F103-D117 HydrophobicContact CD1-CB 4.27Å
104	I	98.8	Very high	97	Very high	56 Å²	56	58.1 Å²	58.1	29%	0.287	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	121.2	161.8	-59.3	179.4	0	0	0	107.6	C80 I81 L82 C114 T115 N116	C80-I104 HydrophobicContact CB-CG2 3.92Å; I81-I104 WeakPolarHBondContact O-CA 3.19Å; L82-I104 HydrophobicContact CD1-CG1 4.15Å; I104-C114 WeakPolarHBondContact O-CA 3.49Å; I104-T115 PolarHBondContact O-N 3.45Å; I104-T115 PolarHBondContact O-OG1 2.8Å; I104-N116 HydrophobicContact CB-CB 3.95Å; I104-N116 HydrophobicContact CD1-CB 3.99Å; I104-N116 HydrophobicContact CG1-CB 4.03Å; I104-N116 PolarHBondContact N-O 3.46Å
105	L	98.8	Very high	97.3	Very high	0 Å²	0	55 Å²	55	0%	0	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	135.7	178	-46.2	-179.8	0	0	0	109.6	F14 C80 I81 F103 W112 V113 C114	F14-L105 HydrophobicContact CB-CD1 3.61Å; F14-L105 HydrophobicContact CD1-CD1 3.94Å; F14-L105 HydrophobicContact CD1-CD2 3.63Å; F14-L105 HydrophobicContact CD1-CG 4.37Å; F14-L105 HydrophobicContact CD2-CD1 4.08Å; F14-L105 HydrophobicContact CD2-CD2 3.63Å; F14-L105 HydrophobicContact CE1-CD2 3.6Å; F14-L105 HydrophobicContact CE2-CD2 3.57Å; F14-L105 HydrophobicContact CG-CD1 3.58Å; F14-L105 HydrophobicContact CG-CD2 3.66Å; F14-L105 HydrophobicContact CG-CG 4.28Å; F14-L105 HydrophobicContact CZ-CD2 3.56Å; C80-L105 CarbonylContact C-O 3.55Å; C80-L105 WeakPolarHBondContact CA-O 3.44Å; C80-L105 WeakPolarHBondContact CB-O 3.25Å; I81-L105 HydrophobicContact CB-CB 4.23Å; I81-L105 HydrophobicContact CB-CD1 4.47Å; I81-L105 PolarHBondContact N-O 2.88Å; I81-L105 PolarHBondContact O-N 2.86Å; F103-L105 HydrophobicContact CB-CD2 4.13Å; L105-W112 HydrophobicContact CB-CE3 3.89Å; L105-W112 HydrophobicContact CB-CZ3 4.39Å; L105-V113 CarbonylContact C-O 3.43Å; L105-V113 VanDerWaalsContact CA-O 3.3Å; L105-V113 WeakPolarHBondContact CA-O 3.46Å; L105-C114 HydrophobicContact CD2-CB 4.23Å
106	K	98.4	Very high	97.4	Very high	98 Å²	98	53.2 Å²	53.2	43%	0.426	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	138.2	175.6	-171.8	170.1	-177	171.9	0	109.6	I108 V113 T115	K106-I108 HydrophobicContact CD-CD1 4.45Å; K106-I108 HydrophobicContact CD-CG1 4.38Å; K106-I108 HydrophobicContact CG-CG1 4.1Å; K106-V113 PolarHBondContact N-O 3.38Å; K106-V113 WeakPolarHBondContact O-CG2 3.36Å; K106-V113 PolarHBondContact O-N 2.86Å; K106-T115 HydrophobicContact CB-CG2 3.7Å; K106-T115 HydrophobicContact CD-CG2 4.37Å
107	N	97.4	Very high	97.6	Very high	60 Å²	60	48.1 Å²	48.1	32%	0.321	26%	0.258	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.5	121.2	170.5	-167	-69.2	0	0	0	109.5	D110 A111 W112	N107-D110 WeakPolarHBondContact OD1-CA 3.43Å; N107-D110 PolarHBondContact OD1-N 2.76Å; N107-A111 CarbonylContact C-O 3.57Å; N107-A111 WeakPolarHBondContact CA-O 3.17Å; N107-W112 HydrophobicContact CB-CD2 4.03Å; N107-W112 HydrophobicContact CB-CE3 4.1Å; N107-W112 HydrophobicContact CB-CH2 4.04Å; N107-W112 HydrophobicContact CB-CZ2 3.96Å; N107-W112 HydrophobicContact CB-CZ3 4.11Å; N107-W112 PolarHBondContact ND2-NE1 2.88Å
108	I	95.6	Very high	97.7	Very high	60 Å²	60	50.6 Å²	50.6	31%	0.308	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	120.4	176.7	-56.7	-177.8	0	0	0	107.2	I34 K106 D110 A111 V113	I34-I108 HydrophobicContact CD1-CD1 3.7Å; K106-I108 HydrophobicContact CD-CD1 4.45Å; K106-I108 HydrophobicContact CD-CG1 4.38Å; K106-I108 HydrophobicContact CG-CG1 4.1Å; I108-D110 VanDerWaalsContact C-N 3.31Å; I108-D110 PolarHBondContact O-N 3.02Å; I108-A111 PolarHBondContact N-O 2.9Å; I108-A111 PolarHBondContact O-N 3.43Å; I108-A111 VanDerWaalsContact O-N 3.11Å; I108-V113 HydrophobicContact CB-CG2 4.41Å; I108-V113 HydrophobicContact CD1-CG2 3.74Å; I108-V113 HydrophobicContact CG1-CG2 4.03Å
109	N	93.8	Very high	97.7	Very high	155 Å²	155	49.9 Å²	49.9	83%	0.829	26%	0.26	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.7	48.7	-178.1	-54.7	-35.2	0	0	0	112.4	A111	N109-A111 PolarHBondContact O-N 3.32Å; N109-A111 VanDerWaalsContact O-N 3.13Å
110	D	92.8	Very high	97.7	Very high	157 Å²	157	56 Å²	56	84%	0.84	28%	0.283	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.9	9.7	-179.3	-57.8	-45.9	0	0	0	115.7	N107 I108	N107-D110 WeakPolarHBondContact OD1-CA 3.43Å; N107-D110 PolarHBondContact OD1-N 2.76Å; I108-D110 VanDerWaalsContact C-N 3.31Å; I108-D110 PolarHBondContact O-N 3.02Å
111	A	94.8	Very high	97.6	Very high	50 Å²	50	54 Å²	54	41%	0.413	27%	0.274	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	134.8	175.1	0	0	0	0	0	111.5	N107 I108 N109	N107-A111 CarbonylContact C-O 3.57Å; N107-A111 WeakPolarHBondContact CA-O 3.17Å; I108-A111 PolarHBondContact N-O 2.9Å; I108-A111 PolarHBondContact O-N 3.43Å; I108-A111 VanDerWaalsContact O-N 3.11Å; N109-A111 PolarHBondContact O-N 3.32Å; N109-A111 VanDerWaalsContact O-N 3.13Å
112	W	97.6	Very high	97.3	Very high	85 Å²	85	56.2 Å²	56.2	32%	0.322	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	118.5	172.7	-72.2	97.8	0	0	0	110.3	I10 I81 L105 N107	I10-W112 HydrophobicContact CD1-CZ2 3.73Å; I10-W112 HydrophobicContact CG2-CB 4.49Å; I10-W112 HydrophobicContact CG2-CD2 3.8Å; I10-W112 HydrophobicContact CG2-CE3 4.41Å; I10-W112 HydrophobicContact CG2-CG 3.81Å; I81-W112 HydrophobicContact CD1-CE3 4.24Å; I81-W112 HydrophobicContact CD1-CH2 3.67Å; I81-W112 HydrophobicContact CD1-CZ2 4.05Å; I81-W112 HydrophobicContact CD1-CZ3 3.77Å; I81-W112 HydrophobicContact CG1-CH2 3.95Å; I81-W112 HydrophobicContact CG1-CZ3 3.91Å; L105-W112 HydrophobicContact CB-CE3 3.89Å; L105-W112 HydrophobicContact CB-CZ3 4.39Å; N107-W112 HydrophobicContact CB-CD2 4.03Å; N107-W112 HydrophobicContact CB-CE3 4.1Å; N107-W112 HydrophobicContact CB-CH2 4.04Å; N107-W112 HydrophobicContact CB-CZ2 3.96Å; N107-W112 HydrophobicContact CB-CZ3 4.11Å; N107-W112 PolarHBondContact ND2-NE1 2.88Å
113	V	98.3	Very high	96.7	Very high	16 Å²	16	59.9 Å²	59.9	10%	0.097	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	153.4	179.1	-62.9	0	0	0	0	110.9	I34 L105 K106 I108	I34-V113 HydrophobicContact CD1-CG2 4.24Å; I34-V113 HydrophobicContact CG2-CB 4.05Å; I34-V113 HydrophobicContact CG2-CG1 4.03Å; I34-V113 HydrophobicContact CG2-CG2 3.96Å; L105-V113 CarbonylContact C-O 3.43Å; L105-V113 VanDerWaalsContact CA-O 3.3Å; L105-V113 WeakPolarHBondContact CA-O 3.46Å; K106-V113 PolarHBondContact N-O 3.38Å; K106-V113 WeakPolarHBondContact O-CG2 3.36Å; K106-V113 PolarHBondContact O-N 2.86Å; I108-V113 HydrophobicContact CB-CG2 4.41Å; I108-V113 HydrophobicContact CD1-CG2 3.74Å; I108-V113 HydrophobicContact CG1-CG2 4.03Å
114	C	98.7	Very high	95.5	Very high	0 Å²	0	67.7 Å²	67.7	0%	0	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.6	114.7	176.7	-176	0	0	0	0	110.6	F14 I32 Y33 S37 I104 L105 N116	F14-C114 HydrophobicContact CE2-CB 4.06Å; F14-C114 HydrophobicContact CZ-CB 3.72Å; I32-C114 PolarHBondContact O-N 3.48Å; Y33-C114 HydrophobicContact CD1-CB 3.92Å; Y33-C114 HydrophobicContact CE1-CB 3.94Å; S37-C114 WeakPolarHBondContact CB-O 3.47Å; S37-C114 PolarHBondContact OG-O 2.67Å; I104-C114 WeakPolarHBondContact O-CA 3.49Å; L105-C114 HydrophobicContact CD2-CB 4.23Å; C114-N116 PolarHBondContact SG-O 2.9Å
115	T	98.7	Very high	93.7	Very high	22 Å²	22	72.2 Å²	72.2	14%	0.135	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	-31.1	177.1	61.1	0	0	0	0	112.3	I34 S37 C38 I104 K106	I34-T115 HydrophobicContact CD1-CG2 4.3Å; S37-T115 CarbonylContact C-O 3.58Å; S37-T115 VanDerWaalsContact CA-O 3.29Å; S37-T115 WeakPolarHBondContact CA-O 3.33Å; C38-T115 PolarHBondContact N-O 3.15Å; I104-T115 PolarHBondContact O-N 3.45Å; I104-T115 PolarHBondContact O-OG1 2.8Å; K106-T115 HydrophobicContact CB-CG2 3.7Å; K106-T115 HydrophobicContact CD-CG2 4.37Å
116	N	98.9	Very high	91.6	Very high	65 Å²	65	81.5 Å²	81.5	35%	0.348	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	134.3	-179.7	-58	79.6	0	0	0	109.8	C38 F103 I104 C114	C38-N116 CarbonylContact O-C 3.53Å; C38-N116 WeakPolarHBondContact O-CA 3.38Å; F103-N116 CarbonylContact C-O 3.57Å; F103-N116 VanDerWaalsContact CA-O 3.27Å; F103-N116 WeakPolarHBondContact CA-O 3.42Å; I104-N116 HydrophobicContact CB-CB 3.95Å; I104-N116 HydrophobicContact CD1-CB 3.99Å; I104-N116 HydrophobicContact CG1-CB 4.03Å; I104-N116 PolarHBondContact N-O 3.46Å; C114-N116 PolarHBondContact SG-O 2.9Å
117	D	98.9	Very high	89	Confident	1 Å²	1	84 Å²	84	1%	0.005	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	129.2	179.5	-173.8	-13.6	0	0	0	108.8	Y33 C38 L39 T40 Q101 S102 F103	Y33-D117 HydrophobicContact CE1-CB 4.16Å; Y33-D117 PolarHBondContact OH-OD2 3.28Å; C38-D117 PolarHBondContact O-N 2.97Å; L39-D117 CarbonylContact C-O 3.52Å; L39-D117 VanDerWaalsContact CA-O 3.28Å; L39-D117 WeakPolarHBondContact CA-O 3.48Å; L39-D117 HydrophobicContact CD1-CB 3.82Å; T40-D117 PolarHBondContact N-O 2.95Å; Q101-D117 PolarHBondContact NE2-OD1 3.41Å; Q101-D117 PolarHBondContact NE2-OD2 3.16Å; S102-D117 CarbonylContact O-C 3.5Å; S102-D117 WeakPolarHBondContact O-CA 3.27Å; F103-D117 HydrophobicContact CD1-CB 4.27Å
118	M	98.9	Very high	88.6	Confident	108 Å²	108	85.3 Å²	85.3	53%	0.532	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.8	117.8	174.8	-65	-174.3	-69.9	0	0	109.5	T40 Q101 S102	T40-M118 WeakPolarHBondContact O-CA 3.16Å; Q101-M118 CarbonylContact C-O 3.5Å; Q101-M118 WeakPolarHBondContact CA-O 3.18Å; Q101-M118 WeakPolarHBondContact CG-O 3.29Å; S102-M118 PolarHBondContact N-O 3.21Å; S102-M118 PolarHBondContact O-N 3.39Å
119	F	98.8	Very high	88.3	Confident	8 Å²	8	86.6 Å²	86.6	4%	0.035	48%	0.481	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	138.1	178.4	174.7	-86.4	0	0	0	110.9	T40 W41 E42 L89 F99 Q101 L121	T40-F119 PolarHBondContact O-N 3.3Å; W41-F119 HydrophobicContact CD2-CB 4.28Å; W41-F119 AromaticContact CD2-CD1 3.69Å; W41-F119 HydrophobicContact CD2-CD1 3.69Å; W41-F119 HydrophobicContact CD2-CE1 4.39Å; W41-F119 HydrophobicContact CD2-CG 4.18Å; W41-F119 AromaticContact CE2-CD1 3.63Å; W41-F119 AromaticContact CE2-CE1 3.86Å; W41-F119 HydrophobicContact CE3-CB 3.64Å; W41-F119 AromaticContact CE3-CD1 3.71Å; W41-F119 HydrophobicContact CE3-CD1 3.71Å; W41-F119 AromaticContact CE3-CG 3.71Å; W41-F119 HydrophobicContact CE3-CG 3.71Å; W41-F119 HydrophobicContact CG-CD1 4.4Å; W41-F119 AromaticContact CH2-CD1 3.63Å; W41-F119 HydrophobicContact CH2-CD1 3.63Å; W41-F119 HydrophobicContact CH2-CD2 4.02Å; W41-F119 AromaticContact CH2-CE1 3.71Å; W41-F119 HydrophobicContact CH2-CE1 3.71Å; W41-F119 HydrophobicContact CH2-CE2 4.07Å; W41-F119 AromaticContact CH2-CG 3.8Å; W41-F119 HydrophobicContact CH2-CG 3.8Å; W41-F119 AromaticContact CH2-CZ 3.93Å; W41-F119 HydrophobicContact CH2-CZ 3.93Å; W41-F119 AromaticContact CZ2-CD1 3.62Å; W41-F119 HydrophobicContact CZ2-CD1 3.62Å; W41-F119 AromaticContact CZ2-CE1 3.51Å; W41-F119 HydrophobicContact CZ2-CE1 3.51Å; W41-F119 HydrophobicContact CZ2-CG 4.27Å; W41-F119 HydrophobicContact CZ2-CZ 4.06Å; W41-F119 HydrophobicContact CZ3-CB 3.81Å; W41-F119 AromaticContact CZ3-CD1 3.68Å; W41-F119 HydrophobicContact CZ3-CD1 3.68Å; W41-F119 AromaticContact CZ3-CD2 3.92Å; W41-F119 HydrophobicContact CZ3-CD2 3.92Å; W41-F119 HydrophobicContact CZ3-CE1 4.25Å; W41-F119 HydrophobicContact CZ3-CE2 4.43Å; W41-F119 AromaticContact CZ3-CG 3.5Å; W41-F119 HydrophobicContact CZ3-CG 3.5Å; E42-F119 PolarHBondContact N-O 2.85Å; L89-F119 HydrophobicContact CD2-CE2 4Å; L89-F119 HydrophobicContact CD2-CZ 3.78Å; F99-F119 HydrophobicContact CB-CE2 3.83Å; F99-F119 HydrophobicContact CB-CZ 4.04Å; F99-F119 HydrophobicContact CD2-CD2 4.19Å; F99-F119 AromaticContact CD2-CE2 3.74Å; F99-F119 HydrophobicContact CD2-CE2 3.74Å; F99-F119 AromaticContact CG-CE2 3.95Å; F99-F119 HydrophobicContact CG-CE2 3.95Å; Q101-F119 HydrophobicContact CB-CD2 4.33Å; Q101-F119 HydrophobicContact CG-CB 4.12Å; Q101-F119 HydrophobicContact CG-CD2 4.25Å; F119-L121 HydrophobicContact CE1-CD2 4.22Å; F119-L121 HydrophobicContact CE1-CG 4.05Å; F119-L121 HydrophobicContact CZ-CD2 3.83Å; F119-L121 HydrophobicContact CZ-CG 4.17Å
120	R	98.1	Very high	88	Confident	131 Å²	131	82.8 Å²	82.8	49%	0.494	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.3	142.3	166.9	168.9	-171.2	-55.8	-172.5	-0	111.9	E42 F99 H100	E42-R120 VanDerWaalsContact OE1-CA 3.3Å; E42-R120 WeakPolarHBondContact OE1-CA 3.49Å; F99-R120 WeakPolarHBondContact CA-O 3.39Å; H100-R120 VanDerWaalsContact CE1-CB 3.48Å; H100-R120 WeakPolarHBondContact CE1-CB 3.43Å; H100-R120 VanDerWaalsContact CE1-CD 3.44Å; H100-R120 WeakPolarHBondContact CE1-CD 3.44Å; H100-R120 WeakPolarHBondContact CE1-CG 3.36Å; H100-R120 PolarHBondContact CE1-O 2.97Å; H100-R120 PolarHBondContact N-O 2.9Å; H100-R120 PolarHBondContact ND1-O 3.2Å; H100-R120 VanDerWaalsContact NE2-CB 3.28Å; H100-R120 WeakPolarHBondContact NE2-CB 3.34Å; H100-R120 WeakPolarHBondContact NE2-CD 3.45Å; H100-R120 PolarHBondContact O-N 2.85Å
121	L	97	Very high	87.7	Confident	34 Å²	34	78.4 Å²	78.4	18%	0.178	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.4	141.4	172.9	-68.1	172.9	0	0	0	110.3	E42 L89 M97 F99 F119 I123	E42-L121 WeakPolarHBondContact OE1-CB 3.3Å; E42-L121 WeakPolarHBondContact OE1-CG 3.42Å; E42-L121 PolarHBondContact OE1-N 2.91Å; L89-L121 HydrophobicContact CD1-CD2 4.23Å; L89-L121 HydrophobicContact CD2-CD2 3.89Å; L89-L121 HydrophobicContact CG-CD2 4.31Å; M97-L121 HydrophobicContact CB-CD2 4.17Å; M97-L121 HydrophobicContact CE-CD1 4.17Å; M97-L121 HydrophobicContact CE-CD2 4.29Å; M97-L121 HydrophobicContact SD-CD1 4Å; M97-L121 HydrophobicContact SD-CD2 4.4Å; F99-L121 HydrophobicContact CB-CD2 4.26Å; F119-L121 HydrophobicContact CE1-CD2 4.22Å; F119-L121 HydrophobicContact CE1-CG 4.05Å; F119-L121 HydrophobicContact CZ-CD2 3.83Å; F119-L121 HydrophobicContact CZ-CG 4.17Å; L121-I123 HydrophobicContact CB-CG2 4.18Å; L121-I123 PolarHBondContact O-N 3.49Å
122	A	92.3	Very high	87.2	Confident	47 Å²	47	80.2 Å²	80.2	39%	0.388	44%	0.441	S	S	.	.			trans	-79.6	65.1	173.3	0	0	0	0	0	110	G98	G98-A122 WeakPolarHBondContact O-CB 3.34Å; G98-A122 PolarHBondContact O-N 2.82Å
123	I	85.3	Confident	86.5	Confident	104 Å²	104	79.9 Å²	79.9	53%	0.533	45%	0.449	S	S	.	.			trans	-90.3	127.1	171.1	53.6	173.7	0	0	0	109.3	L121	L121-I123 HydrophobicContact CB-CG2 4.18Å; L121-I123 PolarHBondContact O-N 3.49Å
124	H	73.3	Confident	85.7	Confident	165 Å²	165	84.4 Å²	84.4	76%	0.764	47%	0.474	S	S	*	.			trans	-91.1	130.2	172.8	-64.3	-68.7	0	0	0	109	F126	H124-F126 PolarHBondContact O-N 3.13Å
125	N	62.7	Low	84.7	Confident	150 Å²	150	90.9 Å²	90.9	80%	0.802	51%	0.511	S	S	*	.	S	Bend	trans	-72.8	10.9	176	-68.4	-26.6	0	0	0	113.7
126	F	52.8	Low	83.5	Confident	195 Å²	195	96.7 Å²	96.7	86%	0.855	54%	0.542	S	S	*	.			trans	-118.5	102.2	-177.6	-61.6	-72.9	0	0	0	109.8	H124	H124-F126 PolarHBondContact O-N 3.13Å
127	G	45.7	Very low	82.1	Confident	152 Å²	152	99.5 Å²	99.5	100%	1.567	56%	0.56	S	S	*	*			trans	-139.7	0	163.7	0	0	0	0	0	108.3

Retrieved 127 of 127 residues in 82.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).