A0A087XPN3_POEFO Loading...

Cytochrome c oxidase subunit 7A2, mitochondrial

AlphaFold DB , UniProt , Accession A0A087XPN3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 83 aa.

						>A0A087XPN3_POEFO|A0A087XPN3
MFRTMNAVQQMARRSICSSARRQVENKVPQKQKMFQEDNGMPIHLKGGSSDALLYRATMVLTVLGVGFTLYELVKASFPQKKD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.2	Low	69.3	Low	200 Å²	200	125.9 Å²	125.9	99%	0.985	62%	0.622	S	S	*	*				0	-30.6	0	-132.2	161.6	174.2	0	0	114	T4	M1-T4 PolarHBondContact O-OG1 2.69Å; M1-T4 VanDerWaalsContact O-OG1 3.05Å
2	F	63.3	Low	69.1	Low	154 Å²	154	122.2 Å²	122.2	68%	0.675	63%	0.626	S	S	*	*	H	α-helix	trans	-74.9	-20.8	-178.4	-66.7	-82.6	0	0	0	116.3	M5 N6	F2-M5 HydrophobicContact CB-CE 4.31Å; F2-M5 HydrophobicContact CD1-CE 3.26Å; F2-M5 HydrophobicContact CE1-CE 3.61Å; F2-M5 HydrophobicContact CG-CE 3.89Å; F2-M5 HydrophobicContact CZ-CE 4.48Å; F2-M5 PolarHBondContact O-N 3.38Å; F2-N6 PolarHBondContact O-N 2.93Å
3	R	65	Low	68.8	Low	226 Å²	226	127.6 Å²	127.6	85%	0.853	63%	0.634	S	S	*	*	H	α-helix	trans	-68.4	-39.9	-178.4	-70.4	175.7	124.4	179	-0.9	113.1	A7	R3-A7 PolarHBondContact O-N 3.15Å; R3-A7 VanDerWaalsContact O-N 3.08Å
4	T	71.8	Confident	68.4	Low	96 Å²	96	131.7 Å²	131.7	59%	0.589	64%	0.639	S	S	*	*	H	α-helix	trans	-68.6	-38.4	176.2	41.9	0	0	0	0	111.2	M1 A7 V8	M1-T4 PolarHBondContact O-OG1 2.69Å; M1-T4 VanDerWaalsContact O-OG1 3.05Å; T4-A7 PolarHBondContact O-N 3.19Å; T4-V8 VanDerWaalsContact O-CG2 3.32Å; T4-V8 WeakPolarHBondContact O-CG2 3.32Å; T4-V8 PolarHBondContact O-N 2.94Å
5	M	70.4	Confident	67.9	Low	98 Å²	98	129.5 Å²	129.5	48%	0.483	64%	0.642	S	S	.	*	H	α-helix	trans	-63.8	-42.8	175.7	-65.2	-169	-69	0	0	112.2	F2 A7 V8 Q9	F2-M5 HydrophobicContact CB-CE 4.31Å; F2-M5 HydrophobicContact CD1-CE 3.26Å; F2-M5 HydrophobicContact CE1-CE 3.61Å; F2-M5 HydrophobicContact CG-CE 3.89Å; F2-M5 HydrophobicContact CZ-CE 4.48Å; F2-M5 PolarHBondContact O-N 3.38Å; M5-A7 PolarHBondContact O-N 3.46Å; M5-V8 PolarHBondContact O-N 3.12Å; M5-Q9 WeakPolarHBondContact O-CB 3.46Å; M5-Q9 PolarHBondContact O-N 3.39Å
6	N	72.4	Confident	67.5	Low	92 Å²	92	130.9 Å²	130.9	49%	0.492	65%	0.65	S	S	.	*	H	α-helix	trans	-66.1	-35.9	175.3	-71.8	-18.6	0	0	0	112.6	F2 Q9 Q10	F2-N6 PolarHBondContact O-N 2.93Å; N6-Q9 PolarHBondContact O-N 3.32Å; N6-Q10 WeakPolarHBondContact O-CB 3.41Å; N6-Q10 WeakPolarHBondContact O-CG 3.33Å; N6-Q10 PolarHBondContact O-N 3.35Å
7	A	74.1	Confident	66.9	Low	48 Å²	48	129.1 Å²	129.1	40%	0.397	65%	0.652	S	S	.	*	H	α-helix	trans	-66.8	-41.7	175.4	0	0	0	0	0	111.9	R3 T4 M5 Q10 M11	R3-A7 PolarHBondContact O-N 3.15Å; R3-A7 VanDerWaalsContact O-N 3.08Å; T4-A7 PolarHBondContact O-N 3.19Å; M5-A7 PolarHBondContact O-N 3.46Å; A7-Q10 PolarHBondContact O-N 3.33Å; A7-M11 WeakPolarHBondContact O-CG 3.32Å; A7-M11 PolarHBondContact O-N 3.44Å
8	V	71.5	Confident	66.4	Low	100 Å²	100	127.5 Å²	127.5	61%	0.606	66%	0.655	S	S	*	*	H	α-helix	trans	-64.6	-42.2	173.6	172	0	0	0	0	110.8	T4 M5 Q10 M11 A12	T4-V8 VanDerWaalsContact O-CG2 3.32Å; T4-V8 WeakPolarHBondContact O-CG2 3.32Å; T4-V8 PolarHBondContact O-N 2.94Å; M5-V8 PolarHBondContact O-N 3.12Å; V8-Q10 VanDerWaalsContact C-N 3.33Å; V8-Q10 PolarHBondContact O-N 2.86Å; V8-M11 PolarHBondContact O-N 3.38Å; V8-A12 WeakPolarHBondContact O-CB 3.22Å; V8-A12 PolarHBondContact O-N 2.82Å
9	Q	72.6	Confident	66	Low	90 Å²	90	125 Å²	125	42%	0.421	65%	0.65	S	S	.	*	H	α-helix	trans	-64.7	-36.6	176.6	-163.1	-170.2	-34.9	0	0	112	M5 N6 R13	M5-Q9 WeakPolarHBondContact O-CB 3.46Å; M5-Q9 PolarHBondContact O-N 3.39Å; N6-Q9 PolarHBondContact O-N 3.32Å; Q9-R13 VanDerWaalsContact NE2-NH2 3.16Å; Q9-R13 WeakPolarHBondContact O-CB 3.36Å; Q9-R13 VanDerWaalsContact O-CG 3.24Å; Q9-R13 WeakPolarHBondContact O-CG 3.22Å; Q9-R13 PolarHBondContact O-N 2.87Å
10	Q	71.5	Confident	65.7	Low	148 Å²	148	123.2 Å²	123.2	69%	0.692	65%	0.654	S	S	*	*	H	α-helix	trans	-68.2	-38	172.5	-80.8	-170.6	-29	0	0	112.5	N6 A7 V8 R13 R14	N6-Q10 WeakPolarHBondContact O-CB 3.41Å; N6-Q10 WeakPolarHBondContact O-CG 3.33Å; N6-Q10 PolarHBondContact O-N 3.35Å; A7-Q10 PolarHBondContact O-N 3.33Å; V8-Q10 VanDerWaalsContact C-N 3.33Å; V8-Q10 PolarHBondContact O-N 2.86Å; Q10-R13 PolarHBondContact O-N 3.4Å; Q10-R14 PolarHBondContact O-N 2.91Å
11	M	67.6	Low	65.4	Low	133 Å²	133	127.1 Å²	127.1	66%	0.655	66%	0.66	S	S	*	*	H	α-helix	trans	-69.6	-37.1	175.1	-74.1	-167.8	158.8	0	0	112.5	A7 V8 R13 R14	A7-M11 WeakPolarHBondContact O-CG 3.32Å; A7-M11 PolarHBondContact O-N 3.44Å; V8-M11 PolarHBondContact O-N 3.38Å; M11-R13 VanDerWaalsContact C-N 3.34Å; M11-R14 WeakPolarHBondContact O-CB 3.32Å; M11-R14 PolarHBondContact O-N 3.28Å
12	A	66.6	Low	65.4	Low	81 Å²	81	128.6 Å²	128.6	67%	0.669	65%	0.654	S	S	*	*	H	α-helix	trans	-71.3	-27.7	174.7	0	0	0	0	0	112.9	V8	V8-A12 WeakPolarHBondContact O-CB 3.22Å; V8-A12 PolarHBondContact O-N 2.82Å
13	R	65.4	Low	65.5	Low	193 Å²	193	129.7 Å²	129.7	73%	0.728	66%	0.662	S	S	*	*	H	α-helix	trans	-80.4	-11.9	173.5	-77.7	178	172.4	-172.8	-2.4	113.8	Q9 Q10 M11 S15	Q9-R13 VanDerWaalsContact NE2-NH2 3.16Å; Q9-R13 WeakPolarHBondContact O-CB 3.36Å; Q9-R13 VanDerWaalsContact O-CG 3.24Å; Q9-R13 WeakPolarHBondContact O-CG 3.22Å; Q9-R13 PolarHBondContact O-N 2.87Å; Q10-R13 PolarHBondContact O-N 3.4Å; M11-R13 VanDerWaalsContact C-N 3.34Å; R13-S15 PolarHBondContact O-N 3Å
14	R	62.9	Low	66.2	Low	185 Å²	185	124.8 Å²	124.8	70%	0.698	66%	0.656	S	S	*	*	S	Bend	trans	-68.4	106.6	163.6	-71.1	-176.2	170.4	-177	-3.2	106.2	Q10 M11 I16	Q10-R14 PolarHBondContact O-N 2.91Å; M11-R14 WeakPolarHBondContact O-CB 3.32Å; M11-R14 PolarHBondContact O-N 3.28Å; R14-I16 PolarHBondContact O-N 3.47Å
15	S	61.6	Low	67	Low	98 Å²	98	125.8 Å²	125.8	69%	0.685	65%	0.654	S	S	*	*			trans	-49.5	110.2	169.3	-175.6	0	0	0	0	107.6	R13 C17	R13-S15 PolarHBondContact O-N 3Å; S15-C17 PolarHBondContact O-N 2.92Å
16	I	61.5	Low	68	Low	152 Å²	152	126.2 Å²	126.2	78%	0.779	66%	0.659	S	S	*	*			trans	-74.4	76.5	171.3	-54.8	179	0	0	0	105.1	R14 S18	R14-I16 PolarHBondContact O-N 3.47Å; I16-S18 PolarHBondContact O-N 3.43Å
17	C	56.3	Low	69.1	Low	101 Å²	101	126.7 Å²	126.7	68%	0.682	66%	0.656	S	S	*	*			trans	-68.4	77.9	161.8	-86.7	0	0	0	0	106.9	S15 S19	S15-C17 PolarHBondContact O-N 2.92Å; C17-S19 PolarHBondContact O-N 3.32Å
18	S	58.8	Low	70.2	Confident	100 Å²	100	128.2 Å²	128.2	70%	0.699	66%	0.661	S	S	*	*			trans	-74.4	56.4	163.8	-167.3	0	0	0	0	109.1	I16 A20	I16-S18 PolarHBondContact O-N 3.43Å; S18-A20 PolarHBondContact O-N 3.24Å
19	S	59.3	Low	71.4	Confident	80 Å²	80	126.9 Å²	126.9	56%	0.559	65%	0.654	S	S	*	*			trans	-82.2	81	144.9	63	0	0	0	0	104.1	C17 R21	C17-S19 PolarHBondContact O-N 3.32Å; S19-R21 PolarHBondContact O-N 2.99Å
20	A	58.7	Low	72.5	Confident	88 Å²	88	126.8 Å²	126.8	73%	0.727	65%	0.654	S	S	*	*			trans	-56.4	91.8	154.6	0	0	0	0	0	104.4	S18 R22	S18-A20 PolarHBondContact O-N 3.24Å; A20-R22 PolarHBondContact O-N 3.39Å
21	R	60.1	Low	73.7	Confident	206 Å²	206	125.4 Å²	125.4	78%	0.777	65%	0.645	S	S	*	*			trans	-63.2	99.9	175.5	-63.5	-159.4	-168.2	-165.7	7.3	102.7	S19 Q23	S19-R21 PolarHBondContact O-N 2.99Å; R21-Q23 HydrophobicContact CB-CG 4.17Å; R21-Q23 PolarHBondContact O-N 3.43Å
22	R	61.3	Low	75.2	Confident	231 Å²	231	123.8 Å²	123.8	87%	0.872	64%	0.636	S	S	*	*			trans	-54.9	94	144	-90.1	-175.3	176	175	-0.4	102.5	A20 V24	A20-R22 PolarHBondContact O-N 3.39Å; R22-V24 HydrophobicContact CB-CG2 4.12Å; R22-V24 PolarHBondContact O-N 3.03Å
23	Q	65.8	Low	76.6	Confident	177 Å²	177	128.1 Å²	128.1	83%	0.827	64%	0.64	S	S	*	*			trans	-66.6	75.2	167.7	-87.8	-176.9	-61.1	0	0	104.8	R21 E25	R21-Q23 HydrophobicContact CB-CG 4.17Å; R21-Q23 PolarHBondContact O-N 3.43Å; Q23-E25 PolarHBondContact O-N 2.87Å
24	V	81	Confident	78.1	Confident	123 Å²	123	122.4 Å²	122.4	75%	0.745	62%	0.622	S	S	*	*			trans	-64.9	116.1	162.8	-177.1	0	0	0	0	103.6	R22 N26	R22-V24 HydrophobicContact CB-CG2 4.12Å; R22-V24 PolarHBondContact O-N 3.03Å; V24-N26 PolarHBondContact O-N 3.48Å
25	E	88.4	Confident	79.7	Confident	117 Å²	117	117.4 Å²	117.4	55%	0.547	61%	0.606	S	S	.	*			trans	-55.2	135.6	177.3	-167	-166.4	138.3	0	0	109	Q23 K27	Q23-E25 PolarHBondContact O-N 2.87Å; E25-K27 PolarHBondContact O-N 3.43Å; E25-K27 IonicContact OE1-NZ 2.69Å; E25-K27 PolarHBondContact OE1-NZ 2.98Å; E25-K27 WeakPolarHBondContact OE2-CE 3.5Å; E25-K27 IonicContact OE2-NZ 3.98Å; E25-K27 PolarHBondContact OE2-NZ 2.98Å
26	N	91.2	Very high	81.5	Confident	107 Å²	107	119.8 Å²	119.8	57%	0.572	61%	0.606	S	S	*	*			trans	-65.4	110.7	176.7	-178.1	-1.4	0	0	0	109.5	V24 V28 Q30	V24-N26 PolarHBondContact O-N 3.48Å; N26-V28 VanDerWaalsContact OD1-CB 3.23Å; N26-V28 WeakPolarHBondContact OD1-CB 3.28Å; N26-V28 VanDerWaalsContact OD1-CG2 3.29Å; N26-V28 WeakPolarHBondContact OD1-CG2 3.48Å; N26-V28 PolarHBondContact OD1-N 2.95Å; N26-Q30 PolarHBondContact O-OE1 3.3Å
27	K	94.7	Very high	83.2	Confident	102 Å²	102	118 Å²	118	44%	0.443	60%	0.595	S	S	.	*			trans	-96.3	3.8	178.1	-63.6	-60.1	-177.3	-170.9	0	114.3	E25 Q30 K31	E25-K27 PolarHBondContact O-N 3.43Å; E25-K27 IonicContact OE1-NZ 2.69Å; E25-K27 PolarHBondContact OE1-NZ 2.98Å; E25-K27 WeakPolarHBondContact OE2-CE 3.5Å; E25-K27 IonicContact OE2-NZ 3.98Å; E25-K27 PolarHBondContact OE2-NZ 2.98Å; K27-Q30 PolarHBondContact O-N 2.84Å; K27-Q30 PolarHBondContact O-OE1 3.43Å; K27-Q30 VanDerWaalsContact O-OE1 3.05Å; K27-K31 WeakPolarHBondContact O-CG 3.45Å; K27-K31 PolarHBondContact O-N 2.85Å; K27-K31 VanDerWaalsContact O-N 3.13Å
28	V	96.7	Very high	85.1	Confident	81 Å²	81	120.9 Å²	120.9	49%	0.491	60%	0.603	S	S	.	*	H	α-helix	trans	-60.3	-47.3	-176.9	174.7	0	0	0	0	112.2	N26 Q30 K31 Q32	N26-V28 VanDerWaalsContact OD1-CB 3.23Å; N26-V28 WeakPolarHBondContact OD1-CB 3.28Å; N26-V28 VanDerWaalsContact OD1-CG2 3.29Å; N26-V28 WeakPolarHBondContact OD1-CG2 3.48Å; N26-V28 PolarHBondContact OD1-N 2.95Å; V28-Q30 VanDerWaalsContact C-N 3.28Å; V28-Q30 PolarHBondContact O-N 2.88Å; V28-K31 PolarHBondContact O-N 2.9Å; V28-K31 VanDerWaalsContact O-N 3.15Å; V28-Q32 HydrophobicContact CG1-CG 4.07Å; V28-Q32 WeakPolarHBondContact O-CG 3.31Å; V28-Q32 PolarHBondContact O-N 2.97Å
29	P	97.4	Very high	86.8	Confident	72 Å²	72	118.9 Å²	118.9	47%	0.468	59%	0.585	S	S	.	*	H	α-helix	trans	-60.2	-37.3	180	-25	35.7	0	0	0	113.2	Q32 K33	P29-Q32 PolarHBondContact O-N 3.28Å; P29-K33 PolarHBondContact O-N 2.93Å
30	Q	96.4	Very high	88.6	Confident	87 Å²	87	118.5 Å²	118.5	41%	0.407	59%	0.593	S	S	.	*	H	α-helix	trans	-67.2	-41.2	178.1	-60.4	85.7	-17.5	0	0	110.9	N26 K27 V28 M34	N26-Q30 PolarHBondContact O-OE1 3.3Å; K27-Q30 PolarHBondContact O-N 2.84Å; K27-Q30 PolarHBondContact O-OE1 3.43Å; K27-Q30 VanDerWaalsContact O-OE1 3.05Å; V28-Q30 VanDerWaalsContact C-N 3.28Å; V28-Q30 PolarHBondContact O-N 2.88Å; Q30-M34 PolarHBondContact O-N 3.34Å; Q30-M34 VanDerWaalsContact O-N 3.11Å
31	K	96.2	Very high	90.3	Very high	120 Å²	120	118.1 Å²	118.1	52%	0.522	58%	0.577	S	S	.	*	H	α-helix	trans	-69.4	-41.3	176.1	-65.5	-63.6	-177.8	179.2	0	111.8	K27 V28 K33 M34 F35	K27-K31 WeakPolarHBondContact O-CG 3.45Å; K27-K31 PolarHBondContact O-N 2.85Å; K27-K31 VanDerWaalsContact O-N 3.13Å; V28-K31 PolarHBondContact O-N 2.9Å; V28-K31 VanDerWaalsContact O-N 3.15Å; K31-K33 VanDerWaalsContact C-N 3.33Å; K31-K33 PolarHBondContact O-N 3.38Å; K31-M34 PolarHBondContact O-N 2.9Å; K31-F35 WeakPolarHBondContact O-CD2 3.46Å; K31-F35 PolarHBondContact O-N 3.36Å
32	Q	98.2	Very high	92.1	Very high	99 Å²	99	111.3 Å²	111.3	46%	0.463	56%	0.559	S	S	.	*	H	α-helix	trans	-56.9	-47.4	173.6	-75.7	174.9	-28	0	0	111	V28 P29 M34 F35 Q36	V28-Q32 HydrophobicContact CG1-CG 4.07Å; V28-Q32 WeakPolarHBondContact O-CG 3.31Å; V28-Q32 PolarHBondContact O-N 2.97Å; P29-Q32 PolarHBondContact O-N 3.28Å; Q32-M34 VanDerWaalsContact C-N 3.35Å; Q32-M34 PolarHBondContact O-N 3.02Å; Q32-F35 PolarHBondContact O-N 2.92Å; Q32-Q36 WeakPolarHBondContact O-CB 3.47Å; Q32-Q36 WeakPolarHBondContact O-CG 3.34Å; Q32-Q36 PolarHBondContact O-N 3.39Å
33	K	97.4	Very high	93.8	Very high	172 Å²	172	106.2 Å²	106.2	75%	0.748	55%	0.548	S	S	*	.	H	α-helix	trans	-57.9	-45.2	175.9	-174.7	176.1	179.2	180	0	112.5	P29 K31 E37	P29-K33 PolarHBondContact O-N 2.93Å; K31-K33 VanDerWaalsContact C-N 3.33Å; K31-K33 PolarHBondContact O-N 3.38Å; K33-E37 PolarHBondContact O-N 3.42Å; K33-E37 VanDerWaalsContact O-N 3.15Å
34	M	96.6	Very high	95.2	Very high	72 Å²	72	102.7 Å²	102.7	36%	0.355	53%	0.531	S	S	.	.	H	α-helix	trans	-64.1	-46.8	179.4	-177.5	-176.6	179	0	0	112.4	Q30 K31 Q32 G47	Q30-M34 PolarHBondContact O-N 3.34Å; Q30-M34 VanDerWaalsContact O-N 3.11Å; K31-M34 PolarHBondContact O-N 2.9Å; Q32-M34 VanDerWaalsContact C-N 3.35Å; Q32-M34 PolarHBondContact O-N 3.02Å; M34-G47 WeakPolarHBondContact CE-O 3.45Å
35	F	97.3	Very high	96	Very high	81 Å²	81	99 Å²	99	36%	0.355	51%	0.507	S	S	.	.	H	α-helix	trans	-80	-20.2	-176.2	-78.9	-81.2	0	0	0	113.8	K31 Q32 I43 K46	K31-F35 WeakPolarHBondContact O-CD2 3.46Å; K31-F35 PolarHBondContact O-N 3.36Å; Q32-F35 PolarHBondContact O-N 2.92Å; F35-I43 HydrophobicContact CD1-CD1 3.84Å; F35-I43 HydrophobicContact CE1-CD1 4.43Å; F35-K46 HydrophobicContact CB-CG 4.48Å; F35-K46 HydrophobicContact CD1-CB 3.68Å; F35-K46 HydrophobicContact CD1-CG 3.57Å; F35-K46 HydrophobicContact CE1-CB 3.81Å; F35-K46 HydrophobicContact CE1-CG 4.17Å; F35-K46 HydrophobicContact CG-CG 4.33Å; F35-K46 VanDerWaalsContact O-CE 3.27Å; F35-K46 WeakPolarHBondContact O-CE 3.3Å
36	Q	97.9	Very high	96.5	Very high	147 Å²	147	94.2 Å²	94.2	69%	0.687	49%	0.485	S	S	*	.	H	α-helix	trans	-97.3	-1.9	176.9	-62.7	174	22.3	0	0	113.5	Q32 D38	Q32-Q36 WeakPolarHBondContact O-CB 3.47Å; Q32-Q36 WeakPolarHBondContact O-CG 3.34Å; Q32-Q36 PolarHBondContact O-N 3.39Å; Q36-D38 PolarHBondContact O-N 2.95Å
37	E	96.7	Very high	96.7	Very high	116 Å²	116	90.3 Å²	90.3	54%	0.542	47%	0.47	S	S	.	.			trans	-57	129.3	173.2	-177	-179.5	-141.5	0	0	110.5	K33 N39 K46	K33-E37 PolarHBondContact O-N 3.42Å; K33-E37 VanDerWaalsContact O-N 3.15Å; E37-N39 HydrophobicContact CG-CB 4.24Å; E37-N39 PolarHBondContact O-N 2.94Å; E37-N39 PolarHBondContact OE2-ND2 3.39Å; E37-K46 VanDerWaalsContact O-CE 3.3Å; E37-K46 WeakPolarHBondContact O-CE 3.46Å; E37-K46 PolarHBondContact O-NZ 2.93Å
38	D	96.7	Very high	96.7	Very high	161 Å²	161	86.7 Å²	86.7	86%	0.861	46%	0.462	S	S	*	.			trans	-83	67.7	-178.9	-168.5	17.9	0	0	0	111.9	Q36	Q36-D38 PolarHBondContact O-N 2.95Å
39	N	95.5	Very high	96.7	Very high	58 Å²	58	88 Å²	88	31%	0.31	47%	0.474	S	S	.	.	S	Bend	trans	-102.6	11.1	179.5	61.7	26.8	0	0	0	113.1	E37 M41 K46	E37-N39 HydrophobicContact CG-CB 4.24Å; E37-N39 PolarHBondContact O-N 2.94Å; E37-N39 PolarHBondContact OE2-ND2 3.39Å; N39-M41 WeakPolarHBondContact ND2-CE 3.26Å; N39-M41 PolarHBondContact O-N 2.67Å; N39-M41 VanDerWaalsContact OD1-CB 3.31Å; N39-M41 WeakPolarHBondContact OD1-CB 3.5Å; N39-M41 WeakPolarHBondContact OD1-CG 3.42Å; N39-M41 PolarHBondContact OD1-N 3.13Å; N39-M41 VanDerWaalsContact OD1-N 3.13Å; N39-K46 WeakPolarHBondContact OD1-CE 3.33Å; N39-K46 PolarHBondContact OD1-NZ 3.34Å
40	G	96	Very high	96.8	Very high	71 Å²	71	88.8 Å²	88.8	73%	0.732	48%	0.482	S	S	*	.			trans	66.4	-0.4	-179.9	0	0	0	0	0	116.1
41	M	95.9	Very high	96.9	Very high	81 Å²	81	87 Å²	87	40%	0.399	47%	0.474	S	S	.	.			trans	-72.3	138.4	179.9	-66.9	-161.7	-70.8	0	0	111.9	N39 K46	N39-M41 WeakPolarHBondContact ND2-CE 3.26Å; N39-M41 PolarHBondContact O-N 2.67Å; N39-M41 VanDerWaalsContact OD1-CB 3.31Å; N39-M41 WeakPolarHBondContact OD1-CB 3.5Å; N39-M41 WeakPolarHBondContact OD1-CG 3.42Å; N39-M41 PolarHBondContact OD1-N 3.13Å; N39-M41 VanDerWaalsContact OD1-N 3.13Å; M41-K46 HydrophobicContact CB-CD 3.89Å; M41-K46 HydrophobicContact CE-CD 4.28Å
42	P	96.5	Very high	96.9	Very high	62 Å²	62	82.5 Å²	82.5	40%	0.403	46%	0.46	S	S	.	.			trans	-67.2	151.2	173.6	30.4	-35.5	0	0	0	111.1	H44 L45 K46	P42-H44 PolarHBondContact O-N 3.01Å; P42-H44 VanDerWaalsContact O-N 3.1Å; P42-L45 HydrophobicContact CG-CB 4.29Å; P42-L45 HydrophobicContact CG-CD1 4.01Å; P42-L45 HydrophobicContact CG-CG 4.24Å; P42-L45 PolarHBondContact O-N 2.69Å; P42-K46 PolarHBondContact O-N 2.9Å
43	I	96.9	Very high	96.9	Very high	124 Å²	124	83.8 Å²	83.8	64%	0.636	47%	0.469	S	S	*	.	G	3₁₀ helix	trans	-56.8	-33.2	-171.2	-170.9	59.9	0	0	0	114.1	F35 L45 K46	F35-I43 HydrophobicContact CD1-CD1 3.84Å; F35-I43 HydrophobicContact CE1-CD1 4.43Å; I43-L45 VanDerWaalsContact C-N 3.27Å; I43-L45 PolarHBondContact O-N 3.1Å; I43-K46 HydrophobicContact CD1-CB 4.39Å; I43-K46 WeakPolarHBondContact O-CB 3.37Å; I43-K46 PolarHBondContact O-N 3.36Å
44	H	96.6	Very high	97	Very high	103 Å²	103	81 Å²	81	48%	0.477	46%	0.462	S	S	.	.	G	3₁₀ helix	trans	-78.8	-3.1	-179.2	65	-93.9	0	0	0	114.4	P42 D51	P42-H44 PolarHBondContact O-N 3.01Å; P42-H44 VanDerWaalsContact O-N 3.1Å; H44-D51 WeakPolarHBondContact O-CB 3.17Å
45	L	97.6	Very high	97.1	Very high	45 Å²	45	82.9 Å²	82.9	24%	0.236	47%	0.466	C	S	.	.	G	3₁₀ helix	trans	-119	-0.6	171.4	-62.3	178.5	0	0	0	112.2	P42 I43 G47 G48 A52 Y55	P42-L45 HydrophobicContact CG-CB 4.29Å; P42-L45 HydrophobicContact CG-CD1 4.01Å; P42-L45 HydrophobicContact CG-CG 4.24Å; P42-L45 PolarHBondContact O-N 2.69Å; I43-L45 VanDerWaalsContact C-N 3.27Å; I43-L45 PolarHBondContact O-N 3.1Å; L45-G47 PolarHBondContact O-N 3.23Å; L45-G48 PolarHBondContact O-N 2.99Å; L45-A52 HydrophobicContact CD2-CB 4.21Å; L45-Y55 HydrophobicContact CD2-CG 4.4Å
46	K	97.2	Very high	97.2	Very high	18 Å²	18	87.5 Å²	87.5	8%	0.078	48%	0.481	C	S	.	.	T	Hydrogen-bonded Turn	trans	-69.2	-21.8	-169.7	-162.1	73.5	167.8	-158.3	0	112.8	F35 E37 N39 M41 P42 I43 G48	F35-K46 HydrophobicContact CB-CG 4.48Å; F35-K46 HydrophobicContact CD1-CB 3.68Å; F35-K46 HydrophobicContact CD1-CG 3.57Å; F35-K46 HydrophobicContact CE1-CB 3.81Å; F35-K46 HydrophobicContact CE1-CG 4.17Å; F35-K46 HydrophobicContact CG-CG 4.33Å; F35-K46 VanDerWaalsContact O-CE 3.27Å; F35-K46 WeakPolarHBondContact O-CE 3.3Å; E37-K46 VanDerWaalsContact O-CE 3.3Å; E37-K46 WeakPolarHBondContact O-CE 3.46Å; E37-K46 PolarHBondContact O-NZ 2.93Å; N39-K46 WeakPolarHBondContact OD1-CE 3.33Å; N39-K46 PolarHBondContact OD1-NZ 3.34Å; M41-K46 HydrophobicContact CB-CD 3.89Å; M41-K46 HydrophobicContact CE-CD 4.28Å; P42-K46 PolarHBondContact O-N 2.9Å; I43-K46 HydrophobicContact CD1-CB 4.39Å; I43-K46 WeakPolarHBondContact O-CB 3.37Å; I43-K46 PolarHBondContact O-N 3.36Å; K46-G48 PolarHBondContact O-N 3.03Å
47	G	95.5	Very high	97.2	Very high	25 Å²	25	83 Å²	83	26%	0.258	47%	0.469	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.2	-7.6	172.6	0	0	0	0	0	114.2	M34 L45 D51	M34-G47 WeakPolarHBondContact CE-O 3.45Å; L45-G47 PolarHBondContact O-N 3.23Å; G47-D51 WeakPolarHBondContact CA-OD2 3.45Å; G47-D51 PolarHBondContact N-OD2 3.26Å
48	G	96.3	Very high	97.3	Very high	26 Å²	26	81 Å²	81	27%	0.268	47%	0.465	S	S	.	.			trans	96.1	-144.9	172.2	0	0	0	0	0	114	L45 K46 S50 D51 A52	L45-G48 PolarHBondContact O-N 2.99Å; K46-G48 PolarHBondContact O-N 3.03Å; G48-S50 VanDerWaalsContact C-N 3.29Å; G48-S50 PolarHBondContact O-N 3.36Å; G48-D51 WeakPolarHBondContact O-CB 3.31Å; G48-D51 PolarHBondContact O-N 3.45Å; G48-D51 VanDerWaalsContact O-N 3.11Å; G48-A52 PolarHBondContact O-N 3.39Å
49	S	96.9	Very high	97.4	Very high	108 Å²	108	77.3 Å²	77.3	76%	0.755	44%	0.443	S	S	*	.	H	α-helix	trans	-61.4	-31.6	-169.2	-52	0	0	0	0	114.6	A52 L53	S49-A52 PolarHBondContact O-N 2.94Å; S49-L53 WeakPolarHBondContact O-CB 3.38Å; S49-L53 PolarHBondContact O-N 3.3Å
50	S	97.8	Very high	97.6	Very high	89 Å²	89	78.8 Å²	78.8	62%	0.622	45%	0.454	S	S	*	.	H	α-helix	trans	-64.8	-43.3	176.6	-171.2	0	0	0	0	111.4	G48 A52 L53 L54	G48-S50 VanDerWaalsContact C-N 3.29Å; G48-S50 PolarHBondContact O-N 3.36Å; S50-A52 VanDerWaalsContact C-N 3.34Å; S50-L53 PolarHBondContact O-N 3.5Å; S50-L54 WeakPolarHBondContact O-CB 3.4Å; S50-L54 PolarHBondContact O-N 3.38Å
51	D	98.3	Very high	97.7	Very high	48 Å²	48	81.3 Å²	81.3	26%	0.257	45%	0.451	S	S	.	.	H	α-helix	trans	-64.3	-43.2	178.4	-68.2	7.2	0	0	0	110.3	H44 G47 G48 L54 Y55	H44-D51 WeakPolarHBondContact O-CB 3.17Å; G47-D51 WeakPolarHBondContact CA-OD2 3.45Å; G47-D51 PolarHBondContact N-OD2 3.26Å; G48-D51 WeakPolarHBondContact O-CB 3.31Å; G48-D51 PolarHBondContact O-N 3.45Å; G48-D51 VanDerWaalsContact O-N 3.11Å; D51-L54 PolarHBondContact O-N 3.17Å; D51-Y55 VanDerWaalsContact O-CB 3.24Å; D51-Y55 WeakPolarHBondContact O-CB 3.24Å; D51-Y55 PolarHBondContact O-N 2.84Å
52	A	97.8	Very high	97.8	Very high	26 Å²	26	80.7 Å²	80.7	22%	0.215	45%	0.452	C	S	.	.	H	α-helix	trans	-63.7	-42.3	177.6	0	0	0	0	0	112.9	L45 G48 S49 S50 R56	L45-A52 HydrophobicContact CD2-CB 4.21Å; G48-A52 PolarHBondContact O-N 3.39Å; S49-A52 PolarHBondContact O-N 2.94Å; S50-A52 VanDerWaalsContact C-N 3.34Å; A52-R56 WeakPolarHBondContact O-CB 3.25Å; A52-R56 VanDerWaalsContact O-CG 3.25Å; A52-R56 WeakPolarHBondContact O-CG 3.46Å; A52-R56 PolarHBondContact O-N 3.07Å
53	L	98.6	Very high	97.9	Very high	126 Å²	126	82.2 Å²	82.2	66%	0.66	46%	0.459	S	S	*	.	H	α-helix	trans	-63.8	-47.6	176	179.1	62.5	0	0	0	110.8	S49 S50 R56 A57	S49-L53 WeakPolarHBondContact O-CB 3.38Å; S49-L53 PolarHBondContact O-N 3.3Å; S50-L53 PolarHBondContact O-N 3.5Å; L53-R56 PolarHBondContact O-N 3.42Å; L53-A57 WeakPolarHBondContact O-CB 3.27Å; L53-A57 PolarHBondContact O-N 3.15Å
54	L	98.7	Very high	98	Very high	114 Å²	114	81.9 Å²	81.9	60%	0.597	46%	0.458	S	S	*	.	H	α-helix	trans	-61.4	-47.9	179.8	-175.5	60.9	0	0	0	111	S50 D51 R56 A57 T58	S50-L54 WeakPolarHBondContact O-CB 3.4Å; S50-L54 PolarHBondContact O-N 3.38Å; D51-L54 PolarHBondContact O-N 3.17Å; L54-R56 PolarHBondContact O-N 2.94Å; L54-A57 PolarHBondContact O-N 3.39Å; L54-T58 WeakPolarHBondContact O-CB 3.36Å; L54-T58 PolarHBondContact O-N 3.11Å; L54-T58 PolarHBondContact O-OG1 3.21Å
55	Y	98.5	Very high	98.1	Very high	111 Å²	111	78.6 Å²	78.6	44%	0.435	45%	0.452	S	S	.	.	H	α-helix	trans	-55.4	-50.2	176.7	172.3	-100.8	0	0	0	112	L45 D51 A57 T58 M59	L45-Y55 HydrophobicContact CD2-CG 4.4Å; D51-Y55 VanDerWaalsContact O-CB 3.24Å; D51-Y55 WeakPolarHBondContact O-CB 3.24Å; D51-Y55 PolarHBondContact O-N 2.84Å; Y55-A57 PolarHBondContact O-N 2.92Å; Y55-T58 PolarHBondContact O-N 3.41Å; Y55-M59 HydrophobicContact CD1-CG 4.42Å; Y55-M59 HydrophobicContact CD2-CG 4.3Å; Y55-M59 HydrophobicContact CE1-CG 3.97Å; Y55-M59 HydrophobicContact CE2-CG 3.84Å; Y55-M59 HydrophobicContact CE2-SD 4.26Å; Y55-M59 WeakPolarHBondContact O-CB 3.2Å; Y55-M59 WeakPolarHBondContact O-CG 3.44Å; Y55-M59 PolarHBondContact O-N 3.42Å
56	R	98.5	Very high	98.2	Very high	178 Å²	178	80.6 Å²	80.6	67%	0.672	47%	0.466	S	S	*	.	H	α-helix	trans	-64.2	-43	-179.7	-71.4	173	-177	-175.7	1.2	112	A52 L53 L54 M59 V60	A52-R56 WeakPolarHBondContact O-CB 3.25Å; A52-R56 VanDerWaalsContact O-CG 3.25Å; A52-R56 WeakPolarHBondContact O-CG 3.46Å; A52-R56 PolarHBondContact O-N 3.07Å; L53-R56 PolarHBondContact O-N 3.42Å; L54-R56 PolarHBondContact O-N 2.94Å; R56-M59 PolarHBondContact O-N 2.88Å; R56-V60 WeakPolarHBondContact O-CG2 3.5Å; R56-V60 PolarHBondContact O-N 3.11Å
57	A	98.7	Very high	98.3	Very high	54 Å²	54	81.5 Å²	81.5	45%	0.446	48%	0.481	S	S	.	.	H	α-helix	trans	-61.3	-44.9	177.5	0	0	0	0	0	111.4	L53 L54 Y55 V60 L61	L53-A57 WeakPolarHBondContact O-CB 3.27Å; L53-A57 PolarHBondContact O-N 3.15Å; L54-A57 PolarHBondContact O-N 3.39Å; Y55-A57 PolarHBondContact O-N 2.92Å; A57-V60 PolarHBondContact O-N 3.21Å; A57-L61 WeakPolarHBondContact O-CB 3.47Å; A57-L61 PolarHBondContact O-N 2.77Å
58	T	98.7	Very high	98.4	Very high	73 Å²	73	86.5 Å²	86.5	45%	0.448	50%	0.496	S	S	.	.	H	α-helix	trans	-64.2	-42	176.6	-56.7	0	0	0	0	111.9	L54 Y55 L61 T62	L54-T58 WeakPolarHBondContact O-CB 3.36Å; L54-T58 PolarHBondContact O-N 3.11Å; L54-T58 PolarHBondContact O-OG1 3.21Å; Y55-T58 PolarHBondContact O-N 3.41Å; T58-L61 PolarHBondContact O-N 2.95Å; T58-T62 HydrophobicContact CG2-CG2 4.34Å; T58-T62 WeakPolarHBondContact O-CB 3.07Å; T58-T62 VanDerWaalsContact O-CG2 3.31Å; T58-T62 WeakPolarHBondContact O-CG2 3.44Å; T58-T62 PolarHBondContact O-N 3.41Å; T58-T62 PolarHBondContact O-OG1 3.29Å
59	M	98.8	Very high	98.5	Very high	83 Å²	83	89.7 Å²	89.7	41%	0.409	51%	0.51	S	S	.	.	H	α-helix	trans	-61.1	-45.6	175.4	-77.2	-61.6	-60.9	0	0	111.9	Y55 R56 T62 V63	Y55-M59 HydrophobicContact CD1-CG 4.42Å; Y55-M59 HydrophobicContact CD2-CG 4.3Å; Y55-M59 HydrophobicContact CE1-CG 3.97Å; Y55-M59 HydrophobicContact CE2-CG 3.84Å; Y55-M59 HydrophobicContact CE2-SD 4.26Å; Y55-M59 WeakPolarHBondContact O-CB 3.2Å; Y55-M59 WeakPolarHBondContact O-CG 3.44Å; Y55-M59 PolarHBondContact O-N 3.42Å; R56-M59 PolarHBondContact O-N 2.88Å; M59-T62 WeakPolarHBondContact CA-OG1 3.4Å; M59-T62 PolarHBondContact O-N 2.98Å; M59-T62 PolarHBondContact O-OG1 3.37Å; M59-V63 WeakPolarHBondContact O-CB 3.33Å; M59-V63 VanDerWaalsContact O-CG2 3.28Å; M59-V63 WeakPolarHBondContact O-CG2 3.23Å; M59-V63 PolarHBondContact O-N 3.13Å
60	V	98.9	Very high	98.6	Very high	89 Å²	89	89.3 Å²	89.3	54%	0.539	50%	0.499	S	S	.	.	H	α-helix	trans	-61	-49	176.9	169.3	0	0	0	0	110.7	R56 A57 T62 V63 L64	R56-V60 WeakPolarHBondContact O-CG2 3.5Å; R56-V60 PolarHBondContact O-N 3.11Å; A57-V60 PolarHBondContact O-N 3.21Å; V60-T62 VanDerWaalsContact C-N 3.33Å; V60-T62 PolarHBondContact O-N 3.43Å; V60-V63 PolarHBondContact O-N 3.15Å; V60-L64 HydrophobicContact CG1-CD1 3.8Å; V60-L64 HydrophobicContact CG1-CG 4.32Å; V60-L64 WeakPolarHBondContact O-CB 3.34Å; V60-L64 VanDerWaalsContact O-CG 3.26Å; V60-L64 WeakPolarHBondContact O-CG 3.36Å; V60-L64 PolarHBondContact O-N 2.91Å
61	L	98.8	Very high	98.6	Very high	125 Å²	125	91.8 Å²	91.8	65%	0.654	50%	0.496	S	S	*	.	H	α-helix	trans	-59.9	-43.1	-179.6	-179.7	62.3	0	0	0	112.1	A57 T58 G65	A57-L61 WeakPolarHBondContact O-CB 3.47Å; A57-L61 PolarHBondContact O-N 2.77Å; T58-L61 PolarHBondContact O-N 2.95Å; L61-G65 PolarHBondContact O-N 3.35Å
62	T	98.8	Very high	98.6	Very high	68 Å²	68	92.9 Å²	92.9	42%	0.417	50%	0.499	S	S	.	.	H	α-helix	trans	-70.4	-42.4	-178.9	49.7	0	0	0	0	112.3	T58 M59 V60 G65 V66	T58-T62 HydrophobicContact CG2-CG2 4.34Å; T58-T62 WeakPolarHBondContact O-CB 3.07Å; T58-T62 VanDerWaalsContact O-CG2 3.31Å; T58-T62 WeakPolarHBondContact O-CG2 3.44Å; T58-T62 PolarHBondContact O-N 3.41Å; T58-T62 PolarHBondContact O-OG1 3.29Å; M59-T62 WeakPolarHBondContact CA-OG1 3.4Å; M59-T62 PolarHBondContact O-N 2.98Å; M59-T62 PolarHBondContact O-OG1 3.37Å; V60-T62 VanDerWaalsContact C-N 3.33Å; V60-T62 PolarHBondContact O-N 3.43Å; T62-G65 PolarHBondContact O-N 3.47Å; T62-V66 VanDerWaalsContact O-CG2 3.32Å; T62-V66 WeakPolarHBondContact O-CG2 3.42Å; T62-V66 PolarHBondContact O-N 2.83Å
63	V	98.8	Very high	98.6	Very high	94 Å²	94	96.4 Å²	96.4	57%	0.57	51%	0.514	S	S	*	.	H	α-helix	trans	-62.6	-44.9	175.6	171.4	0	0	0	0	111	M59 V60 V66 G67	M59-V63 WeakPolarHBondContact O-CB 3.33Å; M59-V63 VanDerWaalsContact O-CG2 3.28Å; M59-V63 WeakPolarHBondContact O-CG2 3.23Å; M59-V63 PolarHBondContact O-N 3.13Å; V60-V63 PolarHBondContact O-N 3.15Å; V63-V66 PolarHBondContact O-N 2.69Å; V63-G67 PolarHBondContact O-N 3.17Å
64	L	98.8	Very high	98.6	Very high	117 Å²	117	94.4 Å²	94.4	61%	0.613	51%	0.507	S	S	*	.	H	α-helix	trans	-62.1	-44.2	175	-71.5	178.7	0	0	0	111.7	V60 G67 F68	V60-L64 HydrophobicContact CG1-CD1 3.8Å; V60-L64 HydrophobicContact CG1-CG 4.32Å; V60-L64 WeakPolarHBondContact O-CB 3.34Å; V60-L64 VanDerWaalsContact O-CG 3.26Å; V60-L64 WeakPolarHBondContact O-CG 3.36Å; V60-L64 PolarHBondContact O-N 2.91Å; L64-G67 PolarHBondContact O-N 2.71Å; L64-F68 WeakPolarHBondContact O-CB 3.29Å; L64-F68 PolarHBondContact O-N 3.05Å
65	G	98.8	Very high	98.5	Very high	33 Å²	33	92.9 Å²	92.9	34%	0.34	50%	0.495	S	S	.	.	H	α-helix	trans	-59.2	-47.2	177.2	0	0	0	0	0	112.1	L61 T62 G67 F68 T69	L61-G65 PolarHBondContact O-N 3.35Å; T62-G65 PolarHBondContact O-N 3.47Å; G65-G67 PolarHBondContact O-N 2.74Å; G65-F68 PolarHBondContact O-N 2.69Å; G65-T69 WeakPolarHBondContact O-CB 3.44Å; G65-T69 PolarHBondContact O-N 3.3Å; G65-T69 PolarHBondContact O-OG1 2.88Å
66	V	98.8	Very high	98.4	Very high	87 Å²	87	91.4 Å²	91.4	53%	0.527	51%	0.506	S	S	.	.	H	α-helix	trans	-59.8	-46.5	175.7	169.5	0	0	0	0	110.9	T62 V63 F68 T69 L70	T62-V66 VanDerWaalsContact O-CG2 3.32Å; T62-V66 WeakPolarHBondContact O-CG2 3.42Å; T62-V66 PolarHBondContact O-N 2.83Å; V63-V66 PolarHBondContact O-N 2.69Å; V66-F68 VanDerWaalsContact C-N 3.34Å; V66-F68 PolarHBondContact O-N 2.78Å; V66-T69 PolarHBondContact O-N 3.03Å; V66-L70 HydrophobicContact CG1-CD1 4.04Å; V66-L70 HydrophobicContact CG1-CG 4.42Å; V66-L70 WeakPolarHBondContact O-CG 3.46Å; V66-L70 PolarHBondContact O-N 3.39Å
67	G	98.8	Very high	98.3	Very high	38 Å²	38	86.8 Å²	86.8	39%	0.392	50%	0.501	S	S	.	.	H	α-helix	trans	-58.7	-44.5	177.1	0	0	0	0	0	112.6	V63 L64 G65 L70 Y71	V63-G67 PolarHBondContact O-N 3.17Å; L64-G67 PolarHBondContact O-N 2.71Å; G65-G67 PolarHBondContact O-N 2.74Å; G67-L70 PolarHBondContact O-N 2.78Å; G67-Y71 PolarHBondContact O-N 2.9Å
68	F	98.7	Very high	98.1	Very high	130 Å²	130	90.8 Å²	90.8	57%	0.57	51%	0.509	S	S	*	.	H	α-helix	trans	-64.7	-44.6	177.3	-177.1	-101.4	0	0	0	112.2	L64 G65 V66 L70 Y71 E72	L64-F68 WeakPolarHBondContact O-CB 3.29Å; L64-F68 PolarHBondContact O-N 3.05Å; G65-F68 PolarHBondContact O-N 2.69Å; V66-F68 VanDerWaalsContact C-N 3.34Å; V66-F68 PolarHBondContact O-N 2.78Å; F68-L70 VanDerWaalsContact C-N 3.33Å; F68-L70 PolarHBondContact O-N 2.82Å; F68-Y71 WeakPolarHBondContact O-CB 3.33Å; F68-Y71 PolarHBondContact O-N 3.22Å; F68-E72 HydrophobicContact CD1-CG 4.36Å; F68-E72 HydrophobicContact CE1-CG 3.81Å; F68-E72 HydrophobicContact CE2-CG 4.25Å; F68-E72 HydrophobicContact CZ-CG 3.74Å; F68-E72 PolarHBondContact O-N 3.32Å
69	T	98.6	Very high	97.9	Very high	92 Å²	92	93.2 Å²	93.2	56%	0.564	53%	0.526	S	S	*	.	H	α-helix	trans	-61.6	-40.6	176.3	-59.5	0	0	0	0	111.8	G65 V66 E72 L73	G65-T69 WeakPolarHBondContact O-CB 3.44Å; G65-T69 PolarHBondContact O-N 3.3Å; G65-T69 PolarHBondContact O-OG1 2.88Å; V66-T69 PolarHBondContact O-N 3.03Å; T69-E72 PolarHBondContact O-N 3.44Å; T69-L73 WeakPolarHBondContact O-CB 3.35Å; T69-L73 PolarHBondContact O-N 3Å
70	L	98.7	Very high	97.4	Very high	101 Å²	101	94.7 Å²	94.7	53%	0.529	53%	0.531	S	S	.	.	H	α-helix	trans	-65	-41.2	175.7	-71.5	174.7	0	0	0	112	V66 G67 F68 L73 V74	V66-L70 HydrophobicContact CG1-CD1 4.04Å; V66-L70 HydrophobicContact CG1-CG 4.42Å; V66-L70 WeakPolarHBondContact O-CG 3.46Å; V66-L70 PolarHBondContact O-N 3.39Å; G67-L70 PolarHBondContact O-N 2.78Å; F68-L70 VanDerWaalsContact C-N 3.33Å; F68-L70 PolarHBondContact O-N 2.82Å; L70-L73 PolarHBondContact O-N 2.81Å; L70-V74 WeakPolarHBondContact O-CG2 3.44Å; L70-V74 PolarHBondContact O-N 3.06Å
71	Y	98.2	Very high	96.7	Very high	141 Å²	141	100 Å²	100	55%	0.553	55%	0.547	S	S	*	.	H	α-helix	trans	-59.4	-51.3	174.7	168.8	-98.1	0	0	0	111.7	G67 F68 L73 V74 K75	G67-Y71 PolarHBondContact O-N 2.9Å; F68-Y71 WeakPolarHBondContact O-CB 3.33Å; F68-Y71 PolarHBondContact O-N 3.22Å; Y71-L73 VanDerWaalsContact C-N 3.32Å; Y71-L73 PolarHBondContact O-N 2.92Å; Y71-V74 PolarHBondContact O-N 3.34Å; Y71-K75 HydrophobicContact CE1-CD 4.24Å; Y71-K75 WeakPolarHBondContact O-CB 3.38Å; Y71-K75 PolarHBondContact O-N 2.82Å
72	E	97.8	Very high	95.6	Very high	70 Å²	70	103.7 Å²	103.7	33%	0.327	56%	0.558	S	S	.	*	H	α-helix	trans	-63.5	-38.2	178.2	-75.2	-61.9	145.2	0	0	111.8	F68 T69 K75 A76	F68-E72 HydrophobicContact CD1-CG 4.36Å; F68-E72 HydrophobicContact CE1-CG 3.81Å; F68-E72 HydrophobicContact CE2-CG 4.25Å; F68-E72 HydrophobicContact CZ-CG 3.74Å; F68-E72 PolarHBondContact O-N 3.32Å; T69-E72 PolarHBondContact O-N 3.44Å; E72-K75 PolarHBondContact O-N 2.89Å; E72-K75 IonicContact OE1-NZ 2.78Å; E72-A76 WeakPolarHBondContact O-CB 3.24Å; E72-A76 PolarHBondContact O-N 3.42Å
73	L	98.3	Very high	93.9	Very high	101 Å²	101	111.6 Å²	111.6	53%	0.529	60%	0.598	S	S	.	*	H	α-helix	trans	-61.9	-47	175.8	179.8	64.2	0	0	0	111.6	T69 L70 Y71 A76 S77	T69-L73 WeakPolarHBondContact O-CB 3.35Å; T69-L73 PolarHBondContact O-N 3Å; L70-L73 PolarHBondContact O-N 2.81Å; Y71-L73 VanDerWaalsContact C-N 3.32Å; Y71-L73 PolarHBondContact O-N 2.92Å; L73-A76 PolarHBondContact O-N 3.21Å; L73-S77 WeakPolarHBondContact O-CB 3.46Å; L73-S77 PolarHBondContact O-N 3.36Å; L73-S77 PolarHBondContact O-OG 3.3Å
74	V	97.8	Very high	93.7	Very high	84 Å²	84	112.5 Å²	112.5	51%	0.509	60%	0.599	S	S	.	*	H	α-helix	trans	-63	-47	177.5	169.9	0	0	0	0	110.2	L70 Y71 A76 S77 F78	L70-V74 WeakPolarHBondContact O-CG2 3.44Å; L70-V74 PolarHBondContact O-N 3.06Å; Y71-V74 PolarHBondContact O-N 3.34Å; V74-A76 VanDerWaalsContact C-N 3.31Å; V74-A76 PolarHBondContact O-N 2.87Å; V74-S77 WeakPolarHBondContact O-CB 3.37Å; V74-S77 PolarHBondContact O-N 3.48Å; V74-S77 VanDerWaalsContact O-N 3.12Å; V74-F78 HydrophobicContact CG1-CD2 4.45Å; V74-F78 HydrophobicContact CG1-CE2 4.25Å; V74-F78 WeakPolarHBondContact O-CD2 3.32Å
75	K	96.4	Very high	93.4	Very high	82 Å²	82	112.2 Å²	112.2	36%	0.357	60%	0.598	S	S	.	*	H	α-helix	trans	-57.2	-44.6	176.5	-178.1	-176.9	171.4	-166.8	0	111.6	Y71 E72 S77 Q80	Y71-K75 HydrophobicContact CE1-CD 4.24Å; Y71-K75 WeakPolarHBondContact O-CB 3.38Å; Y71-K75 PolarHBondContact O-N 2.82Å; E72-K75 PolarHBondContact O-N 2.89Å; E72-K75 IonicContact OE1-NZ 2.78Å; K75-S77 VanDerWaalsContact C-N 3.31Å; K75-S77 PolarHBondContact O-N 2.94Å; K75-Q80 PolarHBondContact O-NE2 3.45Å
76	A	96	Very high	93.1	Very high	80 Å²	80	116.6 Å²	116.6	66%	0.661	61%	0.613	S	S	*	*	H	α-helix	trans	-70.1	-25.7	178.6	0	0	0	0	0	113.5	E72 L73 V74 F78	E72-A76 WeakPolarHBondContact O-CB 3.24Å; E72-A76 PolarHBondContact O-N 3.42Å; L73-A76 PolarHBondContact O-N 3.21Å; V74-A76 VanDerWaalsContact C-N 3.31Å; V74-A76 PolarHBondContact O-N 2.87Å; A76-F78 VanDerWaalsContact C-N 3.25Å; A76-F78 PolarHBondContact O-N 3.08Å
77	S	97.2	Very high	92.8	Very high	81 Å²	81	118.4 Å²	118.4	57%	0.566	62%	0.618	S	S	*	*	H	α-helix	trans	-71.6	-18.4	-179.4	-61.7	0	0	0	0	113.4	L73 V74 K75	L73-S77 WeakPolarHBondContact O-CB 3.46Å; L73-S77 PolarHBondContact O-N 3.36Å; L73-S77 PolarHBondContact O-OG 3.3Å; V74-S77 WeakPolarHBondContact O-CB 3.37Å; V74-S77 PolarHBondContact O-N 3.48Å; V74-S77 VanDerWaalsContact O-N 3.12Å; K75-S77 VanDerWaalsContact C-N 3.31Å; K75-S77 PolarHBondContact O-N 2.94Å
78	F	95.4	Very high	92.4	Very high	138 Å²	138	123.4 Å²	123.4	61%	0.605	63%	0.632	S	S	*	*	S	Bend	trans	-112.9	142.8	178.5	-65.4	-77	0	0	0	111.7	V74 A76 Q80	V74-F78 HydrophobicContact CG1-CD2 4.45Å; V74-F78 HydrophobicContact CG1-CE2 4.25Å; V74-F78 WeakPolarHBondContact O-CD2 3.32Å; A76-F78 VanDerWaalsContact C-N 3.25Å; A76-F78 PolarHBondContact O-N 3.08Å; F78-Q80 PolarHBondContact O-N 3.06Å; F78-Q80 PolarHBondContact O-NE2 3.44Å; F78-Q80 VanDerWaalsContact O-NE2 3.15Å
79	P	93.6	Very high	92	Very high	124 Å²	124	122.9 Å²	122.9	81%	0.805	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-61.4	123.2	178.4	25.9	-33.6	0	0	0	110
80	Q	88.1	Confident	91.5	Very high	114 Å²	114	125.1 Å²	125.1	53%	0.533	64%	0.641	S	S	.	*	P	Polyproline II helix	trans	-78.9	134.1	173.9	-57.7	-61.6	-66	0	0	108.5	K75 F78 K82	K75-Q80 PolarHBondContact O-NE2 3.45Å; F78-Q80 PolarHBondContact O-N 3.06Å; F78-Q80 PolarHBondContact O-NE2 3.44Å; F78-Q80 VanDerWaalsContact O-NE2 3.15Å; Q80-K82 PolarHBondContact O-N 3.05Å
81	K	84.7	Confident	91	Very high	200 Å²	200	127 Å²	127	87%	0.87	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-61.3	130.8	171.6	-66.2	-174.8	179.6	-177.3	0	108
82	K	75.5	Confident	90.4	Very high	203 Å²	203	125.8 Å²	125.8	88%	0.883	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-87.3	120.6	165.4	-66.8	179.4	179.4	178.5	0	105.8	Q80	Q80-K82 PolarHBondContact O-N 3.05Å
83	D	63.7	Low	89.7	Confident	233 Å²	233	130.9 Å²	130.9	100%	1.246	69%	0.688	S	S	*	*			trans	-66.8	0	159.1	-65.9	-38.9	0	0	0	109.2

Retrieved 83 of 83 residues in 83.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).