A0A087XPA3_POEFO Loading...

Eukaryotic translation initiation factor 4E binding protein 3, like

AlphaFold DB , UniProt , Accession A0A087XPA3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 114 aa.

						>A0A087XPA3_POEFO|A0A087XPA3
MSTGTKQVKSCPIPTKVLTLKDWSQLPDCYSQTPGGTLFSTTPGGTRIIYDRKFLLDCRNSPLARTPPCCLPQIPGVTVPATHAHHTGKLQDLKEEAEEEEKDIGDDSQFEMDI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.6	Very low	58.7	Low	239 Å²	239	148.3 Å²	148.3	100%	1.177	85%	0.847	S	S	*	*				0	97.2	0	-67.1	-72	-134.9	0	0	107.6
2	S	48.8	Very low	60	Low	127 Å²	127	146.1 Å²	146.1	89%	0.888	84%	0.842	S	S	*	*			trans	-89.8	112.3	-177.4	-172.3	0	0	0	0	109.3	G4	S2-G4 PolarHBondContact O-N 3.19Å
3	T	59	Low	61.4	Low	128 Å²	128	142.5 Å²	142.5	79%	0.785	82%	0.817	S	S	*	*			trans	-81.6	97.1	175.3	49.5	0	0	0	0	109	T5	T3-T5 PolarHBondContact O-N 3.26Å
4	G	49.3	Very low	62.8	Low	69 Å²	69	138.7 Å²	138.7	71%	0.711	80%	0.8	S	S	*	*			trans	-67.7	108.9	174.2	0	0	0	0	0	111.2	S2 K6	S2-G4 PolarHBondContact O-N 3.19Å; G4-K6 PolarHBondContact O-N 3.11Å; G4-K6 VanDerWaalsContact O-N 3.17Å
5	T	62.2	Low	63.9	Low	129 Å²	129	135 Å²	135	79%	0.791	78%	0.78	S	S	*	*			trans	-70.9	103.4	169.5	51.6	0	0	0	0	109	T3 Q7	T3-T5 PolarHBondContact O-N 3.26Å; T5-Q7 PolarHBondContact O-N 3.17Å; T5-Q7 VanDerWaalsContact O-N 3.11Å
6	K	61.3	Low	64.7	Low	198 Å²	198	134.2 Å²	134.2	86%	0.861	77%	0.765	S	S	*	*			trans	-67.8	106.9	170.1	-71.6	-173.7	177.7	-174.4	0	108.4	G4 V8	G4-K6 PolarHBondContact O-N 3.11Å; G4-K6 VanDerWaalsContact O-N 3.17Å; K6-V8 PolarHBondContact O-N 3.23Å
7	Q	60	Low	65.6	Low	180 Å²	180	131.4 Å²	131.4	84%	0.841	75%	0.75	S	S	*	*			trans	-62.1	106.1	167.2	-82.1	177.9	-3.8	0	0	108.8	T5 K9	T5-Q7 PolarHBondContact O-N 3.17Å; T5-Q7 VanDerWaalsContact O-N 3.11Å; Q7-K9 PolarHBondContact O-N 3.03Å
8	V	62.4	Low	65.9	Low	140 Å²	140	125.8 Å²	125.8	85%	0.848	72%	0.718	S	S	*	*			trans	-70.8	108.1	167.2	-98.5	0	0	0	0	107.7	K6 S10	K6-V8 PolarHBondContact O-N 3.23Å; V8-S10 PolarHBondContact O-N 3.2Å
9	K	66	Low	66.2	Low	192 Å²	192	124.9 Å²	124.9	84%	0.835	72%	0.715	S	S	*	*			trans	-66.9	113.3	168.7	-63.8	-176.8	-179.3	-178.5	0	107.2	Q7 C11	Q7-K9 PolarHBondContact O-N 3.03Å; K9-C11 PolarHBondContact O-N 3.21Å
10	S	66.1	Low	66.5	Low	115 Å²	115	119.7 Å²	119.7	80%	0.804	69%	0.685	S	S	*	*			trans	-68.9	111.5	175.3	57.5	0	0	0	0	109.1	V8	V8-S10 PolarHBondContact O-N 3.2Å
11	C	66.3	Low	66.7	Low	114 Å²	114	123.5 Å²	123.5	77%	0.77	69%	0.693	S	S	*	*	P	Polyproline II helix	trans	-68	133.8	168.6	-63.6	0	0	0	0	108.9	K9 I13	K9-C11 PolarHBondContact O-N 3.21Å; C11-I13 PolarHBondContact O-N 3.35Å
12	P	74.1	Confident	67.9	Low	122 Å²	122	115.5 Å²	115.5	79%	0.792	66%	0.656	S	S	*	*	P	Polyproline II helix	trans	-59.3	133.4	177.5	-21	31.3	0	0	0	110.9	P14	P12-P14 WeakPolarHBondContact O-CD 3.48Å
13	I	78.5	Confident	68.7	Low	100 Å²	100	113.4 Å²	113.4	51%	0.513	63%	0.628	S	S	.	*	P	Polyproline II helix	trans	-63.2	126.2	174.2	-61.5	175	0	0	0	108.3	C11 T15 G45 R47	C11-I13 PolarHBondContact O-N 3.35Å; I13-T15 PolarHBondContact O-N 3.39Å; I13-T15 VanDerWaalsContact O-N 3.08Å; I13-T15 PolarHBondContact O-OG1 3.43Å; I13-T15 VanDerWaalsContact O-OG1 3.08Å; I13-G45 WeakPolarHBondContact CG2-O 3.34Å; I13-R47 HydrophobicContact CG2-CB 4.05Å
14	P	81	Confident	69.2	Low	89 Å²	89	112 Å²	112	58%	0.578	62%	0.623	S	S	*	*	P	Polyproline II helix	trans	-53.3	119.5	174.5	-25.5	34.5	0	0	0	110.4	P12 R47	P12-P14 WeakPolarHBondContact O-CD 3.48Å; P14-R47 PolarHBondContact O-N 2.71Å
15	T	79.3	Confident	70.3	Confident	83 Å²	83	113.5 Å²	113.5	51%	0.509	61%	0.612	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109	127.9	-175.8	-60.4	0	0	0	0	109.4	I13 R47 I49	I13-T15 PolarHBondContact O-N 3.39Å; I13-T15 VanDerWaalsContact O-N 3.08Å; I13-T15 PolarHBondContact O-OG1 3.43Å; I13-T15 VanDerWaalsContact O-OG1 3.08Å; T15-R47 WeakPolarHBondContact CA-O 3.2Å; T15-I49 HydrophobicContact CG2-CD1 3.81Å; T15-I49 HydrophobicContact CG2-CG1 4.24Å
16	K	77.1	Confident	70.9	Confident	122 Å²	122	109.2 Å²	109.2	53%	0.53	58%	0.584	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-117.5	115.2	173.5	-168.4	-179.1	-177.7	-171	0	108.5	L18 T46 R47 I48 I49	K16-L18 HydrophobicContact CD-CD2 3.65Å; K16-L18 HydrophobicContact CD-CG 4.44Å; K16-L18 HydrophobicContact CG-CD2 3.92Å; K16-L18 HydrophobicContact CG-CG 4.44Å; K16-T46 HydrophobicContact CB-CG2 3.89Å; K16-R47 PolarHBondContact N-O 3.28Å; K16-I48 WeakPolarHBondContact O-CA 3.03Å; K16-I49 PolarHBondContact O-N 3.17Å
17	V	78.6	Confident	71.6	Confident	86 Å²	86	101.8 Å²	101.8	52%	0.521	56%	0.556	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-82.1	119.6	169.8	-176	0	0	0	0	107.2
18	L	71.9	Confident	72.3	Confident	31 Å²	31	101.3 Å²	101.3	16%	0.162	56%	0.56	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.9	115.8	-178.7	-71.3	-177	0	0	0	110.2	K16 L20 I48 I49	K16-L18 HydrophobicContact CD-CD2 3.65Å; K16-L18 HydrophobicContact CD-CG 4.44Å; K16-L18 HydrophobicContact CG-CD2 3.92Å; K16-L18 HydrophobicContact CG-CG 4.44Å; L18-L20 VanDerWaalsContact C-N 3.29Å; L18-L20 HydrophobicContact CB-CD2 3.99Å; L18-L20 HydrophobicContact CB-CG 3.96Å; L18-L20 HydrophobicContact CD1-CD2 4.06Å; L18-L20 PolarHBondContact O-N 3.08Å; L18-I48 HydrophobicContact CB-CG2 4.17Å; L18-I48 HydrophobicContact CD1-CB 4.31Å; L18-I48 HydrophobicContact CD1-CD1 3.91Å; L18-I48 HydrophobicContact CD1-CG1 3.98Å; L18-I48 HydrophobicContact CD1-CG2 3.39Å; L18-I48 HydrophobicContact CG-CG2 3.77Å; L18-I49 PolarHBondContact N-O 2.97Å
19	T	71.1	Confident	73.1	Confident	109 Å²	109	99.5 Å²	99.5	67%	0.669	55%	0.552	S	S	*	*			trans	-83.8	77.3	163.7	46.9	0	0	0	0	108.8
20	L	71.5	Confident	74.1	Confident	20 Å²	20	96.3 Å²	96.3	11%	0.105	54%	0.536	C	S	.	.			trans	-69.4	132.5	177	-63.5	-176.4	0	0	0	109.7	L18 Q25 L26 Y50 F54	L18-L20 VanDerWaalsContact C-N 3.29Å; L18-L20 HydrophobicContact CB-CD2 3.99Å; L18-L20 HydrophobicContact CB-CG 3.96Å; L18-L20 HydrophobicContact CD1-CD2 4.06Å; L18-L20 PolarHBondContact O-N 3.08Å; L20-Q25 HydrophobicContact CD1-CB 4.49Å; L20-Q25 HydrophobicContact CD2-CB 3.77Å; L20-L26 HydrophobicContact CD1-CD1 4.23Å; L20-Y50 HydrophobicContact CD1-CD1 3.86Å; L20-Y50 HydrophobicContact CD1-CE1 3.77Å; L20-F54 HydrophobicContact CB-CD1 4.18Å; L20-F54 HydrophobicContact CB-CD2 3.54Å; L20-F54 HydrophobicContact CB-CE1 3.98Å; L20-F54 HydrophobicContact CB-CE2 3.28Å; L20-F54 HydrophobicContact CB-CG 3.97Å; L20-F54 HydrophobicContact CB-CZ 3.52Å; L20-F54 HydrophobicContact CD1-CD1 4.32Å; L20-F54 HydrophobicContact CD1-CE1 3.62Å; L20-F54 HydrophobicContact CD1-CE2 4.26Å; L20-F54 HydrophobicContact CD1-CZ 3.57Å; L20-F54 HydrophobicContact CG-CE1 4.37Å; L20-F54 HydrophobicContact CG-CE2 4.4Å; L20-F54 HydrophobicContact CG-CZ 4.18Å; L20-F54 WeakPolarHBondContact O-CD2 3.35Å
21	K	72.5	Confident	75.1	Confident	200 Å²	200	94 Å²	94	87%	0.87	52%	0.519	S	S	*	.			trans	-96.5	-24.9	176.4	-68.8	-175.5	179.4	-178.8	0	112.6
22	D	69.3	Low	76.1	Confident	72 Å²	72	94.7 Å²	94.7	39%	0.385	51%	0.511	S	S	.	.	S	Bend	trans	-142.7	157	-174.5	-175.4	36.7	0	0	0	110.8	S24 Q25	D22-S24 PolarHBondContact OD2-OG 3.31Å; D22-Q25 WeakPolarHBondContact O-CB 3.05Å; D22-Q25 PolarHBondContact O-N 3.42Å
23	W	64.5	Low	76.9	Confident	82 Å²	82	90.7 Å²	90.7	31%	0.311	49%	0.485	S	S	.	.	G	3₁₀ helix	trans	-74.9	-34	-169.2	-67.6	112.6	0	0	0	115.7	Q25 L26 F54 C58 S61	W23-Q25 PolarHBondContact O-N 3.08Å; W23-L26 PolarHBondContact O-N 3.46Å; W23-F54 HydrophobicContact CE3-CZ 4.25Å; W23-C58 HydrophobicContact CE3-CB 4.05Å; W23-C58 HydrophobicContact CH2-CB 3.03Å; W23-C58 WeakPolarHBondContact CH2-O 2.9Å; W23-C58 VanDerWaalsContact CH2-SG 3.52Å; W23-C58 HydrophobicContact CZ2-CB 3.68Å; W23-C58 WeakPolarHBondContact CZ2-O 2.78Å; W23-C58 HydrophobicContact CZ3-CB 3.17Å; W23-C58 WeakPolarHBondContact CZ3-SG 3.13Å; W23-S61 WeakPolarHBondContact CH2-OG 3.47Å; W23-S61 WeakPolarHBondContact CZ2-OG 3.42Å
24	S	69.9	Low	77.5	Confident	98 Å²	98	93 Å²	93	69%	0.685	51%	0.506	S	S	*	.	G	3₁₀ helix	trans	-54.9	-13.6	173.3	58.2	0	0	0	0	113.1	D22	D22-S24 PolarHBondContact OD2-OG 3.31Å
25	Q	72.9	Confident	77.9	Confident	101 Å²	101	92.2 Å²	92.2	47%	0.472	51%	0.514	S	S	.	.	G	3₁₀ helix	trans	-98.6	-5	-177.2	-51.5	176.1	19.3	0	0	112.8	L20 D22 W23	L20-Q25 HydrophobicContact CD1-CB 4.49Å; L20-Q25 HydrophobicContact CD2-CB 3.77Å; D22-Q25 WeakPolarHBondContact O-CB 3.05Å; D22-Q25 PolarHBondContact O-N 3.42Å; W23-Q25 PolarHBondContact O-N 3.08Å
26	L	74.2	Confident	78.2	Confident	39 Å²	39	90 Å²	90	20%	0.204	51%	0.508	C	S	.	.	S	Bend	trans	-80.9	127.5	176.8	-172.4	69.3	0	0	0	110	L20 W23 Y30 Y50 F54	L20-L26 HydrophobicContact CD1-CD1 4.23Å; W23-L26 PolarHBondContact O-N 3.46Å; L26-Y30 HydrophobicContact CD2-CE1 4.45Å; L26-Y50 HydrophobicContact CD1-CD1 3.63Å; L26-Y50 HydrophobicContact CD1-CE1 3.22Å; L26-Y50 HydrophobicContact CD1-CE2 4.19Å; L26-Y50 HydrophobicContact CD1-CG 4.27Å; L26-F54 HydrophobicContact CB-CZ 4.43Å; L26-F54 HydrophobicContact CD1-CE1 4.07Å
27	P	76.1	Confident	78.7	Confident	43 Å²	43	87.3 Å²	87.3	28%	0.279	50%	0.501	S	S	.	.			trans	-64.7	147.8	173.1	-20.2	33.5	0	0	0	112.8	C29 Y50	P27-C29 PolarHBondContact O-N 2.82Å; P27-Y50 WeakPolarHBondContact CD-OH 3.43Å; P27-Y50 WeakPolarHBondContact CG-OH 3.47Å
28	D	75.7	Confident	79.1	Confident	170 Å²	170	84.2 Å²	84.2	91%	0.909	48%	0.482	S	S	*	.	S	Bend	trans	-64.9	-23.1	178.6	-63.4	-29	0	0	0	113.6
29	C	78.5	Confident	80	Confident	102 Å²	102	84.7 Å²	84.7	69%	0.689	48%	0.483	S	S	*	.			trans	-119.6	107.6	-178	47.6	0	0	0	0	111.5	P27 S40	P27-C29 PolarHBondContact O-N 2.82Å; C29-S40 WeakPolarHBondContact O-CB 3.4Å
30	Y	86.7	Confident	80.9	Confident	125 Å²	125	79.8 Å²	79.8	49%	0.49	45%	0.453	S	S	.	.			trans	-131.4	169.5	175	61.7	-90.3	0	0	0	110.9	L26 L38	L26-Y30 HydrophobicContact CD2-CE1 4.45Å; Y30-L38 HydrophobicContact CD2-CD2 3.71Å; Y30-L38 HydrophobicContact CD2-CG 4.32Å; Y30-L38 HydrophobicContact CE2-CD2 3.76Å
31	S	87.6	Confident	81.8	Confident	65 Å²	65	82.7 Å²	82.7	46%	0.455	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.4	165.3	-177.7	-59.2	0	0	0	0	110.8	L38 F39	S31-L38 CarbonylContact O-C 3.59Å; S31-L38 WeakPolarHBondContact O-CA 3.45Å; S31-F39 PolarHBondContact N-O 2.83Å; S31-F39 PolarHBondContact O-N 3.01Å; S31-F39 VanDerWaalsContact O-O 3.09Å
32	Q	87.7	Confident	82.6	Confident	129 Å²	129	75.6 Å²	75.6	60%	0.603	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-130.2	134.4	-177	-178.6	171.6	-24.2	0	0	110.6	T37 L38	Q32-T37 WeakPolarHBondContact CA-O 3.32Å; Q32-L38 HydrophobicContact CB-CD1 4.48Å; Q32-L38 HydrophobicContact CG-CD1 4.18Å
33	T	89.6	Confident	83.5	Confident	39 Å²	39	79.3 Å²	79.3	24%	0.239	47%	0.473	C	S	.	.			trans	-76	158.5	171.8	62.9	0	0	0	0	110.7	G35 G36 T37 F39	T33-G35 PolarHBondContact O-N 3.09Å; T33-G35 VanDerWaalsContact O-N 3.09Å; T33-G36 PolarHBondContact O-N 2.94Å; T33-T37 PolarHBondContact N-O 3.05Å; T33-T37 WeakPolarHBondContact OG1-CB 3.41Å; T33-T37 PolarHBondContact OG1-N 2.95Å; T33-T37 PolarHBondContact OG1-O 2.79Å; T33-F39 HydrophobicContact CG2-CD1 3.82Å; T33-F39 HydrophobicContact CG2-CE1 3.61Å
34	P	92.2	Very high	84.6	Confident	148 Å²	148	78.9 Å²	78.9	96%	0.961	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.8	-29.5	172.9	-28.4	36	0	0	0	113.9	G36	P34-G36 PolarHBondContact O-N 2.87Å
35	G	88.9	Confident	85.4	Confident	72 Å²	72	75.7 Å²	75.7	74%	0.742	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.1	7.6	173.5	0	0	0	0	0	115.3	T33 T37	T33-G35 PolarHBondContact O-N 3.09Å; T33-G35 VanDerWaalsContact O-N 3.09Å; G35-T37 PolarHBondContact O-N 2.8Å
36	G	84.8	Confident	86.2	Confident	37 Å²	37	73 Å²	73	38%	0.381	47%	0.467	S	S	.	.	S	Bend	trans	82.8	8.5	173.1	0	0	0	0	0	116.2	T33 P34	T33-G36 PolarHBondContact O-N 2.94Å; P34-G36 PolarHBondContact O-N 2.87Å
37	T	88.1	Confident	86.9	Confident	65 Å²	65	74.9 Å²	74.9	40%	0.399	47%	0.472	S	S	.	.			trans	-84	123.9	178.4	-56.1	0	0	0	0	110.1	Q32 T33 G35 I49	Q32-T37 WeakPolarHBondContact CA-O 3.32Å; T33-T37 PolarHBondContact N-O 3.05Å; T33-T37 WeakPolarHBondContact OG1-CB 3.41Å; T33-T37 PolarHBondContact OG1-N 2.95Å; T33-T37 PolarHBondContact OG1-O 2.79Å; G35-T37 PolarHBondContact O-N 2.8Å; T37-I49 HydrophobicContact CG2-CG2 3.81Å
38	L	88.3	Confident	87.5	Confident	22 Å²	22	73.4 Å²	73.4	12%	0.115	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	136.8	173	-80.1	70.3	0	0	0	110.7	Y30 S31 Q32 Y50 L55	Y30-L38 HydrophobicContact CD2-CD2 3.71Å; Y30-L38 HydrophobicContact CD2-CG 4.32Å; Y30-L38 HydrophobicContact CE2-CD2 3.76Å; S31-L38 CarbonylContact O-C 3.59Å; S31-L38 WeakPolarHBondContact O-CA 3.45Å; Q32-L38 HydrophobicContact CB-CD1 4.48Å; Q32-L38 HydrophobicContact CG-CD1 4.18Å; L38-Y50 HydrophobicContact CB-CD2 3.87Å; L38-Y50 PolarHBondContact O-N 3.31Å; L38-Y50 VanDerWaalsContact O-N 3.1Å; L38-L55 HydrophobicContact CB-CD1 3.93Å; L38-L55 HydrophobicContact CD1-CD1 3.62Å; L38-L55 HydrophobicContact CD2-CD1 3.76Å; L38-L55 HydrophobicContact CD2-CD2 3.66Å; L38-L55 HydrophobicContact CD2-CG 4.34Å; L38-L55 HydrophobicContact CG-CD1 3.95Å
39	F	90.5	Very high	88.2	Confident	41 Å²	41	67.6 Å²	67.6	18%	0.18	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.6	158.9	176.5	71.1	-77.6	0	0	0	111.1	S31 T33 R47 I48	S31-F39 PolarHBondContact N-O 2.83Å; S31-F39 PolarHBondContact O-N 3.01Å; S31-F39 VanDerWaalsContact O-O 3.09Å; T33-F39 HydrophobicContact CG2-CD1 3.82Å; T33-F39 HydrophobicContact CG2-CE1 3.61Å; F39-R47 HydrophobicContact CB-CG 4.48Å; F39-R47 HydrophobicContact CD2-CG 4.32Å; F39-I48 CarbonylContact C-O 3.57Å; F39-I48 WeakPolarHBondContact CA-O 3.41Å; F39-I48 WeakPolarHBondContact CB-O 3.48Å
40	S	90.1	Very high	88.6	Confident	6 Å²	6	63 Å²	63	4%	0.042	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	161.3	167.4	66.1	0	0	0	0	109.8	C29 R47 I48 Y50	C29-S40 WeakPolarHBondContact O-CB 3.4Å; S40-R47 CarbonylContact O-C 3.46Å; S40-R47 WeakPolarHBondContact O-CA 3.21Å; S40-I48 PolarHBondContact N-O 3.49Å; S40-I48 PolarHBondContact O-N 3Å; S40-I48 WeakPolarHBondContact OG-CB 3.03Å; S40-Y50 WeakPolarHBondContact CB-OH 3.49Å; S40-Y50 PolarHBondContact OG-OH 2.99Å
41	T	90.1	Very high	88.7	Confident	81 Å²	81	60.2 Å²	60.2	50%	0.497	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	118.8	174.5	-60	0	0	0	0	107.7	T46	T41-T46 WeakPolarHBondContact CA-O 3.47Å
42	T	88.6	Confident	88.5	Confident	51 Å²	51	66 Å²	66	31%	0.313	40%	0.403	S	S	.	.			trans	-70.8	156.4	174.4	64.4	0	0	0	0	109.6	G44 G45 T46 I48	T42-G44 PolarHBondContact O-N 3.5Å; T42-G45 PolarHBondContact O-N 3.1Å; T42-T46 PolarHBondContact N-O 3.24Å; T42-T46 PolarHBondContact OG1-N 2.83Å; T42-I48 HydrophobicContact CG2-CD1 3.65Å; T42-I48 HydrophobicContact CG2-CG1 4.48Å
43	P	88.9	Confident	88.5	Confident	149 Å²	149	67.9 Å²	67.9	97%	0.968	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.4	-25.6	175.5	-29.1	36	0	0	0	114.3	G45	P43-G45 PolarHBondContact O-N 3.18Å
44	G	87.3	Confident	88.2	Confident	73 Å²	73	66.8 Å²	66.8	75%	0.753	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.7	2.5	173.7	0	0	0	0	0	115.1	T42	T42-G44 PolarHBondContact O-N 3.5Å
45	G	87.4	Confident	87.8	Confident	31 Å²	31	61.8 Å²	61.8	32%	0.32	37%	0.366	S	S	.	.	S	Bend	trans	85.5	1.2	177.1	0	0	0	0	0	115	I13 T42 P43 R47	I13-G45 WeakPolarHBondContact CG2-O 3.34Å; T42-G45 PolarHBondContact O-N 3.1Å; P43-G45 PolarHBondContact O-N 3.18Å; G45-R47 PolarHBondContact O-N 3.25Å
46	T	88.7	Confident	87.7	Confident	44 Å²	44	62 Å²	62	27%	0.27	35%	0.35	S	S	.	.	P	Polyproline II helix	trans	-75	127	178.8	-56.5	0	0	0	0	110.4	K16 T41 T42	K16-T46 HydrophobicContact CB-CG2 3.89Å; T41-T46 WeakPolarHBondContact CA-O 3.47Å; T42-T46 PolarHBondContact N-O 3.24Å; T42-T46 PolarHBondContact OG1-N 2.83Å
47	R	88.8	Confident	87.8	Confident	80 Å²	80	65 Å²	65	30%	0.302	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	122.6	172.9	-169.3	174.5	-175.6	171.5	2.3	110.2	I13 P14 T15 K16 F39 S40 G45	I13-R47 HydrophobicContact CG2-CB 4.05Å; P14-R47 PolarHBondContact O-N 2.71Å; T15-R47 WeakPolarHBondContact CA-O 3.2Å; K16-R47 PolarHBondContact N-O 3.28Å; F39-R47 HydrophobicContact CB-CG 4.48Å; F39-R47 HydrophobicContact CD2-CG 4.32Å; S40-R47 CarbonylContact O-C 3.46Å; S40-R47 WeakPolarHBondContact O-CA 3.21Å; G45-R47 PolarHBondContact O-N 3.25Å
48	I	89.3	Confident	87.6	Confident	12 Å²	12	62.7 Å²	62.7	6%	0.062	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	130.8	174	-64.8	167	0	0	0	108.2	K16 L18 F39 S40 T42 Y50	K16-I48 WeakPolarHBondContact O-CA 3.03Å; L18-I48 HydrophobicContact CB-CG2 4.17Å; L18-I48 HydrophobicContact CD1-CB 4.31Å; L18-I48 HydrophobicContact CD1-CD1 3.91Å; L18-I48 HydrophobicContact CD1-CG1 3.98Å; L18-I48 HydrophobicContact CD1-CG2 3.39Å; L18-I48 HydrophobicContact CG-CG2 3.77Å; F39-I48 CarbonylContact C-O 3.57Å; F39-I48 WeakPolarHBondContact CA-O 3.41Å; F39-I48 WeakPolarHBondContact CB-O 3.48Å; S40-I48 PolarHBondContact N-O 3.49Å; S40-I48 PolarHBondContact O-N 3Å; S40-I48 WeakPolarHBondContact OG-CB 3.03Å; T42-I48 HydrophobicContact CG2-CD1 3.65Å; T42-I48 HydrophobicContact CG2-CG1 4.48Å; I48-Y50 HydrophobicContact CG2-CD1 4.12Å; I48-Y50 HydrophobicContact CG2-CE1 3.55Å; I48-Y50 HydrophobicContact CG2-CE2 4.05Å
49	I	89.8	Confident	87.6	Confident	47 Å²	47	70.3 Å²	70.3	24%	0.241	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	129.2	172.1	-57.7	178.7	0	0	0	108.2	T15 K16 L18 T37	T15-I49 HydrophobicContact CG2-CD1 3.81Å; T15-I49 HydrophobicContact CG2-CG1 4.24Å; K16-I49 PolarHBondContact O-N 3.17Å; L18-I49 PolarHBondContact N-O 2.97Å; T37-I49 HydrophobicContact CG2-CG2 3.81Å
50	Y	87.1	Confident	87.4	Confident	7 Å²	7	72.8 Å²	72.8	3%	0.027	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	135.8	-179.2	-56.2	-77.4	0	0	0	111.6	L20 L26 P27 L38 S40 I48	L20-Y50 HydrophobicContact CD1-CD1 3.86Å; L20-Y50 HydrophobicContact CD1-CE1 3.77Å; L26-Y50 HydrophobicContact CD1-CD1 3.63Å; L26-Y50 HydrophobicContact CD1-CE1 3.22Å; L26-Y50 HydrophobicContact CD1-CE2 4.19Å; L26-Y50 HydrophobicContact CD1-CG 4.27Å; P27-Y50 WeakPolarHBondContact CD-OH 3.43Å; P27-Y50 WeakPolarHBondContact CG-OH 3.47Å; L38-Y50 HydrophobicContact CB-CD2 3.87Å; L38-Y50 PolarHBondContact O-N 3.31Å; L38-Y50 VanDerWaalsContact O-N 3.1Å; S40-Y50 WeakPolarHBondContact CB-OH 3.49Å; S40-Y50 PolarHBondContact OG-OH 2.99Å; I48-Y50 HydrophobicContact CG2-CD1 4.12Å; I48-Y50 HydrophobicContact CG2-CE1 3.55Å; I48-Y50 HydrophobicContact CG2-CE2 4.05Å
51	D	88.6	Confident	87.2	Confident	66 Å²	66	73 Å²	73	35%	0.353	39%	0.388	S	S	.	.			trans	-75	140.7	179.4	-82.7	-8.4	0	0	0	112.6	K53 F54 L55	D51-K53 PolarHBondContact O-N 3.05Å; D51-F54 HydrophobicContact CB-CB 4.43Å; D51-F54 WeakPolarHBondContact O-CB 3.39Å; D51-F54 PolarHBondContact O-N 3.37Å; D51-F54 VanDerWaalsContact O-N 3.17Å; D51-L55 WeakPolarHBondContact O-CG 3.11Å; D51-L55 PolarHBondContact O-N 3.06Å
52	R	84.5	Confident	87.1	Confident	187 Å²	187	74.3 Å²	74.3	71%	0.706	40%	0.398	S	S	*	.	H	α-helix	trans	-53.6	-38.9	175.5	-179.3	179.2	-179.6	-87	1.3	113	L55 L56	R52-L55 PolarHBondContact O-N 3.27Å; R52-L56 HydrophobicContact CG-CD1 4.08Å; R52-L56 HydrophobicContact CG-CG 4.39Å; R52-L56 VanDerWaalsContact NH1-CD1 3.31Å; R52-L56 WeakPolarHBondContact O-CG 3.47Å; R52-L56 PolarHBondContact O-N 3.17Å
53	K	86.4	Confident	86.9	Confident	168 Å²	168	78.4 Å²	78.4	73%	0.73	42%	0.417	S	S	*	.	H	α-helix	trans	-62	-50.3	-179.7	-66.5	-168.3	179.2	101	0	110.7	D51 L55 L56 D57	D51-K53 PolarHBondContact O-N 3.05Å; K53-L55 VanDerWaalsContact C-N 3.32Å; K53-L55 PolarHBondContact O-N 3.37Å; K53-L56 PolarHBondContact O-N 3.19Å; K53-D57 PolarHBondContact O-N 2.84Å
54	F	84.2	Confident	86.8	Confident	15 Å²	15	74.2 Å²	74.2	7%	0.066	40%	0.395	C	S	.	.	H	α-helix	trans	-55.6	-47.3	175.5	173.3	-102.9	0	0	0	111.3	L20 W23 L26 D51 L56 D57 C58	L20-F54 HydrophobicContact CB-CD1 4.18Å; L20-F54 HydrophobicContact CB-CD2 3.54Å; L20-F54 HydrophobicContact CB-CE1 3.98Å; L20-F54 HydrophobicContact CB-CE2 3.28Å; L20-F54 HydrophobicContact CB-CG 3.97Å; L20-F54 HydrophobicContact CB-CZ 3.52Å; L20-F54 HydrophobicContact CD1-CD1 4.32Å; L20-F54 HydrophobicContact CD1-CE1 3.62Å; L20-F54 HydrophobicContact CD1-CE2 4.26Å; L20-F54 HydrophobicContact CD1-CZ 3.57Å; L20-F54 HydrophobicContact CG-CE1 4.37Å; L20-F54 HydrophobicContact CG-CE2 4.4Å; L20-F54 HydrophobicContact CG-CZ 4.18Å; L20-F54 WeakPolarHBondContact O-CD2 3.35Å; W23-F54 HydrophobicContact CE3-CZ 4.25Å; L26-F54 HydrophobicContact CB-CZ 4.43Å; L26-F54 HydrophobicContact CD1-CE1 4.07Å; D51-F54 HydrophobicContact CB-CB 4.43Å; D51-F54 WeakPolarHBondContact O-CB 3.39Å; D51-F54 PolarHBondContact O-N 3.37Å; D51-F54 VanDerWaalsContact O-N 3.17Å; F54-L56 VanDerWaalsContact C-N 3.26Å; F54-L56 PolarHBondContact O-N 3.39Å; F54-D57 WeakPolarHBondContact O-CB 3.34Å; F54-D57 PolarHBondContact O-N 2.58Å; F54-C58 PolarHBondContact O-N 3.42Å; F54-C58 PolarHBondContact O-SG 2.92Å
55	L	84.2	Confident	86.7	Confident	43 Å²	43	79.8 Å²	79.8	23%	0.225	39%	0.393	C	S	.	.	H	α-helix	trans	-65.4	-22.7	177.6	-62.5	175	0	0	0	114.9	L38 D51 R52 K53 C58	L38-L55 HydrophobicContact CB-CD1 3.93Å; L38-L55 HydrophobicContact CD1-CD1 3.62Å; L38-L55 HydrophobicContact CD2-CD1 3.76Å; L38-L55 HydrophobicContact CD2-CD2 3.66Å; L38-L55 HydrophobicContact CD2-CG 4.34Å; L38-L55 HydrophobicContact CG-CD1 3.95Å; D51-L55 WeakPolarHBondContact O-CG 3.11Å; D51-L55 PolarHBondContact O-N 3.06Å; R52-L55 PolarHBondContact O-N 3.27Å; K53-L55 VanDerWaalsContact C-N 3.32Å; K53-L55 PolarHBondContact O-N 3.37Å; L55-C58 VanDerWaalsContact CA-SG 3.55Å; L55-C58 WeakPolarHBondContact O-CB 3.47Å; L55-C58 PolarHBondContact O-N 3.27Å
56	L	86.6	Confident	86.7	Confident	76 Å²	76	82.6 Å²	82.6	40%	0.398	40%	0.404	S	S	.	.	H	α-helix	trans	-85.6	-37.5	175.2	-74.6	176.3	0	0	0	111.9	R52 K53 F54 C58 R59	R52-L56 HydrophobicContact CG-CD1 4.08Å; R52-L56 HydrophobicContact CG-CG 4.39Å; R52-L56 VanDerWaalsContact NH1-CD1 3.31Å; R52-L56 WeakPolarHBondContact O-CG 3.47Å; R52-L56 PolarHBondContact O-N 3.17Å; K53-L56 PolarHBondContact O-N 3.19Å; F54-L56 VanDerWaalsContact C-N 3.26Å; F54-L56 PolarHBondContact O-N 3.39Å; L56-C58 PolarHBondContact O-N 3.07Å; L56-C58 VanDerWaalsContact O-N 3.09Å; L56-R59 WeakPolarHBondContact O-CB 2.99Å; L56-R59 WeakPolarHBondContact O-CD 3.46Å; L56-R59 WeakPolarHBondContact O-CG 3.48Å; L56-R59 PolarHBondContact O-N 3.15Å
57	D	87.4	Confident	86.5	Confident	101 Å²	101	86.1 Å²	86.1	54%	0.54	43%	0.427	S	S	.	.	H	α-helix	trans	-56.6	-23.8	164.4	-63.1	-24.5	0	0	0	109.5	K53 F54 R59 N60	K53-D57 PolarHBondContact O-N 2.84Å; F54-D57 WeakPolarHBondContact O-CB 3.34Å; F54-D57 PolarHBondContact O-N 2.58Å; D57-R59 PolarHBondContact O-N 3.04Å; D57-R59 VanDerWaalsContact O-N 3.15Å; D57-N60 PolarHBondContact O-N 3.4Å
58	C	83.5	Confident	86.3	Confident	17 Å²	17	86.4 Å²	86.4	12%	0.115	44%	0.44	C	S	.	.	G	3₁₀ helix	trans	-59.5	-27.8	176.7	-63.3	0	0	0	0	114.2	W23 F54 L55 L56 N60 S61	W23-C58 HydrophobicContact CE3-CB 4.05Å; W23-C58 HydrophobicContact CH2-CB 3.03Å; W23-C58 WeakPolarHBondContact CH2-O 2.9Å; W23-C58 VanDerWaalsContact CH2-SG 3.52Å; W23-C58 HydrophobicContact CZ2-CB 3.68Å; W23-C58 WeakPolarHBondContact CZ2-O 2.78Å; W23-C58 HydrophobicContact CZ3-CB 3.17Å; W23-C58 WeakPolarHBondContact CZ3-SG 3.13Å; F54-C58 PolarHBondContact O-N 3.42Å; F54-C58 PolarHBondContact O-SG 2.92Å; L55-C58 VanDerWaalsContact CA-SG 3.55Å; L55-C58 WeakPolarHBondContact O-CB 3.47Å; L55-C58 PolarHBondContact O-N 3.27Å; L56-C58 PolarHBondContact O-N 3.07Å; L56-C58 VanDerWaalsContact O-N 3.09Å; C58-N60 PolarHBondContact O-N 3.35Å; C58-S61 PolarHBondContact O-N 3.1Å; C58-S61 PolarHBondContact O-OG 3.07Å
59	R	86.9	Confident	85.9	Confident	182 Å²	182	91.5 Å²	91.5	69%	0.687	48%	0.475	S	S	*	.	G	3₁₀ helix	trans	-66.2	-20.1	-175.6	83.2	-170.1	-157.5	171.4	5.2	114	L56 D57	L56-R59 WeakPolarHBondContact O-CB 2.99Å; L56-R59 WeakPolarHBondContact O-CD 3.46Å; L56-R59 WeakPolarHBondContact O-CG 3.48Å; L56-R59 PolarHBondContact O-N 3.15Å; D57-R59 PolarHBondContact O-N 3.04Å; D57-R59 VanDerWaalsContact O-N 3.15Å
60	N	86.9	Confident	85.6	Confident	93 Å²	93	95.5 Å²	95.5	50%	0.497	51%	0.506	S	S	.	.	G	3₁₀ helix	trans	-93.5	-2.5	-170.7	-61.3	-45.4	0	0	0	113.3	D57 C58	D57-N60 PolarHBondContact O-N 3.4Å; C58-N60 PolarHBondContact O-N 3.35Å
61	S	86.7	Confident	85.6	Confident	10 Å²	10	99.8 Å²	99.8	7%	0.07	53%	0.529	C	S	.	.	S	Bend	trans	-71.1	156.7	179.3	58.7	0	0	0	0	112.6	W23 C58 L63 A64	W23-S61 WeakPolarHBondContact CH2-OG 3.47Å; W23-S61 WeakPolarHBondContact CZ2-OG 3.42Å; C58-S61 PolarHBondContact O-N 3.1Å; C58-S61 PolarHBondContact O-OG 3.07Å; S61-L63 PolarHBondContact O-N 3.47Å; S61-A64 PolarHBondContact O-N 3.09Å; S61-A64 PolarHBondContact OG-N 2.95Å
62	P	87.2	Confident	85.6	Confident	109 Å²	109	100.5 Å²	100.5	71%	0.708	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.3	-37.2	168.5	-25	34.5	0	0	0	113	A64 R65	P62-A64 VanDerWaalsContact C-N 3.33Å; P62-A64 PolarHBondContact O-N 3.3Å; P62-R65 WeakPolarHBondContact O-CB 3.49Å; P62-R65 PolarHBondContact O-N 3Å
63	L	84.4	Confident	85.7	Confident	137 Å²	137	98.3 Å²	98.3	72%	0.717	54%	0.535	S	S	*	.	G	3₁₀ helix	trans	-62.7	-36.9	178.7	-71.5	171.7	0	0	0	112.4	S61 R65 T66	S61-L63 PolarHBondContact O-N 3.47Å; L63-R65 PolarHBondContact O-N 3.39Å; L63-T66 PolarHBondContact O-N 3.46Å; L63-T66 PolarHBondContact O-OG1 2.69Å
64	A	87.4	Confident	85.9	Confident	61 Å²	61	94.1 Å²	94.1	50%	0.504	52%	0.519	S	S	.	.	G	3₁₀ helix	trans	-68.3	-14.8	176.6	0	0	0	0	0	113.3	S61 P62	S61-A64 PolarHBondContact O-N 3.09Å; S61-A64 PolarHBondContact OG-N 2.95Å; P62-A64 VanDerWaalsContact C-N 3.33Å; P62-A64 PolarHBondContact O-N 3.3Å
65	R	85.2	Confident	85.9	Confident	190 Å²	190	98.5 Å²	98.5	72%	0.717	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-95.9	-3.5	179.6	-60.8	-178.2	-176.9	-179.2	0.9	113.4	P62 L63 P67	P62-R65 WeakPolarHBondContact O-CB 3.49Å; P62-R65 PolarHBondContact O-N 3Å; L63-R65 PolarHBondContact O-N 3.39Å; R65-P67 WeakPolarHBondContact O-CD 3.19Å
66	T	86.5	Confident	85.9	Confident	90 Å²	90	100.2 Å²	100.2	55%	0.552	58%	0.577	S	S	*	*	S	Bend	trans	-84.4	119.1	175.4	56.6	0	0	0	0	109.4	L63	L63-T66 PolarHBondContact O-N 3.46Å; L63-T66 PolarHBondContact O-OG1 2.69Å
67	P	84.3	Confident	86	Confident	117 Å²	117	101.9 Å²	101.9	76%	0.76	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-57.8	138.8	175.2	-22.7	33.5	0	0	0	110.8	R65 C69	R65-P67 WeakPolarHBondContact O-CD 3.19Å; P67-C69 PolarHBondContact O-N 2.95Å
68	P	86.4	Confident	85.9	Confident	87 Å²	87	99 Å²	99	57%	0.565	58%	0.577	S	S	*	*	P	Polyproline II helix	trans	-61.5	134.9	178.4	-18	29.2	0	0	0	110.8	C70 L71	P68-C70 PolarHBondContact O-N 3.29Å; P68-L71 HydrophobicContact CB-CB 4.28Å; P68-L71 HydrophobicContact CG-CD2 4.32Å
69	C	79.7	Confident	85.9	Confident	119 Å²	119	99.5 Å²	99.5	80%	0.804	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65	131.5	169.2	52.5	0	0	0	0	108.5	P67	P67-C69 PolarHBondContact O-N 2.95Å
70	C	83.9	Confident	85.4	Confident	130 Å²	130	94.2 Å²	94.2	88%	0.878	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	75.5	21.1	176.5	-42.7	0	0	0	0	116.8	P68	P68-C70 PolarHBondContact O-N 3.29Å
71	L	86.2	Confident	84.5	Confident	97 Å²	97	94.4 Å²	94.4	51%	0.508	58%	0.583	S	S	.	*			trans	-75.1	129.2	170.7	-163.9	71.8	0	0	0	110.8	P68 T78	P68-L71 HydrophobicContact CB-CB 4.28Å; P68-L71 HydrophobicContact CG-CD2 4.32Å; L71-T78 HydrophobicContact CD2-CG2 3.57Å; L71-T78 HydrophobicContact CG-CG2 3.89Å
72	P	89.1	Confident	83.3	Confident	82 Å²	82	99.6 Å²	99.6	53%	0.532	62%	0.615	S	S	.	*			trans	-65.9	147.4	179.1	27.2	-34.4	0	0	0	111.3	I74 T78	P72-I74 HydrophobicContact CB-CG1 4.46Å; P72-I74 HydrophobicContact CG-CD1 4.19Å; P72-I74 PolarHBondContact O-N 2.89Å; P72-T78 WeakPolarHBondContact O-CB 3.11Å; P72-T78 PolarHBondContact O-OG1 3.3Å
73	Q	86.9	Confident	81.8	Confident	141 Å²	141	99.5 Å²	99.5	66%	0.659	60%	0.604	S	S	*	*			trans	-89.2	100.2	-179.5	-165	160.3	-27.6	0	0	110.7	T78 V79	Q73-T78 WeakPolarHBondContact CA-OG1 3.2Å; Q73-V79 HydrophobicContact CG-CG1 3.21Å; Q73-V79 VanDerWaalsContact NE2-CG1 3.34Å
74	I	89.7	Confident	80.4	Confident	79 Å²	79	96.1 Å²	96.1	41%	0.405	60%	0.596	S	S	.	*			trans	-114.1	115.9	-176.7	-59.2	171	0	0	0	107.4	P72 G76 V77 T78	P72-I74 HydrophobicContact CB-CG1 4.46Å; P72-I74 HydrophobicContact CG-CD1 4.19Å; P72-I74 PolarHBondContact O-N 2.89Å; I74-G76 PolarHBondContact O-N 3.16Å; I74-V77 HydrophobicContact CB-CB 4.11Å; I74-V77 HydrophobicContact CB-CG2 4.49Å; I74-V77 HydrophobicContact CG2-CB 3.97Å; I74-V77 HydrophobicContact CG2-CG2 3.8Å; I74-V77 PolarHBondContact O-N 3.5Å; I74-V77 VanDerWaalsContact O-N 3.07Å; I74-T78 PolarHBondContact N-OG1 3.2Å; I74-T78 PolarHBondContact O-N 3.21Å; I74-T78 VanDerWaalsContact O-N 3.1Å
75	P	85.5	Confident	78.7	Confident	107 Å²	107	102.1 Å²	102.1	70%	0.695	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-48.8	129.1	175.8	-29.4	36.8	0	0	0	112.4	V77	P75-V77 VanDerWaalsContact C-N 3.25Å; P75-V77 PolarHBondContact O-N 2.81Å
76	G	83.9	Confident	77.2	Confident	79 Å²	79	99.4 Å²	99.4	81%	0.814	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	77.8	-7.6	179.7	0	0	0	0	0	116.4	I74 V79	I74-G76 PolarHBondContact O-N 3.16Å; G76-V79 VanDerWaalsContact N-CG2 3.32Å
77	V	88.9	Confident	75.7	Confident	111 Å²	111	99.8 Å²	99.8	67%	0.673	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.7	-58.9	-179.8	-176.1	0	0	0	0	111.9	I74 P75	I74-V77 HydrophobicContact CB-CB 4.11Å; I74-V77 HydrophobicContact CB-CG2 4.49Å; I74-V77 HydrophobicContact CG2-CB 3.97Å; I74-V77 HydrophobicContact CG2-CG2 3.8Å; I74-V77 PolarHBondContact O-N 3.5Å; I74-V77 VanDerWaalsContact O-N 3.07Å; P75-V77 VanDerWaalsContact C-N 3.25Å; P75-V77 PolarHBondContact O-N 2.81Å
78	T	85.4	Confident	73.9	Confident	41 Å²	41	97.6 Å²	97.6	25%	0.252	61%	0.609	S	S	.	*	T	Hydrogen-bonded Turn	trans	-112.8	-14.3	-171.9	61	0	0	0	0	113	L71 P72 Q73 I74	L71-T78 HydrophobicContact CD2-CG2 3.57Å; L71-T78 HydrophobicContact CG-CG2 3.89Å; P72-T78 WeakPolarHBondContact O-CB 3.11Å; P72-T78 PolarHBondContact O-OG1 3.3Å; Q73-T78 WeakPolarHBondContact CA-OG1 3.2Å; I74-T78 PolarHBondContact N-OG1 3.2Å; I74-T78 PolarHBondContact O-N 3.21Å; I74-T78 VanDerWaalsContact O-N 3.1Å
79	V	82.7	Confident	71.8	Confident	27 Å²	27	103.5 Å²	103.5	16%	0.164	63%	0.626	C	S	.	*	S	Bend	trans	-74.5	132.5	170.1	-78.5	0	0	0	0	111.1	Q73 G76 A81	Q73-V79 HydrophobicContact CG-CG1 3.21Å; Q73-V79 VanDerWaalsContact NE2-CG1 3.34Å; G76-V79 VanDerWaalsContact N-CG2 3.32Å; V79-A81 PolarHBondContact O-N 3.06Å
80	P	76.5	Confident	70.3	Confident	72 Å²	72	105.2 Å²	105.2	47%	0.468	63%	0.627	S	S	.	*			trans	-60.6	139.1	167.2	-19.1	31	0	0	0	110.2	T82 H83	P80-T82 PolarHBondContact O-N 3.21Å; P80-H83 PolarHBondContact O-N 3.27Å
81	A	67.2	Low	68.2	Low	97 Å²	97	106.8 Å²	106.8	80%	0.802	62%	0.621	S	S	*	*	G	3₁₀ helix	trans	-56	-23	-179.1	0	0	0	0	0	113.5	V79 H83	V79-A81 PolarHBondContact O-N 3.06Å; A81-H83 VanDerWaalsContact C-N 3.33Å; A81-H83 PolarHBondContact O-N 3.42Å
82	T	63.3	Low	65.8	Low	119 Å²	119	110.1 Å²	110.1	73%	0.73	64%	0.639	S	S	*	*	G	3₁₀ helix	trans	-72.7	-20.3	176.5	54.6	0	0	0	0	114	P80	P80-T82 PolarHBondContact O-N 3.21Å
83	H	55.9	Low	63.6	Low	106 Å²	106	114 Å²	114	49%	0.491	66%	0.655	S	S	.	*	G	3₁₀ helix	trans	-99.7	-3.5	179.2	-70.7	-73	0	0	0	113.7	P80 A81 H85 H86	P80-H83 PolarHBondContact O-N 3.27Å; A81-H83 VanDerWaalsContact C-N 3.33Å; A81-H83 PolarHBondContact O-N 3.42Å; H83-H85 PolarHBondContact O-N 3.32Å; H83-H85 VanDerWaalsContact O-N 3.13Å; H83-H86 PolarHBondContact O-ND1 3.4Å; H83-H86 VanDerWaalsContact O-ND1 3.08Å
84	A	54.1	Low	61.5	Low	67 Å²	67	115 Å²	115	55%	0.554	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.5	-12.1	-178.8	0	0	0	0	0	113.8
85	H	51.1	Low	59	Low	187 Å²	187	120.1 Å²	120.1	87%	0.866	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95	0.9	-173.6	-139.8	-74.5	0	0	0	115	H83	H83-H85 PolarHBondContact O-N 3.32Å; H83-H85 VanDerWaalsContact O-N 3.13Å
86	H	54.2	Low	56.9	Low	133 Å²	133	122.6 Å²	122.6	62%	0.616	68%	0.682	S	S	*	*	S	Bend	trans	-108.5	-6.1	-174.1	96.5	-76.7	0	0	0	115.7	H83	H83-H86 PolarHBondContact O-ND1 3.4Å; H83-H86 VanDerWaalsContact O-ND1 3.08Å
87	T	54.8	Low	54.6	Low	98 Å²	98	123.3 Å²	123.3	60%	0.601	68%	0.68	S	S	*	*	S	Bend	trans	-126	95.4	180	53.6	0	0	0	0	110.7
88	G	45.8	Very low	52.1	Low	70 Å²	70	127.3 Å²	127.3	72%	0.722	69%	0.691	S	S	*	*			trans	144.5	62.1	162.2	0	0	0	0	0	116.2	L90	G88-L90 PolarHBondContact O-N 2.85Å
89	K	43.6	Very low	50	Low	212 Å²	212	134.3 Å²	134.3	92%	0.922	72%	0.721	S	S	*	*			trans	-68.2	78.2	141.4	-78	-169	176.9	-171.9	0	107
90	L	46.8	Very low	47.9	Very low	155 Å²	155	142.4 Å²	142.4	81%	0.812	76%	0.757	S	S	*	*			trans	-96.9	108.5	163.2	-149.9	157.4	0	0	0	104.9	G88 D92	G88-L90 PolarHBondContact O-N 2.85Å; L90-D92 PolarHBondContact O-N 2.99Å
91	Q	40.7	Very low	46.4	Very low	162 Å²	162	148 Å²	148	76%	0.757	78%	0.777	S	S	*	*			trans	-55.8	120.2	-173	-64.4	155.3	27.9	0	0	108.7	L93	Q91-L93 VanDerWaalsContact C-N 3.32Å; Q91-L93 PolarHBondContact O-N 3.26Å
92	D	36.8	Very low	45.1	Very low	167 Å²	167	153.2 Å²	153.2	89%	0.893	78%	0.781	S	S	*	*			trans	-57.5	97.3	165.9	-73	-65.9	0	0	0	108.3	L90 K94	L90-D92 PolarHBondContact O-N 2.99Å; D92-K94 PolarHBondContact O-N 3.08Å; D92-K94 VanDerWaalsContact O-N 3.16Å
93	L	41.3	Very low	44	Very low	163 Å²	163	154.2 Å²	154.2	85%	0.853	78%	0.782	S	S	*	*			trans	-70.1	107.1	165	-80.6	161	0	0	0	106.7	Q91 E95	Q91-L93 VanDerWaalsContact C-N 3.32Å; Q91-L93 PolarHBondContact O-N 3.26Å; L93-E95 PolarHBondContact O-N 3.13Å
94	K	44.4	Very low	43.4	Very low	163 Å²	163	156.5 Å²	156.5	71%	0.709	80%	0.797	S	S	*	*			trans	-43.1	113.2	164.8	176.9	166.8	-179.8	169.6	0	110.9	D92 E96	D92-K94 PolarHBondContact O-N 3.08Å; D92-K94 VanDerWaalsContact O-N 3.16Å; K94-E96 WeakPolarHBondContact CE-OE1 3.07Å; K94-E96 IonicContact NZ-OE1 2.85Å; K94-E96 PolarHBondContact NZ-OE1 3.49Å
95	E	36.7	Very low	43.1	Very low	186 Å²	186	156.7 Å²	156.7	87%	0.869	81%	0.805	S	S	*	*			trans	-121.4	102.4	156.6	-79.9	-176.7	166.2	0	0	107.7	L93	L93-E95 PolarHBondContact O-N 3.13Å
96	E	41.8	Very low	42.9	Very low	160 Å²	160	154.5 Å²	154.5	75%	0.748	80%	0.8	S	S	*	*			trans	-69.8	121	153	-73.9	178.7	-159.7	0	0	106.4	K94	K94-E96 WeakPolarHBondContact CE-OE1 3.07Å; K94-E96 IonicContact NZ-OE1 2.85Å; K94-E96 PolarHBondContact NZ-OE1 3.49Å
97	A	35.1	Very low	42.9	Very low	94 Å²	94	154.9 Å²	154.9	78%	0.777	81%	0.806	S	S	*	*			trans	-145.6	123.1	163.1	0	0	0	0	0	108.8
98	E	36.6	Very low	43.4	Very low	194 Å²	194	154.9 Å²	154.9	91%	0.907	81%	0.81	S	S	*	*			trans	-58.6	149.5	-172.3	-65.9	155.7	164.2	0	0	113
99	E	40.8	Very low	44.6	Very low	188 Å²	188	159.7 Å²	159.7	88%	0.879	81%	0.814	S	S	*	*			trans	-58.6	131.4	162.5	-61.8	172.4	161.4	0	0	109.5
100	E	37.7	Very low	45.6	Very low	198 Å²	198	158.5 Å²	158.5	93%	0.925	81%	0.809	S	S	*	*			trans	-179.2	135.7	138.7	-99.7	173.1	-163.4	0	0	112.1
101	E	45	Very low	46.7	Very low	188 Å²	188	159 Å²	159	88%	0.879	81%	0.807	S	S	*	*			trans	-61.8	148.1	-176.9	-59.7	176.3	135	0	0	115
102	K	41.3	Very low	48.2	Very low	207 Å²	207	159 Å²	159	90%	0.9	81%	0.81	S	S	*	*			trans	-159.9	103	137.4	-71.1	-156	-179.5	169.2	0	113.6
103	D	39.8	Very low	50	Low	141 Å²	141	158.2 Å²	158.2	75%	0.754	81%	0.805	S	S	*	*				44.9	126.5	118.3	-147.1	29.1	0	0	0	123.9
104	I	42.7	Very low	51	Low	154 Å²	154	161.5 Å²	161.5	79%	0.79	82%	0.821	S	S	*	*			trans	71.4	129.8	146.5	-78.8	160.9	0	0	0	123.4
105	G	48.7	Very low	51.4	Low	71 Å²	71	161.5 Å²	161.5	73%	0.732	83%	0.827	S	S	*	*			trans	154.2	60.1	158.8	0	0	0	0	0	112.7
106	D	45.9	Very low	52.1	Low	140 Å²	140	160.2 Å²	160.2	75%	0.749	83%	0.825	S	S	*	*				63.1	101.4	99.5	-158.5	29.3	0	0	0	115.6
107	D	54.3	Low	52.7	Low	141 Å²	141	160.2 Å²	160.2	75%	0.754	83%	0.829	S	S	*	*			trans	31.7	107.2	139.4	-59.2	-16.2	0	0	0	120.2
108	S	66.3	Low	53.8	Low	99 Å²	99	164.1 Å²	164.1	69%	0.692	83%	0.832	S	S	*	*				158.5	60.5	126.9	-74.7	0	0	0	0	113	F110	S108-F110 PolarHBondContact O-N 2.91Å
109	Q	70.4	Confident	54.8	Low	171 Å²	171	162.2 Å²	162.2	80%	0.799	83%	0.827	S	S	*	*	S	Bend	trans	-75.6	-12.2	173.7	-167.8	169.5	17.4	0	0	113.3
110	F	64.7	Low	55.8	Low	187 Å²	187	160.5 Å²	160.5	82%	0.82	82%	0.824	S	S	*	*			trans	-142.1	67.1	-175.7	-56.7	-77.4	0	0	0	112.4	S108	S108-F110 PolarHBondContact O-N 2.91Å
111	E	69.3	Low	57	Low	164 Å²	164	157.8 Å²	157.8	77%	0.766	82%	0.817	S	S	*	*			trans	-84.8	114.2	160.3	-163.1	169.5	-166.7	0	0	108.1
112	M	71.9	Confident	58	Low	164 Å²	164	155.5 Å²	155.5	81%	0.808	81%	0.812	S	S	*	*			trans	-105.7	108.8	174.5	-178.7	92.2	68	0	0	106.7	I114	M112-I114 PolarHBondContact O-N 2.99Å
113	D	74.7	Confident	59.4	Low	149 Å²	149	151.2 Å²	151.2	80%	0.797	81%	0.805	S	S	*	*			trans	-60.9	127	172.6	-69.3	-42	0	0	0	109.9
114	I	63.7	Low	61.1	Low	233 Å²	233	152.1 Å²	152.1	100%	1.195	81%	0.809	S	S	*	*			trans	-110.4	0	168.4	55.9	165.4	0	0	0	110.9	M112	M112-I114 PolarHBondContact O-N 2.99Å

Retrieved 114 of 114 residues in 148.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).