A0A087XU04_POEFO Loading...

Gem (nuclear organelle) associated protein 7

AlphaFold DB , UniProt , Accession A0A087XU04, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 128 aa.

						>A0A087XU04_POEFO|A0A087XU04
MATPVPVLRLPKGPDPNSRGFDPNSPRFIALCRTSIPTSAAAESDPQQLQEEQHARSVLRERFLRCLLAMSNKKVRFHMHEKVNVEATFGASDIDVLNFQVSDLHTPIGVQKEALIRSQDVISFTFDV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.5	Very low	53.9	Low	241 Å²	241	143.8 Å²	143.8	100%	1.187	81%	0.813	S	S	*	*				0	119.7	0	-60.5	-176.3	84.1	0	0	107.1
2	A	55	Low	53.8	Low	104 Å²	104	148.8 Å²	148.8	86%	0.86	82%	0.819	S	S	*	*			trans	-81.9	118.6	-177.5	0	0	0	0	0	109.7	P4	A2-P4 WeakPolarHBondContact O-CD 3.32Å
3	T	54.6	Low	53.9	Low	131 Å²	131	138.3 Å²	138.3	80%	0.804	77%	0.767	S	S	*	*			trans	-76.5	115.1	173.7	14.6	0	0	0	0	109	V5	T3-V5 PolarHBondContact O-N 3.02Å
4	P	63.8	Low	53.7	Low	121 Å²	121	138.1 Å²	138.1	79%	0.786	77%	0.774	S	S	*	*			trans	-71.4	123.7	179.1	27.5	-31.5	0	0	0	109.9	A2	A2-P4 WeakPolarHBondContact O-CD 3.32Å
5	V	54.3	Low	53.9	Low	121 Å²	121	135.7 Å²	135.7	73%	0.733	76%	0.759	S	S	*	*			trans	-84	121.7	172.5	-178.5	0	0	0	0	108.1	T3 V7	T3-V5 PolarHBondContact O-N 3.02Å; V5-V7 PolarHBondContact O-N 2.82Å
6	P	44.7	Very low	53.7	Low	127 Å²	127	135.2 Å²	135.2	83%	0.825	76%	0.764	S	S	*	*			trans	-69.6	115.5	178.6	26.8	-31.7	0	0	0	109.9
7	V	61.9	Low	53.7	Low	111 Å²	111	135.3 Å²	135.3	67%	0.673	76%	0.762	S	S	*	*			trans	-99	109.1	174.2	-176.8	0	0	0	0	108.7	V5 R9	V5-V7 PolarHBondContact O-N 2.82Å; V7-R9 HydrophobicContact CG1-CG 4.2Å; V7-R9 PolarHBondContact O-N 3.29Å
8	L	52.7	Low	53.7	Low	160 Å²	160	130.8 Å²	130.8	84%	0.838	74%	0.74	S	S	*	*			trans	-75.1	104.1	170.3	-166.2	81.3	0	0	0	108.9	L10	L8-L10 PolarHBondContact O-N 3.13Å
9	R	55.1	Low	53.6	Low	227 Å²	227	131.9 Å²	131.9	86%	0.857	73%	0.732	S	S	*	*			trans	-83	111.3	176.1	-68.4	-172.5	178.4	172.9	-0.5	109.6	V7	V7-R9 HydrophobicContact CG1-CG 4.2Å; V7-R9 PolarHBondContact O-N 3.29Å
10	L	52.8	Low	53.7	Low	131 Å²	131	127.1 Å²	127.1	69%	0.686	71%	0.713	S	S	*	*	P	Polyproline II helix	trans	-59.2	149.7	172.1	-66.9	175.1	0	0	0	110.8	L8 K12	L8-L10 PolarHBondContact O-N 3.13Å; L10-K12 PolarHBondContact O-N 3.19Å
11	P	49.8	Very low	53.6	Low	108 Å²	108	130.3 Å²	130.3	70%	0.701	72%	0.72	S	S	*	*	P	Polyproline II helix	trans	-55.5	135.4	-179.6	20.5	-31.4	0	0	0	110.9	G13 R19	P11-G13 PolarHBondContact O-N 2.84Å; P11-R19 PolarHBondContact O-NH1 3.06Å
12	K	52.3	Low	54.3	Low	203 Å²	203	122 Å²	122	88%	0.883	68%	0.68	S	S	*	*	P	Polyproline II helix	trans	-60.3	131.3	175.7	-67.8	-178.3	177.3	-179.7	0	108.4	L10	L10-K12 PolarHBondContact O-N 3.19Å
13	G	54.9	Low	54.6	Low	13 Å²	13	120.6 Å²	120.6	13%	0.134	66%	0.663	C	S	.	*	P	Polyproline II helix	trans	-63.1	159.9	172.9	0	0	0	0	0	110.5	P11 D15	P11-G13 PolarHBondContact O-N 2.84Å; G13-D15 PolarHBondContact O-N 2.88Å
14	P	51.8	Low	55.1	Low	135 Å²	135	120.4 Å²	120.4	88%	0.877	66%	0.657	S	S	*	*	S	Bend	trans	-72.9	31.2	-169.8	29.7	-35.5	0	0	0	115.4
15	D	55.9	Low	55.3	Low	102 Å²	102	115.5 Å²	115.5	55%	0.545	63%	0.625	S	S	.	*			trans	-142.4	132.8	-177.9	-109.1	-37.6	0	0	0	111.4	G13 N17 S18	G13-D15 PolarHBondContact O-N 2.88Å; D15-N17 PolarHBondContact O-N 3.36Å; D15-S18 PolarHBondContact O-N 3.21Å
16	P	51.2	Low	55.6	Low	128 Å²	128	115 Å²	115	83%	0.831	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63	-18.6	172	26	-32.3	0	0	0	112.6
17	N	53.2	Low	56.3	Low	137 Å²	137	117 Å²	117	73%	0.733	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.8	0.9	176.2	-72	-10.8	0	0	0	113.8	D15	D15-N17 PolarHBondContact O-N 3.36Å
18	S	54	Low	56.3	Low	54 Å²	54	115.5 Å²	115.5	38%	0.378	60%	0.6	S	S	.	*	S	Bend	trans	-99.8	110.5	-174	175.5	0	0	0	0	110.2	D15	D15-S18 PolarHBondContact O-N 3.21Å
19	R	52.8	Low	56.7	Low	153 Å²	153	112.5 Å²	112.5	58%	0.577	58%	0.584	S	S	*	*	S	Bend	trans	105.7	41.8	169.2	-55.2	171.6	175.8	-174.1	2.9	117.3	P11 F21	P11-R19 PolarHBondContact O-NH1 3.06Å; R19-F21 WeakPolarHBondContact O-CD2 3.46Å; R19-F21 PolarHBondContact O-N 2.97Å
20	G	54.5	Low	56.8	Low	35 Å²	35	105 Å²	105	36%	0.361	57%	0.57	S	S	.	*	S	Bend		74.4	27.3	128	0	0	0	0	0	118.7
21	F	52.1	Low	57	Low	194 Å²	194	104 Å²	104	85%	0.851	57%	0.565	S	S	*	*			trans	-122.9	6.3	168.6	-65.5	-78.7	0	0	0	113.5	R19 P23	R19-F21 WeakPolarHBondContact O-CD2 3.46Å; R19-F21 PolarHBondContact O-N 2.97Å; F21-P23 VanDerWaalsContact O-CD 3.31Å; F21-P23 WeakPolarHBondContact O-CD 3.46Å
22	D	63.3	Low	57	Low	67 Å²	67	102.2 Å²	102.2	36%	0.358	55%	0.554	S	S	.	*			trans	-75.5	116.1	171.5	172.1	16.5	0	0	0	109.2	N24 S25 F28	D22-N24 PolarHBondContact O-N 2.88Å; D22-N24 VanDerWaalsContact O-N 3.15Å; D22-N24 WeakPolarHBondContact OD1-CB 3.26Å; D22-N24 PolarHBondContact OD1-N 3.26Å; D22-S25 WeakPolarHBondContact O-CB 3.21Å; D22-S25 PolarHBondContact O-N 3.46Å; D22-S25 PolarHBondContact O-OG 3.4Å; D22-S25 PolarHBondContact OD2-N 2.76Å; D22-F28 WeakPolarHBondContact O-CB 3.46Å
23	P	60.9	Low	56.8	Low	75 Å²	75	102.7 Å²	102.7	49%	0.487	55%	0.551	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.1	-17.2	179.7	27	-34.7	0	0	0	113.4	F21 F28	F21-P23 VanDerWaalsContact O-CD 3.31Å; F21-P23 WeakPolarHBondContact O-CD 3.46Å; P23-F28 VanDerWaalsContact CA-CD1 3.42Å; P23-F28 HydrophobicContact CB-CD1 4.26Å; P23-F28 HydrophobicContact CB-CE1 3.9Å; P23-F28 HydrophobicContact CB-CZ 4.14Å; P23-F28 WeakPolarHBondContact O-CD1 3.39Å
24	N	65.6	Low	56.5	Low	127 Å²	127	105.3 Å²	105.3	68%	0.679	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.6	-1.7	177.2	-60.9	-45	0	0	0	113.3	D22 I29	D22-N24 PolarHBondContact O-N 2.88Å; D22-N24 VanDerWaalsContact O-N 3.15Å; D22-N24 WeakPolarHBondContact OD1-CB 3.26Å; D22-N24 PolarHBondContact OD1-N 3.26Å; N24-I29 WeakPolarHBondContact O-CD1 3.45Å
25	S	68.6	Low	56.1	Low	17 Å²	17	104.9 Å²	104.9	12%	0.119	56%	0.564	C	S	.	*	S	Bend	trans	-70.5	144.8	-177.8	66.7	0	0	0	0	111.7	D22 R27 F28 I29	D22-S25 WeakPolarHBondContact O-CB 3.21Å; D22-S25 PolarHBondContact O-N 3.46Å; D22-S25 PolarHBondContact O-OG 3.4Å; D22-S25 PolarHBondContact OD2-N 2.76Å; S25-R27 PolarHBondContact O-N 3.28Å; S25-R27 VanDerWaalsContact O-N 3.09Å; S25-F28 PolarHBondContact O-N 2.9Å; S25-F28 WeakPolarHBondContact OG-CB 3.43Å; S25-F28 PolarHBondContact OG-N 2.8Å; S25-F28 VanDerWaalsContact OG-N 3.13Å; S25-I29 WeakPolarHBondContact O-CG1 3.44Å; S25-I29 PolarHBondContact O-N 3.36Å
26	P	59.9	Low	55.7	Low	112 Å²	112	106 Å²	106	73%	0.727	57%	0.569	S	S	*	*	H	α-helix	trans	-54	-33.7	175.4	-27.4	34.3	0	0	0	113.1	A30	P26-A30 WeakPolarHBondContact O-CB 3.49Å; P26-A30 PolarHBondContact O-N 2.84Å
27	R	60	Low	55.3	Low	169 Å²	169	105.3 Å²	105.3	64%	0.638	56%	0.564	S	S	*	*	H	α-helix	trans	-69.2	-46.2	176.4	-177.3	-178.4	170.7	92.6	3.7	112.2	S25 I29 A30 L31	S25-R27 PolarHBondContact O-N 3.28Å; S25-R27 VanDerWaalsContact O-N 3.09Å; R27-I29 VanDerWaalsContact C-N 3.33Å; R27-A30 PolarHBondContact O-N 3.2Å; R27-L31 HydrophobicContact CG-CD1 3.79Å; R27-L31 HydrophobicContact CG-CG 4.35Å; R27-L31 WeakPolarHBondContact O-CB 3.43Å; R27-L31 VanDerWaalsContact O-CG 3.31Å; R27-L31 WeakPolarHBondContact O-CG 3.5Å; R27-L31 PolarHBondContact O-N 3.4Å
28	F	60.9	Low	55.1	Low	79 Å²	79	101.1 Å²	101.1	35%	0.346	54%	0.544	S	S	.	.	H	α-helix	trans	-61.2	-45.6	176.3	-177.5	-88.5	0	0	0	110.3	D22 P23 S25 A30 L31 C32	D22-F28 WeakPolarHBondContact O-CB 3.46Å; P23-F28 VanDerWaalsContact CA-CD1 3.42Å; P23-F28 HydrophobicContact CB-CD1 4.26Å; P23-F28 HydrophobicContact CB-CE1 3.9Å; P23-F28 HydrophobicContact CB-CZ 4.14Å; P23-F28 WeakPolarHBondContact O-CD1 3.39Å; S25-F28 PolarHBondContact O-N 2.9Å; S25-F28 WeakPolarHBondContact OG-CB 3.43Å; S25-F28 PolarHBondContact OG-N 2.8Å; S25-F28 VanDerWaalsContact OG-N 3.13Å; F28-A30 VanDerWaalsContact C-N 3.34Å; F28-A30 PolarHBondContact O-N 3.24Å; F28-L31 PolarHBondContact O-N 2.97Å; F28-C32 HydrophobicContact CD1-CB 4.46Å; F28-C32 HydrophobicContact CE1-CB 4.39Å; F28-C32 VanDerWaalsContact CE1-SG 3.54Å; F28-C32 VanDerWaalsContact CZ-SG 3.55Å; F28-C32 WeakPolarHBondContact O-CB 3.41Å; F28-C32 PolarHBondContact O-N 2.94Å; F28-C32 PolarHBondContact O-SG 2.89Å
29	I	61.5	Low	54.7	Low	96 Å²	96	102.6 Å²	102.6	49%	0.492	55%	0.554	S	S	.	*	H	α-helix	trans	-60.8	-41.9	177	-63.9	165.9	0	0	0	111.6	N24 S25 R27 R33	N24-I29 WeakPolarHBondContact O-CD1 3.45Å; S25-I29 WeakPolarHBondContact O-CG1 3.44Å; S25-I29 PolarHBondContact O-N 3.36Å; R27-I29 VanDerWaalsContact C-N 3.33Å; I29-R33 PolarHBondContact O-N 2.9Å
30	A	57.2	Low	54.6	Low	69 Å²	69	99.7 Å²	99.7	57%	0.57	56%	0.563	S	S	*	*	H	α-helix	trans	-69.1	-38.3	178.6	0	0	0	0	0	113.2	P26 R27 F28	P26-A30 WeakPolarHBondContact O-CB 3.49Å; P26-A30 PolarHBondContact O-N 2.84Å; R27-A30 PolarHBondContact O-N 3.2Å; F28-A30 VanDerWaalsContact C-N 3.34Å; F28-A30 PolarHBondContact O-N 3.24Å
31	L	56.9	Low	54.6	Low	112 Å²	112	102.5 Å²	102.5	59%	0.586	58%	0.583	S	S	*	*	H	α-helix	trans	-79.6	-29.4	178.6	-68.7	173	0	0	0	112.9	R27 F28 R33	R27-L31 HydrophobicContact CG-CD1 3.79Å; R27-L31 HydrophobicContact CG-CG 4.35Å; R27-L31 WeakPolarHBondContact O-CB 3.43Å; R27-L31 VanDerWaalsContact O-CG 3.31Å; R27-L31 WeakPolarHBondContact O-CG 3.5Å; R27-L31 PolarHBondContact O-N 3.4Å; F28-L31 PolarHBondContact O-N 2.97Å; L31-R33 VanDerWaalsContact C-N 3.35Å
32	C	48.7	Very low	54.4	Low	69 Å²	69	97.8 Å²	97.8	47%	0.466	58%	0.579	S	S	.	*	H	α-helix	trans	-82	-10.3	178.7	-70.6	0	0	0	0	113.6	F28 T34	F28-C32 HydrophobicContact CD1-CB 4.46Å; F28-C32 HydrophobicContact CE1-CB 4.39Å; F28-C32 VanDerWaalsContact CE1-SG 3.54Å; F28-C32 VanDerWaalsContact CZ-SG 3.55Å; F28-C32 WeakPolarHBondContact O-CB 3.41Å; F28-C32 PolarHBondContact O-N 2.94Å; F28-C32 PolarHBondContact O-SG 2.89Å; C32-T34 PolarHBondContact O-N 3.43Å
33	R	48.3	Very low	54	Low	214 Å²	214	103.8 Å²	103.8	81%	0.808	61%	0.605	S	S	*	*	S	Bend	trans	-70.6	84.3	159	-92.1	-171.9	-175	-178.3	2.3	108	I29 L31 S35	I29-R33 PolarHBondContact O-N 2.9Å; L31-R33 VanDerWaalsContact C-N 3.35Å; R33-S35 PolarHBondContact O-N 3.36Å
34	T	48.5	Very low	54	Low	67 Å²	67	102.8 Å²	102.8	41%	0.411	60%	0.6	S	S	.	*			trans	-49.6	130.7	159.9	50.6	0	0	0	0	107.7	C32 I36	C32-T34 PolarHBondContact O-N 3.43Å; T34-I36 CarbonylContact O-C 3.51Å; T34-I36 PolarHBondContact O-N 2.8Å; T34-I36 PolarHBondContact OG1-O 2.79Å
35	S	44.6	Very low	54.5	Low	126 Å²	126	99.8 Å²	99.8	88%	0.881	58%	0.584	S	S	*	*	S	Bend	trans	-59.6	-10.3	172.8	47.8	0	0	0	0	112.9	R33	R33-S35 PolarHBondContact O-N 3.36Å
36	I	47.7	Very low	55	Low	125 Å²	125	103.8 Å²	103.8	64%	0.641	61%	0.61	S	S	*	*	S	Bend	trans	-84.8	117.2	167.1	-53	175.4	0	0	0	107.1	T34 T38	T34-I36 CarbonylContact O-C 3.51Å; T34-I36 PolarHBondContact O-N 2.8Å; T34-I36 PolarHBondContact OG1-O 2.79Å; I36-T38 PolarHBondContact O-N 2.92Å
37	P	43.3	Very low	55.9	Low	114 Å²	114	104.9 Å²	104.9	74%	0.74	61%	0.605	S	S	*	*			trans	-58.4	109.3	171.8	24	-31.1	0	0	0	108	S39	P37-S39 PolarHBondContact O-N 2.84Å; P37-S39 VanDerWaalsContact O-N 3.14Å
38	T	47.3	Very low	56.9	Low	49 Å²	49	101.7 Å²	101.7	30%	0.301	60%	0.598	S	S	.	*			trans	-54.7	119.7	154.1	-52.6	0	0	0	0	104.8	I36 A40 R56	I36-T38 PolarHBondContact O-N 2.92Å; T38-A40 PolarHBondContact O-N 2.85Å; T38-R56 PolarHBondContact OG1-NH2 3.33Å
39	S	46.9	Very low	57.7	Low	85 Å²	85	101 Å²	101	59%	0.594	60%	0.597	S	S	*	*	S	Bend	trans	-34	111	175	27.5	0	0	0	0	110.1	P37 A41	P37-S39 PolarHBondContact O-N 2.84Å; P37-S39 VanDerWaalsContact O-N 3.14Å; S39-A41 PolarHBondContact O-N 3.29Å
40	A	50.6	Low	58.7	Low	93 Å²	93	103.1 Å²	103.1	77%	0.769	61%	0.605	S	S	*	*			trans	27.1	88.8	171.3	0	0	0	0	0	115.7	T38 A42	T38-A40 PolarHBondContact O-N 2.85Å; A40-A42 PolarHBondContact O-N 2.87Å
41	A	53.6	Low	60	Low	94 Å²	94	106.3 Å²	106.3	78%	0.777	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.4	98.4	166.3	0	0	0	0	0	110.3	S39	S39-A41 PolarHBondContact O-N 3.29Å
42	A	47.4	Very low	61.2	Low	94 Å²	94	103.7 Å²	103.7	78%	0.777	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-151.3	-32	153.1	0	0	0	0	0	112.9	A40	A40-A42 PolarHBondContact O-N 2.87Å
43	E	55.8	Low	62.9	Low	193 Å²	193	105.3 Å²	105.3	90%	0.902	59%	0.594	S	S	*	*			trans	-149.6	46	-175.6	-62.4	-163.6	177.8	0	0	114.1
44	S	60.1	Low	64.7	Low	54 Å²	54	101.2 Å²	101.2	38%	0.378	58%	0.583	S	S	.	*			trans	-80.9	130.4	173.8	51.3	0	0	0	0	111.5
45	D	77	Confident	66.6	Low	65 Å²	65	100.5 Å²	100.5	35%	0.348	58%	0.584	S	S	.	*			trans	-52.6	130	174.9	171.9	5.9	0	0	0	110.5	Q47 Q48 L49	D45-Q47 PolarHBondContact O-N 3.33Å; D45-Q47 VanDerWaalsContact O-N 3.11Å; D45-Q47 PolarHBondContact OD1-N 2.73Å; D45-Q48 HydrophobicContact CB-CB 4.29Å; D45-Q48 HydrophobicContact CB-CG 3.96Å; D45-Q48 WeakPolarHBondContact O-CB 3.2Å; D45-Q48 PolarHBondContact O-N 3.05Å; D45-L49 PolarHBondContact O-N 2.79Å
46	P	78	Confident	68.8	Low	101 Å²	101	98.8 Å²	98.8	66%	0.656	56%	0.559	S	S	*	*	H	α-helix	trans	-54.2	-30.4	179.6	21.8	-35.3	0	0	0	113.7	Q50	P46-Q50 PolarHBondContact O-N 3.01Å; P46-Q50 VanDerWaalsContact O-N 3.11Å
47	Q	80.5	Confident	70.9	Confident	135 Å²	135	96.4 Å²	96.4	63%	0.631	55%	0.553	S	S	*	*	H	α-helix	trans	-68.1	-44.7	176.2	-65.2	-171	-24.3	0	0	111.4	D45 L49 Q50 E51	D45-Q47 PolarHBondContact O-N 3.33Å; D45-Q47 VanDerWaalsContact O-N 3.11Å; D45-Q47 PolarHBondContact OD1-N 2.73Å; Q47-L49 VanDerWaalsContact C-N 3.33Å; Q47-L49 PolarHBondContact O-N 2.82Å; Q47-Q50 WeakPolarHBondContact O-CB 3.22Å; Q47-Q50 PolarHBondContact O-N 2.83Å; Q47-E51 WeakPolarHBondContact O-CG 3.42Å; Q47-E51 PolarHBondContact O-N 3.17Å
48	Q	79.8	Confident	73.3	Confident	102 Å²	102	93.2 Å²	93.2	48%	0.477	53%	0.531	S	S	.	.	H	α-helix	trans	-62.3	-41	176.2	-65	177.4	1.8	0	0	111.4	D45 Q50 E51 E52	D45-Q48 HydrophobicContact CB-CB 4.29Å; D45-Q48 HydrophobicContact CB-CG 3.96Å; D45-Q48 WeakPolarHBondContact O-CB 3.2Å; D45-Q48 PolarHBondContact O-N 3.05Å; Q48-Q50 VanDerWaalsContact C-N 3.31Å; Q48-Q50 PolarHBondContact O-N 3.04Å; Q48-E51 PolarHBondContact O-N 3.34Å; Q48-E52 WeakPolarHBondContact O-CG 3.42Å; Q48-E52 PolarHBondContact O-N 2.79Å
49	L	78.9	Confident	75.6	Confident	65 Å²	65	96.5 Å²	96.5	34%	0.34	55%	0.546	S	S	.	.	H	α-helix	trans	-59.6	-42.6	175.2	179	63.9	0	0	0	111.8	D45 Q47 E52 Q53	D45-L49 PolarHBondContact O-N 2.79Å; Q47-L49 VanDerWaalsContact C-N 3.33Å; Q47-L49 PolarHBondContact O-N 2.82Å; L49-E52 PolarHBondContact O-N 3.09Å; L49-Q53 HydrophobicContact CD1-CG 4.37Å; L49-Q53 WeakPolarHBondContact O-CB 3.49Å; L49-Q53 VanDerWaalsContact O-CG 3.28Å; L49-Q53 WeakPolarHBondContact O-CG 3.46Å; L49-Q53 PolarHBondContact O-N 3.4Å
50	Q	81.3	Confident	77.9	Confident	140 Å²	140	96.5 Å²	96.5	65%	0.654	53%	0.533	S	S	*	.	H	α-helix	trans	-64.3	-43.4	178.3	-175	174.3	9.8	0	0	111.6	P46 Q47 Q48 Q53 H54	P46-Q50 PolarHBondContact O-N 3.01Å; P46-Q50 VanDerWaalsContact O-N 3.11Å; Q47-Q50 WeakPolarHBondContact O-CB 3.22Å; Q47-Q50 PolarHBondContact O-N 2.83Å; Q48-Q50 VanDerWaalsContact C-N 3.31Å; Q48-Q50 PolarHBondContact O-N 3.04Å; Q50-Q53 PolarHBondContact O-N 3.3Å; Q50-H54 PolarHBondContact O-N 2.95Å
51	E	84.7	Confident	80	Confident	136 Å²	136	96.5 Å²	96.5	64%	0.636	52%	0.517	S	S	*	.	H	α-helix	trans	-62.7	-45.3	176.3	-71	178.6	179.9	0	0	111.8	Q47 Q48 Q53 H54 A55	Q47-E51 WeakPolarHBondContact O-CG 3.42Å; Q47-E51 PolarHBondContact O-N 3.17Å; Q48-E51 PolarHBondContact O-N 3.34Å; E51-Q53 PolarHBondContact O-N 3.22Å; E51-H54 PolarHBondContact O-N 3.03Å; E51-A55 WeakPolarHBondContact O-CB 3.37Å; E51-A55 PolarHBondContact O-N 3.13Å
52	E	83.1	Confident	82.1	Confident	57 Å²	57	100.3 Å²	100.3	27%	0.266	51%	0.512	S	S	.	.	H	α-helix	trans	-61.2	-43.6	175.8	-73.1	-174.6	-177	0	0	112.1	Q48 L49 H54 A55 R56	Q48-E52 WeakPolarHBondContact O-CG 3.42Å; Q48-E52 PolarHBondContact O-N 2.79Å; L49-E52 PolarHBondContact O-N 3.09Å; E52-H54 VanDerWaalsContact C-N 3.32Å; E52-H54 PolarHBondContact O-N 2.91Å; E52-A55 PolarHBondContact O-N 2.93Å; E52-R56 WeakPolarHBondContact O-CB 3.42Å; E52-R56 VanDerWaalsContact O-CG 3.28Å; E52-R56 WeakPolarHBondContact O-CG 3.23Å; E52-R56 PolarHBondContact O-N 3.34Å; E52-R56 IonicContact OE2-CZ 2.77Å; E52-R56 VanDerWaalsContact OE2-CZ 3.29Å; E52-R56 IonicContact OE2-NH1 3.29Å; E52-R56 PolarHBondContact OE2-NH1 3.2Å; E52-R56 IonicContact OE2-NH2 2.75Å; E52-R56 PolarHBondContact OE2-NH2 3.31Å
53	Q	83.8	Confident	84.3	Confident	103 Å²	103	99.6 Å²	99.6	48%	0.481	49%	0.491	S	S	.	.	H	α-helix	trans	-63.6	-39.5	177.5	-75.8	-180	3	0	0	111.7	L49 Q50 E51 S57	L49-Q53 HydrophobicContact CD1-CG 4.37Å; L49-Q53 WeakPolarHBondContact O-CB 3.49Å; L49-Q53 VanDerWaalsContact O-CG 3.28Å; L49-Q53 WeakPolarHBondContact O-CG 3.46Å; L49-Q53 PolarHBondContact O-N 3.4Å; Q50-Q53 PolarHBondContact O-N 3.3Å; E51-Q53 PolarHBondContact O-N 3.22Å; Q53-S57 WeakPolarHBondContact O-CB 3.43Å; Q53-S57 PolarHBondContact O-N 3.39Å; Q53-S57 PolarHBondContact O-OG 3.22Å
54	H	86.1	Confident	86.2	Confident	128 Å²	128	94.2 Å²	94.2	59%	0.593	47%	0.468	S	S	*	.	H	α-helix	trans	-62.9	-48.4	173.7	-177.4	27.9	0	0	0	111.1	Q50 E51 E52 R56 S57 V58	Q50-H54 PolarHBondContact O-N 2.95Å; E51-H54 PolarHBondContact O-N 3.03Å; E52-H54 VanDerWaalsContact C-N 3.32Å; E52-H54 PolarHBondContact O-N 2.91Å; H54-R56 PolarHBondContact O-N 3.27Å; H54-S57 WeakPolarHBondContact O-CB 3.47Å; H54-S57 PolarHBondContact O-N 3.1Å; H54-S57 VanDerWaalsContact O-N 3.11Å; H54-V58 WeakPolarHBondContact O-CG2 3.44Å; H54-V58 PolarHBondContact O-N 2.81Å
55	A	88.7	Confident	87.8	Confident	52 Å²	52	99.5 Å²	99.5	43%	0.43	48%	0.48	S	S	.	.	H	α-helix	trans	-59.2	-45.3	177.8	0	0	0	0	0	112.1	E51 E52 S57 V58 L59	E51-A55 WeakPolarHBondContact O-CB 3.37Å; E51-A55 PolarHBondContact O-N 3.13Å; E52-A55 PolarHBondContact O-N 2.93Å; A55-S57 VanDerWaalsContact C-N 3.29Å; A55-S57 PolarHBondContact O-N 2.75Å; A55-V58 PolarHBondContact O-N 3.31Å; A55-L59 WeakPolarHBondContact O-CG 3.44Å; A55-L59 PolarHBondContact O-N 2.87Å
56	R	89.6	Confident	88.7	Confident	90 Å²	90	98.9 Å²	98.9	34%	0.34	48%	0.48	S	S	.	.	H	α-helix	trans	-57.7	-42	174.2	-74.9	178	-173.4	111	7.1	111.5	T38 E52 H54 L59 R60	T38-R56 PolarHBondContact OG1-NH2 3.33Å; E52-R56 WeakPolarHBondContact O-CB 3.42Å; E52-R56 VanDerWaalsContact O-CG 3.28Å; E52-R56 WeakPolarHBondContact O-CG 3.23Å; E52-R56 PolarHBondContact O-N 3.34Å; E52-R56 IonicContact OE2-CZ 2.77Å; E52-R56 VanDerWaalsContact OE2-CZ 3.29Å; E52-R56 IonicContact OE2-NH1 3.29Å; E52-R56 PolarHBondContact OE2-NH1 3.2Å; E52-R56 IonicContact OE2-NH2 2.75Å; E52-R56 PolarHBondContact OE2-NH2 3.31Å; H54-R56 PolarHBondContact O-N 3.27Å; R56-L59 PolarHBondContact O-N 2.92Å; R56-R60 WeakPolarHBondContact O-CB 3.4Å; R56-R60 PolarHBondContact O-N 3.01Å
57	S	91.6	Very high	89.4	Confident	75 Å²	75	95 Å²	95	52%	0.524	45%	0.454	S	S	.	.	H	α-helix	trans	-64.4	-43.7	179	-58.5	0	0	0	0	111.8	Q53 H54 A55 R60 E61	Q53-S57 WeakPolarHBondContact O-CB 3.43Å; Q53-S57 PolarHBondContact O-N 3.39Å; Q53-S57 PolarHBondContact O-OG 3.22Å; H54-S57 WeakPolarHBondContact O-CB 3.47Å; H54-S57 PolarHBondContact O-N 3.1Å; H54-S57 VanDerWaalsContact O-N 3.11Å; A55-S57 VanDerWaalsContact C-N 3.29Å; A55-S57 PolarHBondContact O-N 2.75Å; S57-R60 PolarHBondContact O-N 2.99Å; S57-E61 WeakPolarHBondContact O-CB 3.37Å; S57-E61 PolarHBondContact O-N 3.45Å
58	V	95.4	Very high	90.1	Very high	47 Å²	47	95.2 Å²	95.2	29%	0.285	46%	0.458	S	S	.	.	H	α-helix	trans	-65	-44.6	177.2	174.1	0	0	0	0	111.4	H54 A55 R60 E61 R62	H54-V58 WeakPolarHBondContact O-CG2 3.44Å; H54-V58 PolarHBondContact O-N 2.81Å; A55-V58 PolarHBondContact O-N 3.31Å; V58-R60 VanDerWaalsContact C-N 3.33Å; V58-E61 PolarHBondContact O-N 2.86Å; V58-R62 WeakPolarHBondContact O-CG 3.18Å; V58-R62 PolarHBondContact O-N 2.95Å; V58-R62 VanDerWaalsContact O-N 3.08Å
59	L	95.4	Very high	90.8	Very high	117 Å²	117	92.1 Å²	92.1	61%	0.613	45%	0.45	S	S	*	.	H	α-helix	trans	-62	-43.6	176.3	-71.4	173.3	0	0	0	111.3	A55 R56 R62 F63	A55-L59 WeakPolarHBondContact O-CG 3.44Å; A55-L59 PolarHBondContact O-N 2.87Å; R56-L59 PolarHBondContact O-N 2.92Å; L59-R62 PolarHBondContact O-N 2.92Å; L59-F63 WeakPolarHBondContact O-CB 3.31Å; L59-F63 PolarHBondContact O-N 2.99Å
60	R	93.9	Very high	91.6	Very high	86 Å²	86	89 Å²	89	33%	0.325	43%	0.434	S	S	.	.	H	α-helix	trans	-64.3	-42.5	178.1	-176.6	57.5	176.2	-176.9	-0.8	111.9	R56 S57 V58 F63 L64 I94	R56-R60 WeakPolarHBondContact O-CB 3.4Å; R56-R60 PolarHBondContact O-N 3.01Å; S57-R60 PolarHBondContact O-N 2.99Å; V58-R60 VanDerWaalsContact C-N 3.33Å; R60-F63 PolarHBondContact O-N 2.75Å; R60-L64 HydrophobicContact CG-CD1 4.12Å; R60-L64 HydrophobicContact CG-CG 4.41Å; R60-L64 WeakPolarHBondContact O-CB 3.09Å; R60-L64 VanDerWaalsContact O-CG 3.29Å; R60-L64 WeakPolarHBondContact O-CG 3.32Å; R60-L64 PolarHBondContact O-N 2.9Å; R60-I94 PolarHBondContact NH2-O 3.39Å
61	E	95.8	Very high	92.3	Very high	93 Å²	93	85.4 Å²	85.4	44%	0.435	42%	0.424	S	S	.	.	H	α-helix	trans	-58.2	-49.2	175.4	-174.5	-167.5	157.4	0	0	111.3	S57 V58 F63 L64 R65	S57-E61 WeakPolarHBondContact O-CB 3.37Å; S57-E61 PolarHBondContact O-N 3.45Å; V58-E61 PolarHBondContact O-N 2.86Å; E61-F63 VanDerWaalsContact C-N 3.31Å; E61-F63 PolarHBondContact O-N 2.89Å; E61-L64 PolarHBondContact O-N 3.48Å; E61-R65 WeakPolarHBondContact O-CG 3.15Å; E61-R65 PolarHBondContact O-N 3.18Å; E61-R65 IonicContact OE1-CZ 3.18Å; E61-R65 IonicContact OE1-NE 2.82Å; E61-R65 PolarHBondContact OE1-NE 3.14Å; E61-R65 IonicContact OE1-NH2 2.7Å; E61-R65 PolarHBondContact OE1-NH2 2.83Å
62	R	96.7	Very high	92.9	Very high	174 Å²	174	85.2 Å²	85.2	66%	0.657	43%	0.428	S	S	*	.	H	α-helix	trans	-60.1	-42.9	178.3	-71.7	177.2	178.4	-167.9	-0.1	111.9	V58 L59 R65 C66	V58-R62 WeakPolarHBondContact O-CG 3.18Å; V58-R62 PolarHBondContact O-N 2.95Å; V58-R62 VanDerWaalsContact O-N 3.08Å; L59-R62 PolarHBondContact O-N 2.92Å; R62-R65 PolarHBondContact O-N 3.03Å; R62-C66 PolarHBondContact O-N 3.48Å
63	F	94.3	Very high	93.6	Very high	79 Å²	79	85.1 Å²	85.1	35%	0.346	43%	0.426	S	S	.	.	H	α-helix	trans	-61.8	-46.2	176.2	177.3	-100.1	0	0	0	112.3	L59 R60 E61 R65 C66 L67 V96	L59-F63 WeakPolarHBondContact O-CB 3.31Å; L59-F63 PolarHBondContact O-N 2.99Å; R60-F63 PolarHBondContact O-N 2.75Å; E61-F63 VanDerWaalsContact C-N 3.31Å; E61-F63 PolarHBondContact O-N 2.89Å; F63-R65 VanDerWaalsContact C-N 3.35Å; F63-R65 PolarHBondContact O-N 2.83Å; F63-C66 VanDerWaalsContact O-CB 3.26Å; F63-C66 WeakPolarHBondContact O-CB 3.34Å; F63-C66 PolarHBondContact O-N 3.44Å; F63-C66 VanDerWaalsContact O-N 3.13Å; F63-L67 HydrophobicContact CD1-CD1 4.25Å; F63-L67 HydrophobicContact CE1-CD1 3.65Å; F63-L67 HydrophobicContact CE1-CG 4.14Å; F63-L67 HydrophobicContact CZ-CD1 4.1Å; F63-L67 HydrophobicContact CZ-CD2 4.27Å; F63-L67 HydrophobicContact CZ-CG 4.27Å; F63-L67 PolarHBondContact O-N 3.28Å; F63-V96 HydrophobicContact CE1-CG2 3.53Å; F63-V96 HydrophobicContact CZ-CB 4.32Å; F63-V96 HydrophobicContact CZ-CG1 4.28Å; F63-V96 HydrophobicContact CZ-CG2 3.63Å
64	L	94.4	Very high	94.2	Very high	79 Å²	79	86.4 Å²	86.4	41%	0.414	43%	0.43	S	S	.	.	H	α-helix	trans	-64.7	-38.2	177.4	-69.6	175.3	0	0	0	112.3	R60 E61 C66 L67 L68	R60-L64 HydrophobicContact CG-CD1 4.12Å; R60-L64 HydrophobicContact CG-CG 4.41Å; R60-L64 WeakPolarHBondContact O-CB 3.09Å; R60-L64 VanDerWaalsContact O-CG 3.29Å; R60-L64 WeakPolarHBondContact O-CG 3.32Å; R60-L64 PolarHBondContact O-N 2.9Å; E61-L64 PolarHBondContact O-N 3.48Å; L64-C66 VanDerWaalsContact C-N 3.28Å; L64-C66 PolarHBondContact O-N 2.89Å; L64-L67 HydrophobicContact CD2-CD1 4.31Å; L64-L67 PolarHBondContact O-N 2.84Å; L64-L68 PolarHBondContact O-N 3.06Å
65	R	95.6	Very high	94.8	Very high	166 Å²	166	80.3 Å²	80.3	63%	0.626	40%	0.402	S	S	*	.	H	α-helix	trans	-62.5	-36	172.7	-72.7	175.5	-179	-102.3	5.4	111.8	E61 R62 F63 L68 A69	E61-R65 WeakPolarHBondContact O-CG 3.15Å; E61-R65 PolarHBondContact O-N 3.18Å; E61-R65 IonicContact OE1-CZ 3.18Å; E61-R65 IonicContact OE1-NE 2.82Å; E61-R65 PolarHBondContact OE1-NE 3.14Å; E61-R65 IonicContact OE1-NH2 2.7Å; E61-R65 PolarHBondContact OE1-NH2 2.83Å; R62-R65 PolarHBondContact O-N 3.03Å; F63-R65 VanDerWaalsContact C-N 3.35Å; F63-R65 PolarHBondContact O-N 2.83Å; R65-L68 PolarHBondContact O-N 3.41Å; R65-A69 WeakPolarHBondContact O-CB 3.48Å; R65-A69 PolarHBondContact O-N 2.8Å
66	C	94.2	Very high	95.3	Very high	52 Å²	52	83.3 Å²	83.3	35%	0.351	40%	0.402	S	S	.	.	H	α-helix	trans	-63.6	-47.8	173.8	-175.6	0	0	0	0	111.6	R62 F63 L64 L68 A69 M70	R62-C66 PolarHBondContact O-N 3.48Å; F63-C66 VanDerWaalsContact O-CB 3.26Å; F63-C66 WeakPolarHBondContact O-CB 3.34Å; F63-C66 PolarHBondContact O-N 3.44Å; F63-C66 VanDerWaalsContact O-N 3.13Å; L64-C66 VanDerWaalsContact C-N 3.28Å; L64-C66 PolarHBondContact O-N 2.89Å; C66-L68 VanDerWaalsContact C-N 3.27Å; C66-L68 PolarHBondContact O-N 3.15Å; C66-A69 PolarHBondContact O-N 2.66Å; C66-A69 VanDerWaalsContact O-N 3.14Å; C66-M70 PolarHBondContact O-N 3.47Å
67	L	93.6	Very high	95.7	Very high	20 Å²	20	79 Å²	79	11%	0.105	39%	0.386	C	S	.	.	H	α-helix	trans	-58.4	-41.1	175.5	-65.6	-179	0	0	0	111.9	F63 L64 M70 S71 V96	F63-L67 HydrophobicContact CD1-CD1 4.25Å; F63-L67 HydrophobicContact CE1-CD1 3.65Å; F63-L67 HydrophobicContact CE1-CG 4.14Å; F63-L67 HydrophobicContact CZ-CD1 4.1Å; F63-L67 HydrophobicContact CZ-CD2 4.27Å; F63-L67 HydrophobicContact CZ-CG 4.27Å; F63-L67 PolarHBondContact O-N 3.28Å; L64-L67 HydrophobicContact CD2-CD1 4.31Å; L64-L67 PolarHBondContact O-N 2.84Å; L67-M70 HydrophobicContact CD2-CE 3.85Å; L67-M70 WeakPolarHBondContact O-CB 3.5Å; L67-M70 PolarHBondContact O-N 3.03Å; L67-S71 PolarHBondContact O-N 2.77Å; L67-V96 HydrophobicContact CD1-CG2 4Å
68	L	94.4	Very high	96	Very high	138 Å²	138	78.6 Å²	78.6	72%	0.723	38%	0.375	S	S	*	.	H	α-helix	trans	-65.5	-40.9	176.8	-172.7	139	0	0	0	112	L64 R65 C66 M70 S71	L64-L68 PolarHBondContact O-N 3.06Å; R65-L68 PolarHBondContact O-N 3.41Å; C66-L68 VanDerWaalsContact C-N 3.27Å; C66-L68 PolarHBondContact O-N 3.15Å; L68-M70 PolarHBondContact O-N 3.42Å; L68-S71 WeakPolarHBondContact O-CB 3.42Å; L68-S71 PolarHBondContact O-N 3.35Å
69	A	95.6	Very high	96	Very high	38 Å²	38	78.1 Å²	78.1	31%	0.314	37%	0.371	S	S	.	.	H	α-helix	trans	-66.9	-22.5	176.2	0	0	0	0	0	113.4	R65 C66 K73	R65-A69 WeakPolarHBondContact O-CB 3.48Å; R65-A69 PolarHBondContact O-N 2.8Å; C66-A69 PolarHBondContact O-N 2.66Å; C66-A69 VanDerWaalsContact O-N 3.14Å; A69-K73 WeakPolarHBondContact O-CD 3.46Å; A69-K73 WeakPolarHBondContact O-CE 3.48Å; A69-K73 PolarHBondContact O-NZ 2.96Å
70	M	95.8	Very high	96	Very high	0 Å²	0	77.7 Å²	77.7	0%	0	37%	0.365	C	S	.	.	H	α-helix	trans	-81.6	-17.9	176.2	-170.4	171.8	58.8	0	0	112.8	C66 L67 L68 N72 K73 V75 F89 F124 F126	C66-M70 PolarHBondContact O-N 3.47Å; L67-M70 HydrophobicContact CD2-CE 3.85Å; L67-M70 WeakPolarHBondContact O-CB 3.5Å; L67-M70 PolarHBondContact O-N 3.03Å; L68-M70 PolarHBondContact O-N 3.42Å; M70-N72 PolarHBondContact O-N 3.2Å; M70-K73 VanDerWaalsContact O-CB 3.31Å; M70-K73 WeakPolarHBondContact O-CB 3.42Å; M70-K73 PolarHBondContact O-N 3.27Å; M70-K73 VanDerWaalsContact O-N 3.09Å; M70-V75 HydrophobicContact CG-CG2 3.46Å; M70-V75 VanDerWaalsContact CG-CG2 3.46Å; M70-V75 HydrophobicContact SD-CG1 4.09Å; M70-V75 HydrophobicContact SD-CG2 3.69Å; M70-F89 HydrophobicContact CB-CD1 4.02Å; M70-F89 HydrophobicContact CB-CE1 4.34Å; M70-F89 HydrophobicContact CE-CD1 3.77Å; M70-F89 HydrophobicContact CE-CD2 3.59Å; M70-F89 HydrophobicContact CE-CE1 3.68Å; M70-F89 HydrophobicContact CE-CE2 3.52Å; M70-F89 HydrophobicContact CE-CG 3.72Å; M70-F89 HydrophobicContact CE-CZ 3.54Å; M70-F89 HydrophobicContact CG-CB 4.02Å; M70-F89 HydrophobicContact CG-CD1 3.78Å; M70-F89 HydrophobicContact CG-CE1 4.43Å; M70-F89 HydrophobicContact CG-CG 3.88Å; M70-F89 WeakPolarHBondContact O-CD1 3.4Å; M70-F89 HydrophobicContact SD-CD1 4.49Å; M70-F89 HydrophobicContact SD-CD2 4.45Å; M70-F89 HydrophobicContact SD-CG 4.25Å; M70-F124 HydrophobicContact CE-CE2 3.93Å; M70-F124 HydrophobicContact CE-CZ 4.28Å; M70-F124 HydrophobicContact SD-CD2 3.65Å; M70-F124 HydrophobicContact SD-CE2 3.4Å; M70-F124 WeakPolarHBondContact SD-CE2 3.35Å; M70-F124 HydrophobicContact SD-CZ 4.31Å; M70-F126 HydrophobicContact CB-CD1 4.35Å; M70-F126 HydrophobicContact CB-CD2 4.23Å; M70-F126 HydrophobicContact CB-CE1 4.18Å; M70-F126 HydrophobicContact CB-CE2 4.04Å; M70-F126 HydrophobicContact CB-CG 4.37Å; M70-F126 HydrophobicContact CB-CZ 4.02Å; M70-F126 HydrophobicContact CG-CB 4.38Å; M70-F126 HydrophobicContact CG-CD1 3.97Å; M70-F126 HydrophobicContact CG-CD2 4.2Å; M70-F126 HydrophobicContact CG-CE1 4.27Å; M70-F126 HydrophobicContact CG-CE2 4.48Å; M70-F126 HydrophobicContact CG-CG 3.93Å; M70-F126 HydrophobicContact SD-CD1 3.84Å; M70-F126 HydrophobicContact SD-CE1 4.17Å; M70-F126 HydrophobicContact SD-CG 4.34Å
71	S	95.3	Very high	95.9	Very high	64 Å²	64	81.9 Å²	81.9	45%	0.448	39%	0.389	S	S	.	.	T	Hydrogen-bonded Turn	trans	-52.5	130.8	-179.3	-171.5	0	0	0	0	112.2	L67 L68 K73	L67-S71 PolarHBondContact O-N 2.77Å; L68-S71 WeakPolarHBondContact O-CB 3.42Å; L68-S71 PolarHBondContact O-N 3.35Å; S71-K73 PolarHBondContact O-N 2.78Å
72	N	96.8	Very high	95.7	Very high	132 Å²	132	86.8 Å²	86.8	71%	0.706	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	59	24.7	-179.8	-161	41.9	0	0	0	114.3	M70 F89	M70-N72 PolarHBondContact O-N 3.2Å; N72-F89 WeakPolarHBondContact CA-O 3.31Å; N72-F89 PolarHBondContact N-O 2.97Å
73	K	97.9	Very high	95.6	Very high	54 Å²	54	81 Å²	81	24%	0.235	39%	0.392	C	S	.	.	S	Bend	trans	-105.7	156.1	173.7	-63	-169.4	171.4	177.6	0	111.3	A69 M70 S71 V75 T88 F89 F126 D127 V128	A69-K73 WeakPolarHBondContact O-CD 3.46Å; A69-K73 WeakPolarHBondContact O-CE 3.48Å; A69-K73 PolarHBondContact O-NZ 2.96Å; M70-K73 VanDerWaalsContact O-CB 3.31Å; M70-K73 WeakPolarHBondContact O-CB 3.42Å; M70-K73 PolarHBondContact O-N 3.27Å; M70-K73 VanDerWaalsContact O-N 3.09Å; S71-K73 PolarHBondContact O-N 2.78Å; K73-V75 PolarHBondContact O-N 3.37Å; K73-T88 WeakPolarHBondContact O-CA 3.33Å; K73-F89 PolarHBondContact O-N 3.37Å; K73-F126 HydrophobicContact CD-CD2 3.9Å; K73-F126 HydrophobicContact CD-CE2 4.39Å; K73-D127 VanDerWaalsContact CD-O 3.28Å; K73-D127 WeakPolarHBondContact CD-O 3.35Å; K73-D127 PolarHBondContact NZ-O 3.35Å; K73-V128 VanDerWaalsContact NZ-C 3.32Å; K73-V128 PolarHBondContact NZ-OXT 3.09Å
74	K	98.1	Very high	95.7	Very high	131 Å²	131	82.1 Å²	82.1	57%	0.57	40%	0.402	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.3	127.2	166.9	-73.2	-174.5	159.7	-143.4	0	109.8	E86 A87	K74-E86 WeakPolarHBondContact CD-OE1 3.48Å; K74-E86 WeakPolarHBondContact CE-OE1 3.46Å; K74-E86 IonicContact NZ-OE1 3.86Å; K74-E86 PolarHBondContact NZ-OE1 3.26Å; K74-A87 WeakPolarHBondContact CA-O 3.48Å
75	V	98.3	Very high	95.9	Very high	0 Å²	0	78.7 Å²	78.7	0%	0	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	131.5	-179.8	-176.2	0	0	0	0	108.5	M70 K73 F77 E86 A87 F89 F124 T125 F126	M70-V75 HydrophobicContact CG-CG2 3.46Å; M70-V75 VanDerWaalsContact CG-CG2 3.46Å; M70-V75 HydrophobicContact SD-CG1 4.09Å; M70-V75 HydrophobicContact SD-CG2 3.69Å; K73-V75 PolarHBondContact O-N 3.37Å; V75-F77 HydrophobicContact CB-CD2 4.44Å; V75-F77 HydrophobicContact CB-CE2 3.74Å; V75-F77 HydrophobicContact CB-CZ 3.99Å; V75-F77 HydrophobicContact CG1-CD2 4.17Å; V75-F77 HydrophobicContact CG1-CE1 4.09Å; V75-F77 HydrophobicContact CG1-CE2 3.7Å; V75-F77 HydrophobicContact CG1-CZ 3.65Å; V75-E86 WeakPolarHBondContact O-CA 3.49Å; V75-A87 PolarHBondContact N-O 3.38Å; V75-A87 PolarHBondContact O-N 2.86Å; V75-F89 HydrophobicContact CB-CB 4.4Å; V75-F89 HydrophobicContact CG2-CB 3.48Å; V75-F89 VanDerWaalsContact CG2-CB 3.48Å; V75-F89 HydrophobicContact CG2-CG 4.42Å; V75-F124 HydrophobicContact CG1-CB 3.76Å; V75-F124 HydrophobicContact CG1-CD2 3.97Å; V75-F124 HydrophobicContact CG1-CG 4.21Å; V75-T125 WeakPolarHBondContact CA-O 3.17Å; V75-F126 HydrophobicContact CG2-CB 3.95Å
76	R	98.3	Very high	96	Very high	115 Å²	115	73.6 Å²	73.6	43%	0.434	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	118.9	170.9	-69.4	-173.8	-62.7	-92.1	-3.9	109.3	V85 E86 F124 T125	R76-V85 CarbonylContact C-O 3.56Å; R76-V85 WeakPolarHBondContact CA-O 3.12Å; R76-E86 HydrophobicContact CG-CG 4.45Å; R76-F124 CarbonylContact O-C 3.5Å; R76-F124 WeakPolarHBondContact O-CA 3.43Å; R76-T125 PolarHBondContact N-O 3.39Å; R76-T125 PolarHBondContact O-N 3.19Å
77	F	98	Very high	96.2	Very high	0 Å²	0	71.2 Å²	71.2	0%	0	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	130.2	175.1	-59.2	-94.3	0	0	0	109.6	V75 M79 N84 V85 A87 F99 V101 I116 V121 F124	V75-F77 HydrophobicContact CB-CD2 4.44Å; V75-F77 HydrophobicContact CB-CE2 3.74Å; V75-F77 HydrophobicContact CB-CZ 3.99Å; V75-F77 HydrophobicContact CG1-CD2 4.17Å; V75-F77 HydrophobicContact CG1-CE1 4.09Å; V75-F77 HydrophobicContact CG1-CE2 3.7Å; V75-F77 HydrophobicContact CG1-CZ 3.65Å; F77-M79 HydrophobicContact CB-CG 4.47Å; F77-N84 WeakPolarHBondContact O-CA 3.2Å; F77-V85 HydrophobicContact CB-CG2 3.77Å; F77-V85 HydrophobicContact CD2-CG2 4.34Å; F77-V85 HydrophobicContact CG-CG2 4.45Å; F77-V85 PolarHBondContact N-O 3.41Å; F77-V85 PolarHBondContact O-N 2.93Å; F77-A87 HydrophobicContact CE2-CB 4.28Å; F77-F99 HydrophobicContact CE1-CB 4.46Å; F77-F99 HydrophobicContact CE1-CD2 4.08Å; F77-F99 HydrophobicContact CE1-CG 4.19Å; F77-V101 HydrophobicContact CE2-CG1 4.05Å; F77-V101 HydrophobicContact CZ-CG1 3.96Å; F77-I116 HydrophobicContact CD1-CD1 4.49Å; F77-I116 HydrophobicContact CD2-CD1 4.03Å; F77-I116 HydrophobicContact CE2-CD1 4.12Å; F77-I116 HydrophobicContact CG-CD1 4.23Å; F77-I116 HydrophobicContact CZ-CD1 4.4Å; F77-V121 HydrophobicContact CD1-CG1 4.04Å; F77-V121 HydrophobicContact CD1-CG2 4.01Å; F77-F124 HydrophobicContact CD1-CB 3.69Å; F77-F124 HydrophobicContact CD1-CG 4.45Å; F77-F124 HydrophobicContact CE1-CB 3.98Å; F77-F124 HydrophobicContact CE1-CG 4.35Å; F77-F124 HydrophobicContact CG-CB 4.3Å
78	H	97.6	Very high	96.4	Very high	65 Å²	65	71.4 Å²	71.4	30%	0.301	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	116.6	170.9	-59.4	82.7	0	0	0	107.5	N84 I122 S123	H78-N84 PolarHBondContact CD2-OD1 2.99Å; H78-I122 WeakPolarHBondContact O-CB 3.41Å; H78-I122 PolarHBondContact O-N 3.08Å; H78-S123 PolarHBondContact N-O 3.32Å; H78-S123 PolarHBondContact ND1-OG 2.82Å; H78-S123 PolarHBondContact O-N 2.7Å
79	M	96.3	Very high	96.6	Very high	38 Å²	38	65 Å²	65	19%	0.187	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	176	-174	-56.5	-175.9	76.6	0	0	110.8	F77 V83 V85 I116 D120 I122	F77-M79 HydrophobicContact CB-CG 4.47Å; M79-V83 HydrophobicContact CB-CB 4.24Å; M79-V83 WeakPolarHBondContact CB-O 3.22Å; M79-V83 PolarHBondContact N-O 3.11Å; M79-V85 HydrophobicContact CG-CG2 4.34Å; M79-V85 HydrophobicContact SD-CG1 4.22Å; M79-V85 HydrophobicContact SD-CG2 3.65Å; M79-I116 HydrophobicContact CE-CG2 4.14Å; M79-D120 VanDerWaalsContact CA-O 3.26Å; M79-D120 WeakPolarHBondContact CA-O 3.48Å; M79-D120 WeakPolarHBondContact CB-O 3.46Å; M79-D120 HydrophobicContact CE-CB 3.51Å; M79-I122 WeakPolarHBondContact O-CD1 3.05Å
80	H	94.8	Very high	96.7	Very high	107 Å²	107	64.6 Å²	64.6	50%	0.495	32%	0.319	S	S	.	.	G	3₁₀ helix	trans	-57.6	161.6	169.7	-71.1	-79.6	0	0	0	112	K82 V83 Q119	H80-K82 PolarHBondContact O-N 3.49Å; H80-V83 PolarHBondContact O-N 2.84Å; H80-Q119 PolarHBondContact NE2-O 2.96Å
81	E	93.4	Very high	96.7	Very high	175 Å²	175	66.8 Å²	66.8	82%	0.818	34%	0.338	S	S	*	.	G	3₁₀ helix	trans	59.1	26.3	-178.3	-54.1	-54.1	140.3	0	0	114.9	V83	E81-V83 HydrophobicContact CB-CG2 4.34Å; E81-V83 PolarHBondContact O-N 3.38Å
82	K	91.2	Very high	96.7	Very high	196 Å²	196	65.3 Å²	65.3	85%	0.852	33%	0.327	S	S	*	.	G	3₁₀ helix	trans	58.4	26.1	-179.1	-54.1	177.1	-178.9	175.8	0	113.3	H80	H80-K82 PolarHBondContact O-N 3.49Å
83	V	94.6	Very high	96.4	Very high	51 Å²	51	61.6 Å²	61.6	31%	0.309	31%	0.307	S	S	.	.			trans	-79.8	124.3	176.1	178.4	0	0	0	0	108.9	M79 H80 E81 V85	M79-V83 HydrophobicContact CB-CB 4.24Å; M79-V83 WeakPolarHBondContact CB-O 3.22Å; M79-V83 PolarHBondContact N-O 3.11Å; H80-V83 PolarHBondContact O-N 2.84Å; E81-V83 HydrophobicContact CB-CG2 4.34Å; E81-V83 PolarHBondContact O-N 3.38Å; V83-V85 HydrophobicContact CG1-CG1 3.88Å
84	N	96.3	Very high	95.6	Very high	103 Å²	103	64.9 Å²	64.9	55%	0.551	33%	0.326	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.4	123.1	174.6	-58.5	-45.1	0	0	0	108.4	F77 H78	F77-N84 WeakPolarHBondContact O-CA 3.2Å; H78-N84 PolarHBondContact CD2-OD1 2.99Å
85	V	97.4	Very high	94.9	Very high	8 Å²	8	64 Å²	64	5%	0.048	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	146.3	178.4	-61.5	0	0	0	0	110.1	R76 F77 M79 V83 L104 H105	R76-V85 CarbonylContact C-O 3.56Å; R76-V85 WeakPolarHBondContact CA-O 3.12Å; F77-V85 HydrophobicContact CB-CG2 3.77Å; F77-V85 HydrophobicContact CD2-CG2 4.34Å; F77-V85 HydrophobicContact CG-CG2 4.45Å; F77-V85 PolarHBondContact N-O 3.41Å; F77-V85 PolarHBondContact O-N 2.93Å; M79-V85 HydrophobicContact CG-CG2 4.34Å; M79-V85 HydrophobicContact SD-CG1 4.22Å; M79-V85 HydrophobicContact SD-CG2 3.65Å; V83-V85 HydrophobicContact CG1-CG1 3.88Å; V85-L104 HydrophobicContact CB-CD1 3.68Å; V85-L104 HydrophobicContact CG1-CD1 4.4Å; V85-L104 HydrophobicContact CG2-CD1 3.65Å; V85-H105 WeakPolarHBondContact CB-O 3.4Å
86	E	98.3	Very high	94.5	Very high	58 Å²	58	65.1 Å²	65.1	27%	0.271	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	136.2	173.6	-175.8	176.4	112.9	0	0	108.8	K74 V75 R76 H105	K74-E86 WeakPolarHBondContact CD-OE1 3.48Å; K74-E86 WeakPolarHBondContact CE-OE1 3.46Å; K74-E86 IonicContact NZ-OE1 3.86Å; K74-E86 PolarHBondContact NZ-OE1 3.26Å; V75-E86 WeakPolarHBondContact O-CA 3.49Å; R76-E86 HydrophobicContact CG-CG 4.45Å; E86-H105 WeakPolarHBondContact O-CB 3.45Å; E86-H105 PolarHBondContact O-N 3.44Å
87	A	98.4	Very high	94.1	Very high	2 Å²	2	64 Å²	64	2%	0.017	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.9	162.4	174.9	0	0	0	0	0	111	K74 V75 F77 V101 L104	K74-A87 WeakPolarHBondContact CA-O 3.48Å; V75-A87 PolarHBondContact N-O 3.38Å; V75-A87 PolarHBondContact O-N 2.86Å; F77-A87 HydrophobicContact CE2-CB 4.28Å; A87-V101 HydrophobicContact CB-CB 3.64Å; A87-V101 HydrophobicContact CB-CG1 4.15Å; A87-V101 HydrophobicContact CB-CG2 3.74Å; A87-L104 HydrophobicContact CB-CB 4.11Å; A87-L104 HydrophobicContact CB-CD1 3.81Å
88	T	98.6	Very high	93.9	Very high	24 Å²	24	66.1 Å²	66.1	15%	0.147	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.5	117.9	167.8	-58.7	0	0	0	0	108.4	K73 G90 V101 S102	K73-T88 WeakPolarHBondContact O-CA 3.33Å; T88-G90 PolarHBondContact O-N 3.46Å; T88-V101 CarbonylContact O-C 3.58Å; T88-V101 VanDerWaalsContact O-CA 3.23Å; T88-V101 WeakPolarHBondContact O-CA 3.28Å; T88-V101 WeakPolarHBondContact O-CB 3.41Å; T88-S102 WeakPolarHBondContact CB-OG 3.19Å; T88-S102 PolarHBondContact N-O 2.91Å; T88-S102 PolarHBondContact O-N 3.46Å
89	F	98.4	Very high	93.9	Very high	4 Å²	4	63.2 Å²	63.2	2%	0.018	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.7	126.8	177.9	175.7	-97.1	0	0	0	110.8	M70 N72 K73 V75 A91 F99	M70-F89 HydrophobicContact CB-CD1 4.02Å; M70-F89 HydrophobicContact CB-CE1 4.34Å; M70-F89 HydrophobicContact CE-CD1 3.77Å; M70-F89 HydrophobicContact CE-CD2 3.59Å; M70-F89 HydrophobicContact CE-CE1 3.68Å; M70-F89 HydrophobicContact CE-CE2 3.52Å; M70-F89 HydrophobicContact CE-CG 3.72Å; M70-F89 HydrophobicContact CE-CZ 3.54Å; M70-F89 HydrophobicContact CG-CB 4.02Å; M70-F89 HydrophobicContact CG-CD1 3.78Å; M70-F89 HydrophobicContact CG-CE1 4.43Å; M70-F89 HydrophobicContact CG-CG 3.88Å; M70-F89 WeakPolarHBondContact O-CD1 3.4Å; M70-F89 HydrophobicContact SD-CD1 4.49Å; M70-F89 HydrophobicContact SD-CD2 4.45Å; M70-F89 HydrophobicContact SD-CG 4.25Å; N72-F89 WeakPolarHBondContact CA-O 3.31Å; N72-F89 PolarHBondContact N-O 2.97Å; K73-F89 PolarHBondContact O-N 3.37Å; V75-F89 HydrophobicContact CB-CB 4.4Å; V75-F89 HydrophobicContact CG2-CB 3.48Å; V75-F89 VanDerWaalsContact CG2-CB 3.48Å; V75-F89 HydrophobicContact CG2-CG 4.42Å; F89-A91 VanDerWaalsContact CE2-O 3.32Å; F89-A91 WeakPolarHBondContact CE2-O 3.4Å; F89-F99 HydrophobicContact CE2-CB 4.33Å; F89-F99 AromaticContact CE2-CD1 3.84Å; F89-F99 HydrophobicContact CE2-CD1 3.84Å
90	G	97.4	Very high	94	Very high	29 Å²	29	64.5 Å²	64.5	30%	0.299	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	-61.8	174.2	0	0	0	0	0	111.9	T88 Q100	T88-G90 PolarHBondContact O-N 3.46Å; G90-Q100 VanDerWaalsContact CA-OE1 3.26Å; G90-Q100 PolarHBondContact N-O 3.43Å
91	A	96.3	Very high	94.2	Very high	47 Å²	47	59.4 Å²	59.4	39%	0.388	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.6	163.6	-176.1	0	0	0	0	0	113.5	F89 F99 Q100	F89-A91 VanDerWaalsContact CE2-O 3.32Å; F89-A91 WeakPolarHBondContact CE2-O 3.4Å; A91-F99 CarbonylContact O-C 3.59Å; A91-F99 WeakPolarHBondContact O-CA 3.31Å; A91-Q100 PolarHBondContact N-O 2.9Å; A91-Q100 PolarHBondContact O-N 2.93Å
92	S	95.3	Very high	94.4	Very high	32 Å²	32	52.2 Å²	52.2	22%	0.224	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	151.4	167.8	178.7	0	0	0	0	108.8	V96 N98	S92-V96 WeakPolarHBondContact OG-CA 3.29Å; S92-N98 WeakPolarHBondContact CA-O 3.39Å; S92-N98 PolarHBondContact OG-O 3.45Å
93	D	89.6	Confident	94.8	Very high	54 Å²	54	46.4 Å²	46.4	29%	0.289	26%	0.264	S	S	.	.			trans	-66.4	164.8	161.4	58.9	2.4	0	0	0	111.1	D95 V96 L97 N98	D93-D95 PolarHBondContact O-N 3.4Å; D93-V96 PolarHBondContact O-N 2.87Å; D93-V96 WeakPolarHBondContact OD1-CA 3.28Å; D93-V96 PolarHBondContact OD1-N 3.31Å; D93-L97 PolarHBondContact OD1-N 3.27Å; D93-L97 WeakPolarHBondContact OD2-CB 3.49Å; D93-N98 PolarHBondContact N-O 3.13Å; D93-N98 PolarHBondContact OD1-N 3.32Å; D93-N98 VanDerWaalsContact OD1-N 3.1Å; D93-N98 PolarHBondContact OD2-N 3.41Å; D93-N98 PolarHBondContact OD2-ND2 3Å
94	I	81.4	Confident	94.9	Very high	123 Å²	123	44.9 Å²	44.9	63%	0.631	25%	0.254	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.5	-35.2	-176.3	-167.7	168.5	0	0	0	111.5	R60 V96	R60-I94 PolarHBondContact NH2-O 3.39Å; I94-V96 VanDerWaalsContact C-N 3.31Å
95	D	83.7	Confident	95	Very high	114 Å²	114	44 Å²	44	61%	0.61	25%	0.246	S	C	*	.	T	Hydrogen-bonded Turn	trans	-87.4	-3.5	-177.4	-59.8	-40.7	0	0	0	112.9	D93 L97	D93-D95 PolarHBondContact O-N 3.4Å; D95-L97 VanDerWaalsContact C-N 3.27Å; D95-L97 HydrophobicContact CB-CD1 4.2Å; D95-L97 HydrophobicContact CB-CG 3.96Å; D95-L97 PolarHBondContact O-N 3.06Å
96	V	88.8	Confident	94.9	Very high	23 Å²	23	46.3 Å²	46.3	14%	0.139	26%	0.26	C	S	.	.	S	Bend	trans	55.6	45.5	-179.2	-162.8	0	0	0	0	111.5	F63 L67 S92 D93 I94 F99 S118	F63-V96 HydrophobicContact CE1-CG2 3.53Å; F63-V96 HydrophobicContact CZ-CB 4.32Å; F63-V96 HydrophobicContact CZ-CG1 4.28Å; F63-V96 HydrophobicContact CZ-CG2 3.63Å; L67-V96 HydrophobicContact CD1-CG2 4Å; S92-V96 WeakPolarHBondContact OG-CA 3.29Å; D93-V96 PolarHBondContact O-N 2.87Å; D93-V96 WeakPolarHBondContact OD1-CA 3.28Å; D93-V96 PolarHBondContact OD1-N 3.31Å; I94-V96 VanDerWaalsContact C-N 3.31Å; V96-F99 HydrophobicContact CG1-CD1 4.48Å; V96-F99 HydrophobicContact CG1-CE1 3.46Å; V96-F99 VanDerWaalsContact CG1-CE1 3.46Å; V96-F99 HydrophobicContact CG1-CZ 3.6Å; V96-S118 VanDerWaalsContact O-CB 3.22Å; V96-S118 WeakPolarHBondContact O-CB 3.39Å; V96-S118 PolarHBondContact O-OG 3.47Å
97	L	90.2	Very high	94.5	Very high	92 Å²	92	49.2 Å²	49.2	48%	0.482	28%	0.284	S	S	.	.	S	Bend	trans	-89.8	-21.8	170.3	-55.2	177.9	0	0	0	110.9	D93 D95 R117 S118	D93-L97 PolarHBondContact OD1-N 3.27Å; D93-L97 WeakPolarHBondContact OD2-CB 3.49Å; D95-L97 VanDerWaalsContact C-N 3.27Å; D95-L97 HydrophobicContact CB-CD1 4.2Å; D95-L97 HydrophobicContact CB-CG 3.96Å; D95-L97 PolarHBondContact O-N 3.06Å; L97-R117 CarbonylContact O-C 3.59Å; L97-R117 WeakPolarHBondContact O-CA 3.44Å; L97-S118 WeakPolarHBondContact CA-OG 3.43Å; L97-S118 PolarHBondContact O-N 3.39Å; L97-S118 PolarHBondContact O-OG 2.89Å
98	N	94	Very high	94.2	Very high	43 Å²	43	57.3 Å²	57.3	23%	0.23	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.7	142.1	-175.9	-52.9	-81.6	0	0	0	112.4	S92 D93 L115 I116	S92-N98 WeakPolarHBondContact CA-O 3.39Å; S92-N98 PolarHBondContact OG-O 3.45Å; D93-N98 PolarHBondContact N-O 3.13Å; D93-N98 PolarHBondContact OD1-N 3.32Å; D93-N98 VanDerWaalsContact OD1-N 3.1Å; D93-N98 PolarHBondContact OD2-N 3.41Å; D93-N98 PolarHBondContact OD2-ND2 3Å; N98-L115 HydrophobicContact CB-CD1 3.77Å; N98-L115 HydrophobicContact CB-CD2 4.23Å; N98-L115 HydrophobicContact CB-CG 4Å; N98-I116 CarbonylContact C-O 3.58Å; N98-I116 WeakPolarHBondContact CA-O 3.48Å
99	F	97.8	Very high	94.1	Very high	5 Å²	5	57.8 Å²	57.8	2%	0.022	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	116.5	173.3	-52.1	-73	0	0	0	109.4	F77 F89 A91 V96 V101 L115 I116 V121 F124	F77-F99 HydrophobicContact CE1-CB 4.46Å; F77-F99 HydrophobicContact CE1-CD2 4.08Å; F77-F99 HydrophobicContact CE1-CG 4.19Å; F89-F99 HydrophobicContact CE2-CB 4.33Å; F89-F99 AromaticContact CE2-CD1 3.84Å; F89-F99 HydrophobicContact CE2-CD1 3.84Å; A91-F99 CarbonylContact O-C 3.59Å; A91-F99 WeakPolarHBondContact O-CA 3.31Å; V96-F99 HydrophobicContact CG1-CD1 4.48Å; V96-F99 HydrophobicContact CG1-CE1 3.46Å; V96-F99 VanDerWaalsContact CG1-CE1 3.46Å; V96-F99 HydrophobicContact CG1-CZ 3.6Å; F99-V101 HydrophobicContact CB-CG1 4.32Å; F99-L115 WeakPolarHBondContact O-CA 3.28Å; F99-I116 HydrophobicContact CB-CB 4.41Å; F99-I116 PolarHBondContact N-O 3.29Å; F99-I116 PolarHBondContact O-N 2.91Å; F99-V121 HydrophobicContact CD2-CG2 4.43Å; F99-V121 HydrophobicContact CE2-CG2 4.32Å; F99-F124 HydrophobicContact CE1-CE1 4.29Å; F99-F124 HydrophobicContact CZ-CD1 4.3Å; F99-F124 AromaticContact CZ-CE1 3.98Å; F99-F124 HydrophobicContact CZ-CE1 3.98Å
100	Q	98.2	Very high	94.1	Very high	65 Å²	65	61.4 Å²	61.4	30%	0.304	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	129.1	165.9	-178.8	-85.1	-25.6	0	0	108.6	G90 A91 E113 L115	G90-Q100 VanDerWaalsContact CA-OE1 3.26Å; G90-Q100 PolarHBondContact N-O 3.43Å; A91-Q100 PolarHBondContact N-O 2.9Å; A91-Q100 PolarHBondContact O-N 2.93Å; Q100-E113 PolarHBondContact NE2-OE2 3.04Å; Q100-L115 HydrophobicContact CB-CD1 4.22Å
101	V	98.5	Very high	94.1	Very high	0 Å²	0	65.4 Å²	65.4	0%	0	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.4	150.6	-178.4	-56.4	0	0	0	0	110.2	F77 A87 T88 F99 L104 A114 I116	F77-V101 HydrophobicContact CE2-CG1 4.05Å; F77-V101 HydrophobicContact CZ-CG1 3.96Å; A87-V101 HydrophobicContact CB-CB 3.64Å; A87-V101 HydrophobicContact CB-CG1 4.15Å; A87-V101 HydrophobicContact CB-CG2 3.74Å; T88-V101 CarbonylContact O-C 3.58Å; T88-V101 VanDerWaalsContact O-CA 3.23Å; T88-V101 WeakPolarHBondContact O-CA 3.28Å; T88-V101 WeakPolarHBondContact O-CB 3.41Å; F99-V101 HydrophobicContact CB-CG1 4.32Å; V101-L104 HydrophobicContact CG2-CB 4.13Å; V101-A114 HydrophobicContact CG2-CB 3.95Å; V101-A114 PolarHBondContact N-O 3.43Å; V101-A114 PolarHBondContact O-N 3.02Å; V101-I116 HydrophobicContact CG1-CD1 4.2Å; V101-I116 HydrophobicContact CG2-CD1 3.89Å; V101-I116 HydrophobicContact CG2-CG1 4.1Å
102	S	98.6	Very high	94.1	Very high	23 Å²	23	71.1 Å²	71.1	16%	0.161	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	160	168.5	74.6	0	0	0	0	110.7	T88 L104 K112	T88-S102 WeakPolarHBondContact CB-OG 3.19Å; T88-S102 PolarHBondContact N-O 2.91Å; T88-S102 PolarHBondContact O-N 3.46Å; S102-L104 VanDerWaalsContact C-N 3.31Å; S102-L104 PolarHBondContact O-N 3Å; S102-K112 CarbonylContact C-O 3.52Å; S102-K112 WeakPolarHBondContact CA-O 3.03Å; S102-K112 WeakPolarHBondContact CB-O 3.21Å
103	D	98.3	Very high	94.3	Very high	75 Å²	75	75 Å²	75	40%	0.401	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	51.3	48.6	177.6	-53.4	-61.2	0	0	0	112.6	H105 V110 Q111 K112	D103-H105 PolarHBondContact O-CE1 3.2Å; D103-H105 PolarHBondContact O-N 3.34Å; D103-H105 PolarHBondContact O-ND1 3.02Å; D103-V110 HydrophobicContact CB-CG1 4.42Å; D103-Q111 CarbonylContact C-O 3.55Å; D103-K112 PolarHBondContact N-O 3.05Å
104	L	98.4	Very high	94.7	Very high	18 Å²	18	73.4 Å²	73.4	9%	0.094	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.8	110.1	178.5	174.1	64.6	0	0	0	110.1	V85 A87 V101 S102 T106 V110 Q111 A114 I116	V85-L104 HydrophobicContact CB-CD1 3.68Å; V85-L104 HydrophobicContact CG1-CD1 4.4Å; V85-L104 HydrophobicContact CG2-CD1 3.65Å; A87-L104 HydrophobicContact CB-CB 4.11Å; A87-L104 HydrophobicContact CB-CD1 3.81Å; V101-L104 HydrophobicContact CG2-CB 4.13Å; S102-L104 VanDerWaalsContact C-N 3.31Å; S102-L104 PolarHBondContact O-N 3Å; L104-T106 HydrophobicContact CD2-CG2 4.24Å; L104-T106 HydrophobicContact CG-CG2 4.01Å; L104-T106 PolarHBondContact O-N 3.14Å; L104-V110 WeakPolarHBondContact O-CA 3.26Å; L104-Q111 HydrophobicContact CB-CB 4.26Å; L104-Q111 PolarHBondContact N-O 2.77Å; L104-Q111 PolarHBondContact O-N 3.18Å; L104-A114 HydrophobicContact CB-CB 4.18Å; L104-A114 HydrophobicContact CD2-CB 3.57Å; L104-I116 HydrophobicContact CD1-CD1 4.04Å; L104-I116 HydrophobicContact CD2-CD1 4.43Å; L104-I116 HydrophobicContact CD2-CG1 4.42Å
105	H	97.9	Very high	95.4	Very high	86 Å²	86	73 Å²	73	40%	0.398	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	107.8	177.5	-68	64.7	0	0	0	109.5	V85 E86 D103	V85-H105 WeakPolarHBondContact CB-O 3.4Å; E86-H105 WeakPolarHBondContact O-CB 3.45Å; E86-H105 PolarHBondContact O-N 3.44Å; D103-H105 PolarHBondContact O-CE1 3.2Å; D103-H105 PolarHBondContact O-N 3.34Å; D103-H105 PolarHBondContact O-ND1 3.02Å
106	T	94.5	Very high	96.1	Very high	55 Å²	55	68 Å²	68	34%	0.337	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	163	172.1	73.7	0	0	0	0	109.9	L104 I108 G109	L104-T106 HydrophobicContact CD2-CG2 4.24Å; L104-T106 HydrophobicContact CG-CG2 4.01Å; L104-T106 PolarHBondContact O-N 3.14Å; T106-I108 PolarHBondContact O-N 2.85Å; T106-I108 PolarHBondContact OG1-N 3.34Å; T106-G109 WeakPolarHBondContact CA-O 3.4Å; T106-G109 PolarHBondContact N-O 3.11Å; T106-G109 PolarHBondContact O-N 2.62Å; T106-G109 VanDerWaalsContact O-N 3.13Å; T106-G109 VanDerWaalsContact O-O 3.13Å; T106-G109 PolarHBondContact OG1-N 3.21Å; T106-G109 PolarHBondContact OG1-O 3.4Å
107	P	89.8	Confident	96.5	Very high	120 Å²	120	72.8 Å²	72.8	78%	0.779	38%	0.38	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.4	-22.7	176	-27.2	36.1	0	0	0	114.8
108	I	93.3	Very high	96.7	Very high	172 Å²	172	70 Å²	70	88%	0.882	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.9	-19.6	-176.1	-51.8	175.1	0	0	0	111	T106	T106-I108 PolarHBondContact O-N 2.85Å; T106-I108 PolarHBondContact OG1-N 3.34Å
109	G	95.1	Very high	96.8	Very high	33 Å²	33	74.9 Å²	74.9	34%	0.34	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	157.9	-172	-179.6	0	0	0	0	0	113.5	T106	T106-G109 WeakPolarHBondContact CA-O 3.4Å; T106-G109 PolarHBondContact N-O 3.11Å; T106-G109 PolarHBondContact O-N 2.62Å; T106-G109 VanDerWaalsContact O-N 3.13Å; T106-G109 VanDerWaalsContact O-O 3.13Å; T106-G109 PolarHBondContact OG1-N 3.21Å; T106-G109 PolarHBondContact OG1-O 3.4Å
110	V	98	Very high	96.8	Very high	81 Å²	81	76.9 Å²	76.9	49%	0.491	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	121.6	-178.9	-175.6	0	0	0	0	110	D103 L104	D103-V110 HydrophobicContact CB-CG1 4.42Å; L104-V110 WeakPolarHBondContact O-CA 3.26Å
111	Q	97.8	Very high	96.7	Very high	113 Å²	113	74.7 Å²	74.7	53%	0.528	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	118.2	172.2	-177.4	71.7	-4.9	0	0	108.9	D103 L104 E113 A114	D103-Q111 CarbonylContact C-O 3.55Å; L104-Q111 HydrophobicContact CB-CB 4.26Å; L104-Q111 PolarHBondContact N-O 2.77Å; L104-Q111 PolarHBondContact O-N 3.18Å; Q111-E113 VanDerWaalsContact C-N 3.34Å; Q111-E113 WeakPolarHBondContact CG-O 3.22Å; Q111-E113 PolarHBondContact O-N 3.11Å; Q111-A114 HydrophobicContact CG-CB 4.16Å
112	K	97.8	Very high	96.6	Very high	167 Å²	167	80.1 Å²	80.1	73%	0.726	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.5	-43.8	-174.5	-72.2	-172.4	175.9	-176.4	0	113.2	S102 D103	S102-K112 CarbonylContact C-O 3.52Å; S102-K112 WeakPolarHBondContact CA-O 3.03Å; S102-K112 WeakPolarHBondContact CB-O 3.21Å; D103-K112 PolarHBondContact N-O 3.05Å
113	E	98.1	Very high	96.6	Very high	112 Å²	112	81.6 Å²	81.6	52%	0.523	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.4	134.4	180	-66.4	-62.8	153.8	0	0	109	Q100 Q111	Q100-E113 PolarHBondContact NE2-OE2 3.04Å; Q111-E113 VanDerWaalsContact C-N 3.34Å; Q111-E113 WeakPolarHBondContact CG-O 3.22Å; Q111-E113 PolarHBondContact O-N 3.11Å
114	A	97.9	Very high	96.5	Very high	22 Å²	22	81 Å²	81	18%	0.182	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.7	155.2	179.6	0	0	0	0	0	112	V101 L104 Q111	V101-A114 HydrophobicContact CG2-CB 3.95Å; V101-A114 PolarHBondContact N-O 3.43Å; V101-A114 PolarHBondContact O-N 3.02Å; L104-A114 HydrophobicContact CB-CB 4.18Å; L104-A114 HydrophobicContact CD2-CB 3.57Å; Q111-A114 HydrophobicContact CG-CB 4.16Å
115	L	97.9	Very high	96.4	Very high	114 Å²	114	82.9 Å²	82.9	60%	0.597	44%	0.436	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.2	112.1	169	-169.5	73.2	0	0	0	108	N98 F99 Q100	N98-L115 HydrophobicContact CB-CD1 3.77Å; N98-L115 HydrophobicContact CB-CD2 4.23Å; N98-L115 HydrophobicContact CB-CG 4Å; F99-L115 WeakPolarHBondContact O-CA 3.28Å; Q100-L115 HydrophobicContact CB-CD1 4.22Å
116	I	97.7	Very high	96.4	Very high	8 Å²	8	80.4 Å²	80.4	4%	0.041	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	124.7	176.7	-56.1	174.9	0	0	0	108.1	F77 M79 N98 F99 V101 L104 V121	F77-I116 HydrophobicContact CD1-CD1 4.49Å; F77-I116 HydrophobicContact CD2-CD1 4.03Å; F77-I116 HydrophobicContact CE2-CD1 4.12Å; F77-I116 HydrophobicContact CG-CD1 4.23Å; F77-I116 HydrophobicContact CZ-CD1 4.4Å; M79-I116 HydrophobicContact CE-CG2 4.14Å; N98-I116 CarbonylContact C-O 3.58Å; N98-I116 WeakPolarHBondContact CA-O 3.48Å; F99-I116 HydrophobicContact CB-CB 4.41Å; F99-I116 PolarHBondContact N-O 3.29Å; F99-I116 PolarHBondContact O-N 2.91Å; V101-I116 HydrophobicContact CG1-CD1 4.2Å; V101-I116 HydrophobicContact CG2-CD1 3.89Å; V101-I116 HydrophobicContact CG2-CG1 4.1Å; L104-I116 HydrophobicContact CD1-CD1 4.04Å; L104-I116 HydrophobicContact CD2-CD1 4.43Å; L104-I116 HydrophobicContact CD2-CG1 4.42Å; I116-V121 HydrophobicContact CG2-CG2 3.38Å
117	R	97.3	Very high	96.5	Very high	125 Å²	125	83.7 Å²	83.7	47%	0.472	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78	142.6	174.4	-56.1	173.8	-63.2	170.2	5.7	109.3	L97 Q119 D120	L97-R117 CarbonylContact O-C 3.59Å; L97-R117 WeakPolarHBondContact O-CA 3.44Å; R117-Q119 PolarHBondContact O-N 3.26Å; R117-D120 WeakPolarHBondContact CB-OD2 3.38Å; R117-D120 IonicContact CZ-OD1 3.69Å; R117-D120 IonicContact CZ-OD2 3.36Å; R117-D120 IonicContact NE-OD1 2.84Å; R117-D120 IonicContact NE-OD2 2.93Å; R117-D120 PolarHBondContact NE-OD2 3Å; R117-D120 VanDerWaalsContact NH2-CG 3.34Å; R117-D120 IonicContact NH2-OD1 2.82Å; R117-D120 PolarHBondContact NH2-OD1 3.03Å; R117-D120 IonicContact NH2-OD2 3.02Å; R117-D120 PolarHBondContact NH2-OD2 3.46Å; R117-D120 WeakPolarHBondContact O-CB 3.46Å; R117-D120 PolarHBondContact O-N 2.95Å
118	S	94.8	Very high	96.2	Very high	34 Å²	34	85.9 Å²	85.9	24%	0.238	45%	0.451	C	S	.	.	G	3₁₀ helix	trans	-62	-28.6	178.4	65.4	0	0	0	0	112.6	V96 L97 D120 V121	V96-S118 VanDerWaalsContact O-CB 3.22Å; V96-S118 WeakPolarHBondContact O-CB 3.39Å; V96-S118 PolarHBondContact O-OG 3.47Å; L97-S118 WeakPolarHBondContact CA-OG 3.43Å; L97-S118 PolarHBondContact O-N 3.39Å; L97-S118 PolarHBondContact O-OG 2.89Å; S118-D120 PolarHBondContact O-N 3.26Å; S118-V121 PolarHBondContact O-N 2.95Å
119	Q	96.3	Very high	96.4	Very high	145 Å²	145	81.6 Å²	81.6	68%	0.678	43%	0.429	S	S	*	.	G	3₁₀ helix	trans	-62.5	-24.1	173.8	-65.4	177.9	-1.6	0	0	113.5	H80 R117 V121	H80-Q119 PolarHBondContact NE2-O 2.96Å; R117-Q119 PolarHBondContact O-N 3.26Å; Q119-V121 VanDerWaalsContact C-N 3.33Å
120	D	96.2	Very high	96.5	Very high	46 Å²	46	84.1 Å²	84.1	25%	0.246	43%	0.434	C	S	.	.	G	3₁₀ helix	trans	-87.5	-8.5	178.1	-56.8	-44	0	0	0	111.6	M79 R117 S118	M79-D120 VanDerWaalsContact CA-O 3.26Å; M79-D120 WeakPolarHBondContact CA-O 3.48Å; M79-D120 WeakPolarHBondContact CB-O 3.46Å; M79-D120 HydrophobicContact CE-CB 3.51Å; R117-D120 WeakPolarHBondContact CB-OD2 3.38Å; R117-D120 IonicContact CZ-OD1 3.69Å; R117-D120 IonicContact CZ-OD2 3.36Å; R117-D120 IonicContact NE-OD1 2.84Å; R117-D120 IonicContact NE-OD2 2.93Å; R117-D120 PolarHBondContact NE-OD2 3Å; R117-D120 VanDerWaalsContact NH2-CG 3.34Å; R117-D120 IonicContact NH2-OD1 2.82Å; R117-D120 PolarHBondContact NH2-OD1 3.03Å; R117-D120 IonicContact NH2-OD2 3.02Å; R117-D120 PolarHBondContact NH2-OD2 3.46Å; R117-D120 WeakPolarHBondContact O-CB 3.46Å; R117-D120 PolarHBondContact O-N 2.95Å; S118-D120 PolarHBondContact O-N 3.26Å
121	V	96.9	Very high	96.4	Very high	20 Å²	20	84.3 Å²	84.3	12%	0.121	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	125.3	-173.2	179.2	0	0	0	0	110.6	F77 F99 I116 S118 Q119 S123	F77-V121 HydrophobicContact CD1-CG1 4.04Å; F77-V121 HydrophobicContact CD1-CG2 4.01Å; F99-V121 HydrophobicContact CD2-CG2 4.43Å; F99-V121 HydrophobicContact CE2-CG2 4.32Å; I116-V121 HydrophobicContact CG2-CG2 3.38Å; S118-V121 PolarHBondContact O-N 2.95Å; Q119-V121 VanDerWaalsContact C-N 3.33Å; V121-S123 WeakPolarHBondContact CG1-O 3.47Å
122	I	97.1	Very high	96.3	Very high	113 Å²	113	82.6 Å²	82.6	58%	0.579	43%	0.425	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.1	-44.7	172.7	-59.1	173.1	0	0	0	109.9	H78 M79	H78-I122 WeakPolarHBondContact O-CB 3.41Å; H78-I122 PolarHBondContact O-N 3.08Å; M79-I122 WeakPolarHBondContact O-CD1 3.05Å
123	S	96.8	Very high	96.2	Very high	54 Å²	54	77.3 Å²	77.3	38%	0.378	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.3	164.1	178.5	68.1	0	0	0	0	111.1	H78 V121	H78-S123 PolarHBondContact N-O 3.32Å; H78-S123 PolarHBondContact ND1-OG 2.82Å; H78-S123 PolarHBondContact O-N 2.7Å; V121-S123 WeakPolarHBondContact CG1-O 3.47Å
124	F	96.7	Very high	96.1	Very high	62 Å²	62	75 Å²	75	27%	0.272	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	155.6	170.7	63	-94	0	0	0	111.3	M70 V75 R76 F77 F99 F126	M70-F124 HydrophobicContact CE-CE2 3.93Å; M70-F124 HydrophobicContact CE-CZ 4.28Å; M70-F124 HydrophobicContact SD-CD2 3.65Å; M70-F124 HydrophobicContact SD-CE2 3.4Å; M70-F124 WeakPolarHBondContact SD-CE2 3.35Å; M70-F124 HydrophobicContact SD-CZ 4.31Å; V75-F124 HydrophobicContact CG1-CB 3.76Å; V75-F124 HydrophobicContact CG1-CD2 3.97Å; V75-F124 HydrophobicContact CG1-CG 4.21Å; R76-F124 CarbonylContact O-C 3.5Å; R76-F124 WeakPolarHBondContact O-CA 3.43Å; F77-F124 HydrophobicContact CD1-CB 3.69Å; F77-F124 HydrophobicContact CD1-CG 4.45Å; F77-F124 HydrophobicContact CE1-CB 3.98Å; F77-F124 HydrophobicContact CE1-CG 4.35Å; F77-F124 HydrophobicContact CG-CB 4.3Å; F99-F124 HydrophobicContact CE1-CE1 4.29Å; F99-F124 HydrophobicContact CZ-CD1 4.3Å; F99-F124 AromaticContact CZ-CE1 3.98Å; F99-F124 HydrophobicContact CZ-CE1 3.98Å; F124-F126 HydrophobicContact CE2-CD1 4.46Å
125	T	97.6	Very high	95.9	Very high	58 Å²	58	78.8 Å²	78.8	36%	0.356	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	141.9	-179	48.8	0	0	0	0	110.6	V75 R76	V75-T125 WeakPolarHBondContact CA-O 3.17Å; R76-T125 PolarHBondContact N-O 3.39Å; R76-T125 PolarHBondContact O-N 3.19Å
126	F	97.4	Very high	95.8	Very high	35 Å²	35	76.1 Å²	76.1	15%	0.154	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.5	156.2	178.6	74.1	-81.3	0	0	0	110	M70 K73 V75 F124 V128	M70-F126 HydrophobicContact CB-CD1 4.35Å; M70-F126 HydrophobicContact CB-CD2 4.23Å; M70-F126 HydrophobicContact CB-CE1 4.18Å; M70-F126 HydrophobicContact CB-CE2 4.04Å; M70-F126 HydrophobicContact CB-CG 4.37Å; M70-F126 HydrophobicContact CB-CZ 4.02Å; M70-F126 HydrophobicContact CG-CB 4.38Å; M70-F126 HydrophobicContact CG-CD1 3.97Å; M70-F126 HydrophobicContact CG-CD2 4.2Å; M70-F126 HydrophobicContact CG-CE1 4.27Å; M70-F126 HydrophobicContact CG-CE2 4.48Å; M70-F126 HydrophobicContact CG-CG 3.93Å; M70-F126 HydrophobicContact SD-CD1 3.84Å; M70-F126 HydrophobicContact SD-CE1 4.17Å; M70-F126 HydrophobicContact SD-CG 4.34Å; K73-F126 HydrophobicContact CD-CD2 3.9Å; K73-F126 HydrophobicContact CD-CE2 4.39Å; V75-F126 HydrophobicContact CG2-CB 3.95Å; F124-F126 HydrophobicContact CE2-CD1 4.46Å; F126-V128 HydrophobicContact CE2-CG2 3.87Å; F126-V128 HydrophobicContact CZ-CG2 4.16Å
127	D	95.4	Very high	95.6	Very high	123 Å²	123	81.8 Å²	81.8	66%	0.658	43%	0.43	S	S	*	.			trans	-87.4	129.7	177.6	-60	-40.2	0	0	0	110	K73	K73-D127 VanDerWaalsContact CD-O 3.28Å; K73-D127 WeakPolarHBondContact CD-O 3.35Å; K73-D127 PolarHBondContact NZ-O 3.35Å
128	V	85.2	Confident	95.5	Very high	166 Å²	166	77.8 Å²	77.8	100%	1.006	43%	0.426	S	S	*	.			trans	-81.9	0	-177.6	-178.4	0	0	0	0	111.3	K73 F126	K73-V128 VanDerWaalsContact NZ-C 3.32Å; K73-V128 PolarHBondContact NZ-OXT 3.09Å; F126-V128 HydrophobicContact CE2-CG2 3.87Å; F126-V128 HydrophobicContact CZ-CG2 4.16Å

Retrieved 128 of 128 residues in 22.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).