A0A087XR57_POEFO Loading...

SH3 domain-containing protein

AlphaFold DB , UniProt , Accession A0A087XR57, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 73 aa.

						>A0A087XR57_POEFO|A0A087XR57
MSPNPDTAAEELPFVPGQIIKVFGDKDSDGFYHGESGGLSGYVPSNMVAEVPVDDEYLKHVLMQQGFLPVDHA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.6	Low	71.2	Confident	230 Å²	230	95.3 Å²	95.3	100%	1.133	56%	0.561	S	S	*	*				0	132.8	0	-72.1	179.4	-159.1	0	107
2	S	58.3	Low	72.9	Confident	30 Å²	30	87.9 Å²	87.9	21%	0.21	52%	0.518	C	S	.	.			trans	-65.4	138	174.1	-179.4	0	0	0	109.6	N4 E11	S2-N4 PolarHBondContact O-N 2.9Å; S2-N4 PolarHBondContact OG-N 3.37Å; S2-N4 PolarHBondContact OG-O 3.32Å; S2-E11 WeakPolarHBondContact CB-OE1 3.37Å; S2-E11 VanDerWaalsContact CB-OE2 3.23Å; S2-E11 WeakPolarHBondContact CB-OE2 3.45Å; S2-E11 VanDerWaalsContact OG-CD 3.3Å; S2-E11 PolarHBondContact OG-OE1 2.87Å; S2-E11 PolarHBondContact OG-OE2 2.81Å
3	P	68.8	Low	74.3	Confident	125 Å²	125	88 Å²	88	81%	0.812	52%	0.522	S	S	*	.	S	Bend	trans	-68.6	-15.4	172.6	29.8	-34.8	0	0	112.5
4	N	69.9	Low	75.6	Confident	70 Å²	70	85.7 Å²	85.7	37%	0.374	50%	0.502	S	S	.	.			trans	-118.4	99.8	-179.4	-167.4	13.8	0	0	111.3	S2 D6 T7 A8	S2-N4 PolarHBondContact O-N 2.9Å; S2-N4 PolarHBondContact OG-N 3.37Å; S2-N4 PolarHBondContact OG-O 3.32Å; N4-D6 PolarHBondContact O-N 3.41Å; N4-T7 WeakPolarHBondContact CB-OG1 3.39Å; N4-T7 VanDerWaalsContact CG-OG1 3.28Å; N4-T7 PolarHBondContact ND2-OG1 2.7Å; N4-T7 PolarHBondContact O-N 3.42Å; N4-A8 PolarHBondContact O-N 2.97Å; N4-A8 VanDerWaalsContact O-N 3.12Å
5	P	66.7	Low	76.8	Confident	105 Å²	105	86.3 Å²	86.3	68%	0.682	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	-23.1	-176.6	25.6	-32.7	0	0	113.4
6	D	69.7	Low	77.8	Confident	145 Å²	145	89.4 Å²	89.4	78%	0.775	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.3	-30.9	-179.3	-62.6	-48.4	0	0	112.8	N4	N4-D6 PolarHBondContact O-N 3.41Å
7	T	69.6	Low	78.6	Confident	49 Å²	49	88.9 Å²	88.9	30%	0.301	55%	0.548	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.7	-3.2	175.5	44.9	0	0	0	113.5	N4 A9 E10 E11	N4-T7 WeakPolarHBondContact CB-OG1 3.39Å; N4-T7 VanDerWaalsContact CG-OG1 3.28Å; N4-T7 PolarHBondContact ND2-OG1 2.7Å; N4-T7 PolarHBondContact O-N 3.42Å; T7-A9 PolarHBondContact O-N 3.42Å; T7-A9 VanDerWaalsContact O-N 3.08Å; T7-E10 PolarHBondContact O-N 3.04Å; T7-E11 PolarHBondContact O-N 3.32Å
8	A	72.7	Confident	79.4	Confident	43 Å²	43	87.7 Å²	87.7	36%	0.355	54%	0.535	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.3	-24.6	-179.1	0	0	0	0	113.6	N4 E10	N4-A8 PolarHBondContact O-N 2.97Å; N4-A8 VanDerWaalsContact O-N 3.12Å; A8-E10 VanDerWaalsContact C-N 3.31Å
9	A	76.8	Confident	80.1	Confident	100 Å²	100	85.8 Å²	85.8	83%	0.826	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.5	-20.4	176.2	0	0	0	0	113.5	T7	T7-A9 PolarHBondContact O-N 3.42Å; T7-A9 VanDerWaalsContact O-N 3.08Å
10	E	84.4	Confident	80.8	Confident	112 Å²	112	83 Å²	83	52%	0.523	50%	0.503	S	S	.	.	T	Hydrogen-bonded Turn	trans	-93.8	-15.2	179.3	-54.7	-173.4	155.3	0	112.1	T7 A8 G41 Y42	T7-E10 PolarHBondContact O-N 3.04Å; A8-E10 VanDerWaalsContact C-N 3.31Å; E10-G41 CarbonylContact O-C 3.57Å; E10-G41 WeakPolarHBondContact O-CA 3.29Å; E10-Y42 HydrophobicContact CB-CD2 3.88Å; E10-Y42 HydrophobicContact CB-CE2 4.22Å; E10-Y42 PolarHBondContact O-N 3.43Å
11	E	89.2	Confident	81.4	Confident	39 Å²	39	84.7 Å²	84.7	18%	0.182	50%	0.503	C	S	.	.	B	Isolated β-bridge	trans	-76.6	138.6	175.1	-68.7	178	-157.7	0	111.5	S2 T7 P13 Y42	S2-E11 WeakPolarHBondContact CB-OE1 3.37Å; S2-E11 VanDerWaalsContact CB-OE2 3.23Å; S2-E11 WeakPolarHBondContact CB-OE2 3.45Å; S2-E11 VanDerWaalsContact OG-CD 3.3Å; S2-E11 PolarHBondContact OG-OE1 2.87Å; S2-E11 PolarHBondContact OG-OE2 2.81Å; T7-E11 PolarHBondContact O-N 3.32Å; E11-P13 WeakPolarHBondContact O-CD 3.25Å; E11-Y42 CarbonylContact C-O 3.53Å; E11-Y42 WeakPolarHBondContact CA-O 3.42Å
12	L	92.3	Very high	83.2	Confident	7 Å²	7	76.7 Å²	76.7	4%	0.037	47%	0.467	C	S	.	.	P	Polyproline II helix	trans	-72.3	125.2	174.5	-173.2	72.6	0	0	109.5	F14 I20 L39 Y42 V43	L12-F14 WeakPolarHBondContact O-CD1 3.4Å; L12-F14 WeakPolarHBondContact O-CE1 3.31Å; L12-I20 HydrophobicContact CD2-CG2 3.72Å; L12-L39 VanDerWaalsContact CD1-C 3.48Å; L12-L39 HydrophobicContact CD1-CB 3.68Å; L12-L39 VanDerWaalsContact CD1-O 3.24Å; L12-L39 WeakPolarHBondContact CD1-O 3.31Å; L12-Y42 PolarHBondContact N-O 3.4Å; L12-V43 HydrophobicContact CB-CG2 4.06Å; L12-V43 HydrophobicContact CD2-CG2 3.91Å
13	P	90.8	Very high	84.7	Confident	89 Å²	89	79.3 Å²	79.3	58%	0.578	48%	0.475	S	S	*	.	P	Polyproline II helix	trans	-76.2	129.9	172.9	29.5	-32.8	0	0	110.8	E11 L39	E11-P13 WeakPolarHBondContact O-CD 3.25Å; P13-L39 HydrophobicContact CG-CD1 3.96Å
14	F	92.8	Very high	85.8	Confident	56 Å²	56	76.4 Å²	76.4	25%	0.246	47%	0.467	C	S	.	.			trans	-147.7	166	175.7	56	-91.9	0	0	112.3	L12 Q18 I20 V43 P44 M47 V48	L12-F14 WeakPolarHBondContact O-CD1 3.4Å; L12-F14 WeakPolarHBondContact O-CE1 3.31Å; F14-Q18 HydrophobicContact CB-CB 4.49Å; F14-Q18 HydrophobicContact CB-CG 4.5Å; F14-I20 HydrophobicContact CB-CD1 3.83Å; F14-I20 HydrophobicContact CB-CG1 4.47Å; F14-I20 HydrophobicContact CD1-CD1 3.65Å; F14-I20 HydrophobicContact CD2-CD1 4.02Å; F14-I20 HydrophobicContact CE1-CD1 4.24Å; F14-I20 HydrophobicContact CG-CD1 3.56Å; F14-V43 HydrophobicContact CE1-CG1 4.02Å; F14-V43 HydrophobicContact CZ-CG1 4.31Å; F14-P44 HydrophobicContact CZ-CG 4.26Å; F14-M47 HydrophobicContact CE2-CB 4.05Å; F14-M47 HydrophobicContact CZ-CB 3.95Å; F14-M47 HydrophobicContact CZ-SD 4.37Å; F14-V48 HydrophobicContact CE2-CG1 4.21Å; F14-V48 HydrophobicContact CZ-CG1 4.25Å
15	V	93.4	Very high	86.9	Confident	94 Å²	94	80.4 Å²	80.4	57%	0.57	49%	0.489	S	S	*	.			trans	-118.4	160.3	177.9	-60.2	0	0	0	111.7	G17 Q18	V15-G17 PolarHBondContact O-N 2.92Å; V15-Q18 HydrophobicContact CG2-CB 4.17Å; V15-Q18 WeakPolarHBondContact O-CB 3.41Å; V15-Q18 PolarHBondContact O-N 3.14Å; V15-Q18 VanDerWaalsContact O-N 3.12Å
16	P	93.4	Very high	88.1	Confident	136 Å²	136	80.4 Å²	80.4	88%	0.883	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.7	132.5	176.7	-26.5	35.7	0	0	112.5	Q18	P16-Q18 VanDerWaalsContact C-N 3.32Å
17	G	90.8	Very high	89.1	Confident	81 Å²	81	76.2 Å²	76.2	84%	0.835	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	83.5	-1.8	-179.3	0	0	0	0	115.2	V15	V15-G17 PolarHBondContact O-N 2.92Å
18	Q	92.9	Very high	90.1	Very high	67 Å²	67	79.5 Å²	79.5	31%	0.313	48%	0.481	S	S	.	.			trans	-71.8	132.4	174.3	-175.4	171.7	-10.8	0	111	F14 V15 P16 S36	F14-Q18 HydrophobicContact CB-CB 4.49Å; F14-Q18 HydrophobicContact CB-CG 4.5Å; V15-Q18 HydrophobicContact CG2-CB 4.17Å; V15-Q18 WeakPolarHBondContact O-CB 3.41Å; V15-Q18 PolarHBondContact O-N 3.14Å; V15-Q18 VanDerWaalsContact O-N 3.12Å; P16-Q18 VanDerWaalsContact C-N 3.32Å; Q18-S36 PolarHBondContact NE2-OG 3.22Å
19	I	92.8	Very high	90.9	Very high	52 Å²	52	83.6 Å²	83.6	27%	0.267	50%	0.497	S	S	.	.			trans	-81.2	130.1	172.3	-53.8	-56.6	0	0	109.1	S36 V51 L62 F67	I19-S36 PolarHBondContact O-OG 3.24Å; I19-S36 VanDerWaalsContact O-OG 3.06Å; I19-V51 HydrophobicContact CD1-CG2 4.36Å; I19-L62 HydrophobicContact CD1-CD2 4.41Å; I19-L62 HydrophobicContact CG1-CD2 4.28Å; I19-L62 HydrophobicContact CG2-CD2 4.42Å; I19-F67 HydrophobicContact CB-CD1 4.06Å; I19-F67 HydrophobicContact CB-CD2 4.26Å; I19-F67 HydrophobicContact CB-CE1 3.82Å; I19-F67 HydrophobicContact CB-CE2 4.04Å; I19-F67 HydrophobicContact CB-CG 4.28Å; I19-F67 HydrophobicContact CB-CZ 3.82Å; I19-F67 HydrophobicContact CG1-CD2 4.32Å; I19-F67 HydrophobicContact CG1-CE2 4.07Å; I19-F67 HydrophobicContact CG1-CZ 4.29Å; I19-F67 HydrophobicContact CG2-CB 4.28Å; I19-F67 HydrophobicContact CG2-CD1 3.65Å; I19-F67 HydrophobicContact CG2-CD2 4.15Å; I19-F67 HydrophobicContact CG2-CE1 3.96Å; I19-F67 HydrophobicContact CG2-CE2 4.41Å; I19-F67 HydrophobicContact CG2-CG 3.77Å; I19-F67 HydrophobicContact CG2-CZ 4.33Å
20	I	94.4	Very high	91.6	Very high	29 Å²	29	79.4 Å²	79.4	15%	0.149	46%	0.464	C	S	.	.			trans	-121.3	129.2	-179.9	-55.9	170.9	0	0	107.4	L12 F14 V22 V43 V48	L12-I20 HydrophobicContact CD2-CG2 3.72Å; F14-I20 HydrophobicContact CB-CD1 3.83Å; F14-I20 HydrophobicContact CB-CG1 4.47Å; F14-I20 HydrophobicContact CD1-CD1 3.65Å; F14-I20 HydrophobicContact CD2-CD1 4.02Å; F14-I20 HydrophobicContact CE1-CD1 4.24Å; F14-I20 HydrophobicContact CG-CD1 3.56Å; I20-V22 PolarHBondContact O-N 2.93Å; I20-V43 HydrophobicContact CD1-CG1 4.09Å; I20-V43 HydrophobicContact CD1-CG2 4.49Å; I20-V43 HydrophobicContact CG2-CG2 4Å; I20-V48 HydrophobicContact CD1-CG1 4.21Å
21	K	93.2	Very high	92	Very high	119 Å²	119	77 Å²	77	52%	0.517	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	115.1	173.8	-176.8	175.8	-179.3	179.5	108.5	F23 G34 E35	K21-F23 HydrophobicContact CD-CE1 4.14Å; K21-F23 HydrophobicContact CD-CZ 3.89Å; K21-F23 HydrophobicContact CG-CE1 4.37Å; K21-F23 HydrophobicContact CG-CE2 4.43Å; K21-F23 HydrophobicContact CG-CZ 4.09Å; K21-G34 CarbonylContact O-C 3.59Å; K21-G34 WeakPolarHBondContact O-CA 3.49Å; K21-E35 PolarHBondContact N-O 2.88Å; K21-E35 PolarHBondContact O-N 3.32Å
22	V	94.1	Very high	92.3	Very high	62 Å²	62	77 Å²	77	38%	0.376	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	142.2	177.4	171.3	0	0	0	110.2	I20 Y32	I20-V22 PolarHBondContact O-N 2.93Å; V22-Y32 HydrophobicContact CG1-CD1 3.65Å; V22-Y32 HydrophobicContact CG1-CG 3.97Å; V22-Y32 HydrophobicContact CG2-CG 4.38Å
23	F	91.1	Very high	92.4	Very high	86 Å²	86	81 Å²	81	38%	0.377	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	117	176	-56.1	-87.5	0	0	110.1	K21 H33 E35	K21-F23 HydrophobicContact CD-CE1 4.14Å; K21-F23 HydrophobicContact CD-CZ 3.89Å; K21-F23 HydrophobicContact CG-CE1 4.37Å; K21-F23 HydrophobicContact CG-CE2 4.43Å; K21-F23 HydrophobicContact CG-CZ 4.09Å; F23-H33 PolarHBondContact N-O 3.02Å; F23-E35 HydrophobicContact CE2-CB 3.63Å; F23-E35 HydrophobicContact CZ-CB 4.15Å
24	G	90.1	Very high	92.6	Very high	63 Å²	63	76.8 Å²	76.8	65%	0.649	44%	0.441	S	S	*	.	S	Bend	trans	73.4	-166.7	-178.9	0	0	0	0	113.3
25	D	92.9	Very high	92.7	Very high	154 Å²	154	77.9 Å²	77.9	82%	0.824	45%	0.447	S	S	*	.			trans	-89.9	168.2	-178	-64.8	-50.5	0	0	112.2
26	K	92.1	Very high	92.6	Very high	105 Å²	105	74.3 Å²	74.3	46%	0.457	43%	0.426	S	S	.	.			trans	-61.8	137.1	171.1	-163.9	179.3	69.5	174.1	110.7	F31 Y32	K26-F31 CarbonylContact C-O 3.6Å; K26-F31 WeakPolarHBondContact CA-O 3.38Å; K26-Y32 HydrophobicContact CB-CD1 3.93Å; K26-Y32 HydrophobicContact CB-CE1 3.53Å; K26-Y32 HydrophobicContact CD-CE2 4.46Å; K26-Y32 HydrophobicContact CG-CD1 4.44Å; K26-Y32 HydrophobicContact CG-CE1 4.22Å; K26-Y32 HydrophobicContact CG-CE2 4.46Å
27	D	91.6	Very high	92.3	Very high	58 Å²	58	71.6 Å²	71.6	31%	0.31	42%	0.423	S	S	.	.			trans	-75.4	-178.8	174.5	68.1	23.3	0	0	113.3	D29 G30 F31	D27-D29 PolarHBondContact O-N 3.01Å; D27-D29 WeakPolarHBondContact OD1-CA 3.41Å; D27-D29 PolarHBondContact OD1-N 3.44Å; D27-G30 PolarHBondContact O-N 3.25Å; D27-G30 PolarHBondContact OD1-N 3.44Å; D27-F31 PolarHBondContact N-O 3.3Å; D27-F31 PolarHBondContact OD1-N 3.24Å
28	S	91.6	Very high	92.2	Very high	118 Å²	118	71 Å²	71	83%	0.825	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.9	-26.2	179	44.6	0	0	0	114
29	D	88.1	Confident	92.2	Very high	128 Å²	128	72.5 Å²	72.5	68%	0.684	43%	0.426	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.3	-8.1	-175.5	-62.3	-62.9	0	0	112	D27 F31	D27-D29 PolarHBondContact O-N 3.01Å; D27-D29 WeakPolarHBondContact OD1-CA 3.41Å; D27-D29 PolarHBondContact OD1-N 3.44Å; D29-F31 HydrophobicContact CB-CD2 3.93Å; D29-F31 HydrophobicContact CB-CE2 4.19Å
30	G	91.3	Very high	92.2	Very high	13 Å²	13	73.5 Å²	73.5	13%	0.134	44%	0.438	C	S	.	.	S	Bend	trans	95.3	22.2	175.3	0	0	0	0	113.9	D27 S45	D27-G30 PolarHBondContact O-N 3.25Å; D27-G30 PolarHBondContact OD1-N 3.44Å; G30-S45 WeakPolarHBondContact O-CB 3.35Å; G30-S45 PolarHBondContact O-N 2.94Å; G30-S45 PolarHBondContact O-OG 2.98Å; G30-S45 VanDerWaalsContact O-OG 3.07Å
31	F	93.2	Very high	92.1	Very high	60 Å²	60	72.4 Å²	72.4	26%	0.263	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	149.1	177.9	-63.1	-98.3	0	0	111.4	K26 D27 D29 Y42 V43 P44	K26-F31 CarbonylContact C-O 3.6Å; K26-F31 WeakPolarHBondContact CA-O 3.38Å; D27-F31 PolarHBondContact N-O 3.3Å; D27-F31 PolarHBondContact OD1-N 3.24Å; D29-F31 HydrophobicContact CB-CD2 3.93Å; D29-F31 HydrophobicContact CB-CE2 4.19Å; F31-Y42 HydrophobicContact CB-CD1 4.06Å; F31-V43 WeakPolarHBondContact CA-O 3.16Å; F31-P44 HydrophobicContact CD1-CB 4.02Å; F31-P44 HydrophobicContact CE1-CB 3.8Å
32	Y	95.1	Very high	92.2	Very high	40 Å²	40	71.3 Å²	71.3	16%	0.157	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	154.1	165.9	-62.4	-78.1	0	0	109.6	V22 K26 Y42 V43 V48	V22-Y32 HydrophobicContact CG1-CD1 3.65Å; V22-Y32 HydrophobicContact CG1-CG 3.97Å; V22-Y32 HydrophobicContact CG2-CG 4.38Å; K26-Y32 HydrophobicContact CB-CD1 3.93Å; K26-Y32 HydrophobicContact CB-CE1 3.53Å; K26-Y32 HydrophobicContact CD-CE2 4.46Å; K26-Y32 HydrophobicContact CG-CD1 4.44Å; K26-Y32 HydrophobicContact CG-CE1 4.22Å; K26-Y32 HydrophobicContact CG-CE2 4.46Å; Y32-Y42 CarbonylContact O-C 3.47Å; Y32-Y42 WeakPolarHBondContact O-CA 3.45Å; Y32-V43 PolarHBondContact N-O 3.47Å; Y32-V43 PolarHBondContact O-N 2.84Å; Y32-V48 HydrophobicContact CD2-CG2 4.21Å; Y32-V48 HydrophobicContact CE2-CG2 4.17Å
33	H	95	Very high	92.2	Very high	91 Å²	91	68.4 Å²	68.4	42%	0.421	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.3	122	164.6	-164.1	-109.3	0	0	109	F23	F23-H33 PolarHBondContact N-O 3.02Å
34	G	95.1	Very high	92.3	Very high	0 Å²	0	64.8 Å²	64.8	0%	0	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	162.1	-173.3	0	0	0	0	114.3	K21 S40 G41	K21-G34 CarbonylContact O-C 3.59Å; K21-G34 WeakPolarHBondContact O-CA 3.49Å; G34-S40 VanDerWaalsContact O-CA 3.27Å; G34-S40 WeakPolarHBondContact O-CA 3.14Å; G34-G41 PolarHBondContact N-O 2.99Å; G34-G41 PolarHBondContact O-N 3.26Å
35	E	94.4	Very high	92.4	Very high	80 Å²	80	63.5 Å²	63.5	37%	0.374	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	138.2	174.5	-176.8	-170.7	111.1	0	110.9	K21 F23 L39	K21-E35 PolarHBondContact N-O 2.88Å; K21-E35 PolarHBondContact O-N 3.32Å; F23-E35 HydrophobicContact CE2-CB 3.63Å; F23-E35 HydrophobicContact CZ-CB 4.15Å; E35-L39 CarbonylContact C-O 3.57Å; E35-L39 WeakPolarHBondContact CA-O 3.37Å; E35-L39 VanDerWaalsContact CG-O 3.29Å; E35-L39 WeakPolarHBondContact CG-O 3.43Å
36	S	91.9	Very high	92.3	Very high	18 Å²	18	62.4 Å²	62.4	13%	0.126	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.8	139.9	170.6	-163.6	0	0	0	110.4	Q18 I19 G38 L39	Q18-S36 PolarHBondContact NE2-OG 3.22Å; I19-S36 PolarHBondContact O-OG 3.24Å; I19-S36 VanDerWaalsContact O-OG 3.06Å; S36-G38 PolarHBondContact O-N 3Å; S36-G38 VanDerWaalsContact O-N 3.16Å; S36-L39 PolarHBondContact N-O 3.03Å; S36-L39 PolarHBondContact O-N 3.31Å
37	G	87.3	Confident	92.3	Very high	80 Å²	80	62.6 Å²	62.6	83%	0.825	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.5	25.2	177.4	0	0	0	0	114.9	L39	G37-L39 VanDerWaalsContact C-N 3.29Å; G37-L39 PolarHBondContact O-N 3.5Å
38	G	88.4	Confident	92.4	Very high	68 Å²	68	62.1 Å²	62.1	70%	0.701	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.9	6.8	-176.8	0	0	0	0	114.9	S36	S36-G38 PolarHBondContact O-N 3Å; S36-G38 VanDerWaalsContact O-N 3.16Å
39	L	92.4	Very high	92.5	Very high	99 Å²	99	60.8 Å²	60.8	52%	0.518	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	146.2	170.8	-62.2	176.5	0	0	109.6	L12 P13 E35 S36 G37	L12-L39 VanDerWaalsContact CD1-C 3.48Å; L12-L39 HydrophobicContact CD1-CB 3.68Å; L12-L39 VanDerWaalsContact CD1-O 3.24Å; L12-L39 WeakPolarHBondContact CD1-O 3.31Å; P13-L39 HydrophobicContact CG-CD1 3.96Å; E35-L39 CarbonylContact C-O 3.57Å; E35-L39 WeakPolarHBondContact CA-O 3.37Å; E35-L39 VanDerWaalsContact CG-O 3.29Å; E35-L39 WeakPolarHBondContact CG-O 3.43Å; S36-L39 PolarHBondContact N-O 3.03Å; S36-L39 PolarHBondContact O-N 3.31Å; G37-L39 VanDerWaalsContact C-N 3.29Å; G37-L39 PolarHBondContact O-N 3.5Å
40	S	92.8	Very high	92.6	Very high	72 Å²	72	62.6 Å²	62.6	50%	0.503	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	145.7	175.2	-47.4	0	0	0	109.8	G34	G34-S40 VanDerWaalsContact O-CA 3.27Å; G34-S40 WeakPolarHBondContact O-CA 3.14Å
41	G	93.6	Very high	92.4	Very high	6 Å²	6	64.9 Å²	64.9	6%	0.062	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	175.7	-173.2	179.6	0	0	0	0	112.9	E10 G34	E10-G41 CarbonylContact O-C 3.57Å; E10-G41 WeakPolarHBondContact O-CA 3.29Å; G34-G41 PolarHBondContact N-O 2.99Å; G34-G41 PolarHBondContact O-N 3.26Å
42	Y	93.9	Very high	91.9	Very high	96 Å²	96	65.8 Å²	65.8	38%	0.376	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.9	138.8	178.2	-67.7	-71.7	0	0	112.2	E10 E11 L12 F31 Y32	E10-Y42 HydrophobicContact CB-CD2 3.88Å; E10-Y42 HydrophobicContact CB-CE2 4.22Å; E10-Y42 PolarHBondContact O-N 3.43Å; E11-Y42 CarbonylContact C-O 3.53Å; E11-Y42 WeakPolarHBondContact CA-O 3.42Å; L12-Y42 PolarHBondContact N-O 3.4Å; F31-Y42 HydrophobicContact CB-CD1 4.06Å; Y32-Y42 CarbonylContact O-C 3.47Å; Y32-Y42 WeakPolarHBondContact O-CA 3.45Å
43	V	94.1	Very high	91	Very high	1 Å²	1	66.9 Å²	66.9	1%	0.006	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	116	-179.7	-177.7	0	0	0	108.1	L12 F14 I20 F31 Y32 S45 V48	L12-V43 HydrophobicContact CB-CG2 4.06Å; L12-V43 HydrophobicContact CD2-CG2 3.91Å; F14-V43 HydrophobicContact CE1-CG1 4.02Å; F14-V43 HydrophobicContact CZ-CG1 4.31Å; I20-V43 HydrophobicContact CD1-CG1 4.09Å; I20-V43 HydrophobicContact CD1-CG2 4.49Å; I20-V43 HydrophobicContact CG2-CG2 4Å; F31-V43 WeakPolarHBondContact CA-O 3.16Å; Y32-V43 PolarHBondContact N-O 3.47Å; Y32-V43 PolarHBondContact O-N 2.84Å; V43-S45 PolarHBondContact O-N 2.85Å; V43-V48 HydrophobicContact CG1-CB 4.47Å; V43-V48 HydrophobicContact CG1-CG1 3.56Å; V43-V48 HydrophobicContact CG1-CG2 4.09Å
44	P	92.8	Very high	90.3	Very high	11 Å²	11	69.4 Å²	69.4	7%	0.071	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.2	124.8	-177.4	30.3	-35	0	0	110.4	F14 F31 N46 M47	F14-P44 HydrophobicContact CZ-CG 4.26Å; F31-P44 HydrophobicContact CD1-CB 4.02Å; F31-P44 HydrophobicContact CE1-CB 3.8Å; P44-N46 WeakPolarHBondContact CB-OD1 3.39Å; P44-N46 PolarHBondContact O-N 2.93Å; P44-M47 HydrophobicContact CG-CB 4.16Å; P44-M47 HydrophobicContact CG-CE 4.4Å; P44-M47 HydrophobicContact CG-CG 3.91Å; P44-M47 HydrophobicContact CG-SD 3.86Å; P44-M47 PolarHBondContact O-N 3.35Å; P44-M47 VanDerWaalsContact O-N 3.08Å
45	S	92.5	Very high	89.8	Confident	36 Å²	36	73.4 Å²	73.4	25%	0.252	45%	0.445	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.3	-20.2	-171.8	74.8	0	0	0	114.1	G30 V43 M47	G30-S45 WeakPolarHBondContact O-CB 3.35Å; G30-S45 PolarHBondContact O-N 2.94Å; G30-S45 PolarHBondContact O-OG 2.98Å; G30-S45 VanDerWaalsContact O-OG 3.07Å; V43-S45 PolarHBondContact O-N 2.85Å; S45-M47 VanDerWaalsContact C-N 3.31Å
46	N	92.1	Very high	89.4	Confident	131 Å²	131	74.5 Å²	74.5	70%	0.701	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.9	-10.8	179.7	64.9	-14.1	0	0	113.8	P44	P44-N46 WeakPolarHBondContact CB-OD1 3.39Å; P44-N46 PolarHBondContact O-N 2.93Å
47	M	91.8	Very high	89.2	Confident	108 Å²	108	82 Å²	82	53%	0.532	48%	0.477	S	S	.	.	S	Bend	trans	-105.5	-2.4	179.2	-60.2	-167.2	-174.7	0	113.3	F14 P44 S45	F14-M47 HydrophobicContact CE2-CB 4.05Å; F14-M47 HydrophobicContact CZ-CB 3.95Å; F14-M47 HydrophobicContact CZ-SD 4.37Å; P44-M47 HydrophobicContact CG-CB 4.16Å; P44-M47 HydrophobicContact CG-CE 4.4Å; P44-M47 HydrophobicContact CG-CG 3.91Å; P44-M47 HydrophobicContact CG-SD 3.86Å; P44-M47 PolarHBondContact O-N 3.35Å; P44-M47 VanDerWaalsContact O-N 3.08Å; S45-M47 VanDerWaalsContact C-N 3.31Å
48	V	93	Very high	89.1	Confident	49 Å²	49	81.1 Å²	81.1	30%	0.297	45%	0.453	S	S	.	.			trans	-128	161.1	-176.4	-63.2	0	0	0	110.9	F14 I20 Y32 V43	F14-V48 HydrophobicContact CE2-CG1 4.21Å; F14-V48 HydrophobicContact CZ-CG1 4.25Å; I20-V48 HydrophobicContact CD1-CG1 4.21Å; Y32-V48 HydrophobicContact CD2-CG2 4.21Å; Y32-V48 HydrophobicContact CE2-CG2 4.17Å; V43-V48 HydrophobicContact CG1-CB 4.47Å; V43-V48 HydrophobicContact CG1-CG1 3.56Å; V43-V48 HydrophobicContact CG1-CG2 4.09Å
49	A	93.3	Very high	89.1	Confident	90 Å²	90	81 Å²	81	74%	0.744	43%	0.433	S	S	*	.			trans	-132.5	144.9	171.9	0	0	0	0	108.6
50	E	90.4	Very high	88.8	Confident	166 Å²	166	81.3 Å²	81.3	78%	0.776	43%	0.432	S	S	*	.			trans	-64.2	138.3	171.9	-70.8	177.2	-149.9	0	109.9	P52	E50-P52 WeakPolarHBondContact O-CD 3.27Å
51	V	87.5	Confident	88.6	Confident	61 Å²	61	79.8 Å²	79.8	37%	0.37	42%	0.419	S	S	.	.			trans	-89.1	115.8	178.2	-177.9	0	0	0	107.8	I19 V53 L58 L62	I19-V51 HydrophobicContact CD1-CG2 4.36Å; V51-V53 PolarHBondContact O-N 2.85Å; V51-L58 HydrophobicContact CG1-CD2 3.36Å; V51-L58 HydrophobicContact CG1-CG 4.43Å; V51-L62 HydrophobicContact CG1-CD1 3.86Å
52	P	81.8	Confident	88.4	Confident	78 Å²	78	80.2 Å²	80.2	51%	0.506	42%	0.42	S	S	.	.			trans	-69.7	107	-178.6	27.8	-32.8	0	0	109.3	E50 D54	E50-P52 WeakPolarHBondContact O-CD 3.27Å; P52-D54 PolarHBondContact O-N 3.35Å
53	V	76.3	Confident	88.1	Confident	63 Å²	63	77.8 Å²	77.8	38%	0.382	41%	0.413	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.8	0.9	177.4	-66.2	0	0	0	113.1	V51 D55 L62 L68	V51-V53 PolarHBondContact O-N 2.85Å; V53-D55 PolarHBondContact O-N 2.85Å; V53-L62 HydrophobicContact CG1-CD1 4.29Å; V53-L68 HydrophobicContact CG1-CD1 4.02Å
54	D	80.7	Confident	87.8	Confident	145 Å²	145	86 Å²	86	78%	0.775	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.8	-23.6	175.4	-38.6	-27.1	0	0	111.4	P52 E56	P52-D54 PolarHBondContact O-N 3.35Å; D54-E56 PolarHBondContact O-N 2.95Å
55	D	85.5	Confident	87.5	Confident	83 Å²	83	91.2 Å²	91.2	44%	0.444	47%	0.474	S	S	.	.	S	Bend	trans	-77	108.1	170.6	-173.1	-57.1	0	0	109.1	V53 Y57 L58 K59	V53-D55 PolarHBondContact O-N 2.85Å; D55-Y57 PolarHBondContact O-N 2.88Å; D55-Y57 WeakPolarHBondContact OD1-CA 3.24Å; D55-Y57 VanDerWaalsContact OD1-CB 3.25Å; D55-Y57 WeakPolarHBondContact OD1-CB 3.41Å; D55-Y57 PolarHBondContact OD1-N 2.87Å; D55-L58 HydrophobicContact CB-CB 3.94Å; D55-L58 PolarHBondContact O-N 2.85Å; D55-L58 VanDerWaalsContact O-N 3.14Å; D55-L58 PolarHBondContact OD1-N 2.77Å; D55-K59 WeakPolarHBondContact O-CB 3.21Å; D55-K59 PolarHBondContact O-N 3.38Å
56	E	85.1	Confident	87.1	Confident	104 Å²	104	92.4 Å²	92.4	49%	0.486	49%	0.493	S	S	.	.	H	α-helix	trans	-58.4	-33.5	-178.9	-77.7	-71.8	120.7	0	112.5	D54 K59 H60	D54-E56 PolarHBondContact O-N 2.95Å; E56-K59 WeakPolarHBondContact OE1-CD 3.37Å; E56-K59 IonicContact OE1-NZ 2.9Å; E56-K59 PolarHBondContact OE1-NZ 3.07Å; E56-H60 WeakPolarHBondContact O-CB 3.36Å; E56-H60 PolarHBondContact O-N 3.04Å; E56-H60 PolarHBondContact O-ND1 3.05Å; E56-H60 IonicContact OE2-CE1 3.6Å
57	Y	87.3	Confident	86.9	Confident	174 Å²	174	90.3 Å²	90.3	68%	0.682	48%	0.478	S	S	*	.	H	α-helix	trans	-66.7	-47.7	176.2	170.1	-97.6	0	0	110.8	D55 K59 H60 V61	D55-Y57 PolarHBondContact O-N 2.88Å; D55-Y57 WeakPolarHBondContact OD1-CA 3.24Å; D55-Y57 VanDerWaalsContact OD1-CB 3.25Å; D55-Y57 WeakPolarHBondContact OD1-CB 3.41Å; D55-Y57 PolarHBondContact OD1-N 2.87Å; Y57-K59 VanDerWaalsContact C-N 3.33Å; Y57-K59 PolarHBondContact O-N 3.05Å; Y57-H60 PolarHBondContact O-N 3.08Å; Y57-V61 HydrophobicContact CD1-CG2 4.49Å; Y57-V61 HydrophobicContact CE1-CG2 4.06Å; Y57-V61 HydrophobicContact CE2-CG2 4.18Å; Y57-V61 WeakPolarHBondContact O-CG2 3.44Å; Y57-V61 PolarHBondContact O-N 2.99Å
58	L	86.6	Confident	86.6	Confident	62 Å²	62	87.6 Å²	87.6	33%	0.325	47%	0.465	S	S	.	.	H	α-helix	trans	-62.8	-42.4	-180	-147.2	81.2	0	0	111.5	V51 D55 V61 L62	V51-L58 HydrophobicContact CG1-CD2 3.36Å; V51-L58 HydrophobicContact CG1-CG 4.43Å; D55-L58 HydrophobicContact CB-CB 3.94Å; D55-L58 PolarHBondContact O-N 2.85Å; D55-L58 VanDerWaalsContact O-N 3.14Å; D55-L58 PolarHBondContact OD1-N 2.77Å; L58-V61 PolarHBondContact O-N 3.06Å; L58-L62 VanDerWaalsContact O-CG 3.31Å; L58-L62 WeakPolarHBondContact O-CG 3.06Å; L58-L62 PolarHBondContact O-N 2.95Å
59	K	86.8	Confident	86	Confident	65 Å²	65	90.1 Å²	90.1	28%	0.283	48%	0.482	S	S	.	.	H	α-helix	trans	-58.5	-46.8	174	-180	-177.1	171.9	-171.6	112	D55 E56 Y57 V61 L62 M63 L68	D55-K59 WeakPolarHBondContact O-CB 3.21Å; D55-K59 PolarHBondContact O-N 3.38Å; E56-K59 WeakPolarHBondContact OE1-CD 3.37Å; E56-K59 IonicContact OE1-NZ 2.9Å; E56-K59 PolarHBondContact OE1-NZ 3.07Å; Y57-K59 VanDerWaalsContact C-N 3.33Å; Y57-K59 PolarHBondContact O-N 3.05Å; K59-V61 VanDerWaalsContact C-N 3.33Å; K59-V61 PolarHBondContact O-N 3.49Å; K59-L62 PolarHBondContact O-N 3.16Å; K59-M63 HydrophobicContact CD-CE 4.28Å; K59-M63 HydrophobicContact CG-CE 3.83Å; K59-M63 HydrophobicContact CG-SD 4.31Å; K59-M63 VanDerWaalsContact O-CG 3.31Å; K59-M63 WeakPolarHBondContact O-CG 3.2Å; K59-M63 PolarHBondContact O-N 2.84Å; K59-L68 HydrophobicContact CG-CD1 4.12Å
60	H	87.4	Confident	85.2	Confident	106 Å²	106	89.6 Å²	89.6	49%	0.491	47%	0.47	S	S	.	.	H	α-helix	trans	-60.8	-41.7	176.3	-81.7	82.3	0	0	111.9	E56 Y57 M63 Q64	E56-H60 WeakPolarHBondContact O-CB 3.36Å; E56-H60 PolarHBondContact O-N 3.04Å; E56-H60 PolarHBondContact O-ND1 3.05Å; E56-H60 IonicContact OE2-CE1 3.6Å; Y57-H60 PolarHBondContact O-N 3.08Å; H60-M63 PolarHBondContact O-N 2.82Å; H60-Q64 WeakPolarHBondContact O-CG 3.42Å; H60-Q64 PolarHBondContact O-N 3.35Å
61	V	88.3	Confident	84.1	Confident	41 Å²	41	88.9 Å²	88.9	25%	0.248	47%	0.471	C	S	.	.	H	α-helix	trans	-61.9	-47	176.5	171.6	0	0	0	111	Y57 L58 K59 M63 Q64 Q65	Y57-V61 HydrophobicContact CD1-CG2 4.49Å; Y57-V61 HydrophobicContact CE1-CG2 4.06Å; Y57-V61 HydrophobicContact CE2-CG2 4.18Å; Y57-V61 WeakPolarHBondContact O-CG2 3.44Å; Y57-V61 PolarHBondContact O-N 2.99Å; L58-V61 PolarHBondContact O-N 3.06Å; K59-V61 VanDerWaalsContact C-N 3.33Å; K59-V61 PolarHBondContact O-N 3.49Å; V61-M63 VanDerWaalsContact C-N 3.33Å; V61-M63 PolarHBondContact O-N 3.12Å; V61-Q64 PolarHBondContact O-N 2.86Å; V61-Q65 WeakPolarHBondContact O-CG 3.23Å; V61-Q65 PolarHBondContact O-N 3.35Å
62	L	88.7	Confident	82.5	Confident	14 Å²	14	93.9 Å²	93.9	7%	0.073	49%	0.49	C	S	.	.	H	α-helix	trans	-65.2	-35.2	179.4	-68.3	170.7	0	0	112.5	I19 V51 V53 L58 K59 Q65 G66 F67 L68	I19-L62 HydrophobicContact CD1-CD2 4.41Å; I19-L62 HydrophobicContact CG1-CD2 4.28Å; I19-L62 HydrophobicContact CG2-CD2 4.42Å; V51-L62 HydrophobicContact CG1-CD1 3.86Å; V53-L62 HydrophobicContact CG1-CD1 4.29Å; L58-L62 VanDerWaalsContact O-CG 3.31Å; L58-L62 WeakPolarHBondContact O-CG 3.06Å; L58-L62 PolarHBondContact O-N 2.95Å; K59-L62 PolarHBondContact O-N 3.16Å; L62-Q65 PolarHBondContact O-N 2.61Å; L62-G66 PolarHBondContact O-N 3.08Å; L62-F67 HydrophobicContact CB-CB 4.3Å; L62-F67 HydrophobicContact CD2-CB 4.13Å; L62-F67 HydrophobicContact CD2-CD2 3.97Å; L62-F67 HydrophobicContact CD2-CG 4.37Å; L62-F67 PolarHBondContact O-N 2.93Å; L62-L68 HydrophobicContact CB-CD1 3.72Å; L62-L68 HydrophobicContact CB-CG 3.84Å; L62-L68 HydrophobicContact CD1-CD1 4.09Å; L62-L68 HydrophobicContact CD1-CG 4.5Å; L62-L68 PolarHBondContact O-N 3.32Å
63	M	88.5	Confident	80.7	Confident	46 Å²	46	98.3 Å²	98.3	23%	0.227	53%	0.533	C	S	.	.	H	α-helix	trans	-64.7	-46.4	172.3	-73.8	175.9	173.6	0	111.8	K59 H60 V61 Q65 G66 L68 V70	K59-M63 HydrophobicContact CD-CE 4.28Å; K59-M63 HydrophobicContact CG-CE 3.83Å; K59-M63 HydrophobicContact CG-SD 4.31Å; K59-M63 VanDerWaalsContact O-CG 3.31Å; K59-M63 WeakPolarHBondContact O-CG 3.2Å; K59-M63 PolarHBondContact O-N 2.84Å; H60-M63 PolarHBondContact O-N 2.82Å; V61-M63 VanDerWaalsContact C-N 3.33Å; V61-M63 PolarHBondContact O-N 3.12Å; M63-Q65 PolarHBondContact O-N 3.12Å; M63-G66 PolarHBondContact O-N 3.4Å; M63-L68 HydrophobicContact CG-CB 3.81Å; M63-L68 HydrophobicContact CG-CD1 4.39Å; M63-V70 HydrophobicContact CB-CG1 4.32Å
64	Q	87.5	Confident	81	Confident	174 Å²	174	100.1 Å²	100.1	81%	0.813	54%	0.541	S	S	*	.	H	α-helix	trans	-62.7	-31.6	178.3	-75.4	-171.4	-28.4	0	112.9	H60 V61 G66	H60-Q64 WeakPolarHBondContact O-CG 3.42Å; H60-Q64 PolarHBondContact O-N 3.35Å; V61-Q64 PolarHBondContact O-N 2.86Å; Q64-G66 VanDerWaalsContact C-N 3.28Å
65	Q	85.7	Confident	81	Confident	119 Å²	119	97.7 Å²	97.7	56%	0.556	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.7	-4.4	176.1	-69	-176.7	-27.6	0	113.4	V61 L62 M63 F67	V61-Q65 WeakPolarHBondContact O-CG 3.23Å; V61-Q65 PolarHBondContact O-N 3.35Å; L62-Q65 PolarHBondContact O-N 2.61Å; M63-Q65 PolarHBondContact O-N 3.12Å; Q65-F67 VanDerWaalsContact C-N 3.32Å; Q65-F67 HydrophobicContact CB-CD2 3.5Å; Q65-F67 HydrophobicContact CB-CE2 3.67Å; Q65-F67 HydrophobicContact CG-CE2 4.46Å
66	G	86.1	Confident	80.7	Confident	62 Å²	62	98.5 Å²	98.5	64%	0.639	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.5	14.8	179.5	0	0	0	0	114.5	L62 M63 Q64	L62-G66 PolarHBondContact O-N 3.08Å; M63-G66 PolarHBondContact O-N 3.4Å; Q64-G66 VanDerWaalsContact C-N 3.28Å
67	F	86.7	Confident	80.5	Confident	87 Å²	87	98.2 Å²	98.2	38%	0.382	54%	0.536	S	S	.	.	S	Bend	trans	-79.1	-28.7	175.2	-68.9	-62	0	0	112.5	I19 L62 Q65	I19-F67 HydrophobicContact CB-CD1 4.06Å; I19-F67 HydrophobicContact CB-CD2 4.26Å; I19-F67 HydrophobicContact CB-CE1 3.82Å; I19-F67 HydrophobicContact CB-CE2 4.04Å; I19-F67 HydrophobicContact CB-CG 4.28Å; I19-F67 HydrophobicContact CB-CZ 3.82Å; I19-F67 HydrophobicContact CG1-CD2 4.32Å; I19-F67 HydrophobicContact CG1-CE2 4.07Å; I19-F67 HydrophobicContact CG1-CZ 4.29Å; I19-F67 HydrophobicContact CG2-CB 4.28Å; I19-F67 HydrophobicContact CG2-CD1 3.65Å; I19-F67 HydrophobicContact CG2-CD2 4.15Å; I19-F67 HydrophobicContact CG2-CE1 3.96Å; I19-F67 HydrophobicContact CG2-CE2 4.41Å; I19-F67 HydrophobicContact CG2-CG 3.77Å; I19-F67 HydrophobicContact CG2-CZ 4.33Å; L62-F67 HydrophobicContact CB-CB 4.3Å; L62-F67 HydrophobicContact CD2-CB 4.13Å; L62-F67 HydrophobicContact CD2-CD2 3.97Å; L62-F67 HydrophobicContact CD2-CG 4.37Å; L62-F67 PolarHBondContact O-N 2.93Å; Q65-F67 VanDerWaalsContact C-N 3.32Å; Q65-F67 HydrophobicContact CB-CD2 3.5Å; Q65-F67 HydrophobicContact CB-CE2 3.67Å; Q65-F67 HydrophobicContact CG-CE2 4.46Å
68	L	85.7	Confident	80	Confident	50 Å²	50	93.4 Å²	93.4	26%	0.262	53%	0.527	S	S	.	.	S	Bend	trans	-111.3	145	172.5	-64.9	177.1	0	0	110	V53 K59 L62 M63 V70	V53-L68 HydrophobicContact CG1-CD1 4.02Å; K59-L68 HydrophobicContact CG-CD1 4.12Å; L62-L68 HydrophobicContact CB-CD1 3.72Å; L62-L68 HydrophobicContact CB-CG 3.84Å; L62-L68 HydrophobicContact CD1-CD1 4.09Å; L62-L68 HydrophobicContact CD1-CG 4.5Å; L62-L68 PolarHBondContact O-N 3.32Å; M63-L68 HydrophobicContact CG-CB 3.81Å; M63-L68 HydrophobicContact CG-CD1 4.39Å; L68-V70 PolarHBondContact O-N 3.19Å
69	P	80.9	Confident	79.6	Confident	102 Å²	102	95.5 Å²	95.5	66%	0.662	54%	0.54	S	S	*	.			trans	-60.8	135.2	170.2	27.2	-32.5	0	0	109.3	D71	P69-D71 PolarHBondContact O-N 3.33Å
70	V	75.4	Confident	79.1	Confident	79 Å²	79	97.7 Å²	97.7	48%	0.479	56%	0.558	S	S	.	*			trans	-74.4	112.8	161	-82.1	0	0	0	106.3	M63 L68 H72	M63-V70 HydrophobicContact CB-CG1 4.32Å; L68-V70 PolarHBondContact O-N 3.19Å; V70-H72 VanDerWaalsContact C-N 3.3Å; V70-H72 WeakPolarHBondContact CG2-NE2 3.34Å; V70-H72 PolarHBondContact O-N 3.37Å
71	D	66.7	Low	78.4	Confident	151 Å²	151	97.1 Å²	97.1	81%	0.807	56%	0.564	S	S	*	*			trans	-58.4	98.8	170.4	-91.3	-46.2	0	0	108	P69 A73	P69-D71 PolarHBondContact O-N 3.33Å; D71-A73 PolarHBondContact O-N 3.23Å
72	H	55.7	Low	77.6	Confident	167 Å²	167	101.8 Å²	101.8	77%	0.773	59%	0.59	S	S	*	*			trans	-84.2	91.9	162	-70.5	-65.5	0	0	106	V70	V70-H72 VanDerWaalsContact C-N 3.3Å; V70-H72 WeakPolarHBondContact CG2-NE2 3.34Å; V70-H72 PolarHBondContact O-N 3.37Å
73	A	43.8	Very low	76.6	Confident	170 Å²	170	109.7 Å²	109.7	100%	1.405	64%	0.637	S	S	*	*			trans	-56.5	0	164.7	0	0	0	0	111.4	D71	D71-A73 PolarHBondContact O-N 3.23Å

Retrieved 73 of 73 residues in 146.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).