A0A087XU22_POEFO Loading...

Large ribosomal subunit protein mL52

AlphaFold DB , UniProt , Accession A0A087XU22, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 128 aa.

						>A0A087XU22_POEFO|A0A087XU22
MAAPIRTLCCSALRLSGRHFSSTCGVQAGQKWRLEHGLARSGSEYGPMTDLPDWSFEDGRPAPPLKGQIRRRQEKETLARRIVMLNSEVDHGVEAWNKKQEEARRAEEHRKSLLLKPKGKLLTKKSKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41	Very low	49.6	Very low	248 Å²	248	148 Å²	148	100%	1.222	87%	0.872	S	S	*	*				0	91.2	0	-67.3	-65.5	179.2	0	0	107.7
2	A	42.7	Very low	50.2	Low	105 Å²	105	143.8 Å²	143.8	87%	0.868	87%	0.866	S	S	*	*	P	Polyproline II helix	trans	-87.8	126.8	-176.7	0	0	0	0	0	109.8
3	A	50.2	Low	50.7	Low	91 Å²	91	145.8 Å²	145.8	75%	0.752	87%	0.868	S	S	*	*	P	Polyproline II helix	trans	-76.1	142.5	179	0	0	0	0	0	111.2	I5	A3-I5 PolarHBondContact O-N 3.31Å
4	P	52.1	Low	51.1	Low	122 Å²	122	152.6 Å²	152.6	79%	0.792	87%	0.871	S	S	*	*	P	Polyproline II helix	trans	-80.3	119.7	176.4	30.6	-30.2	0	0	0	110.4	R6	P4-R6 PolarHBondContact O-N 2.98Å
5	I	53	Low	51.6	Low	159 Å²	159	154.1 Å²	154.1	82%	0.815	87%	0.874	S	S	*	*			trans	-66.9	111.1	169.3	-63.2	168	0	0	0	107.2	A3 T7	A3-I5 PolarHBondContact O-N 3.31Å; I5-T7 PolarHBondContact O-N 2.97Å
6	R	49.3	Very low	52.2	Low	223 Å²	223	151.7 Å²	151.7	84%	0.842	87%	0.87	S	S	*	*			trans	-67.4	109.2	172.1	-80.4	178.9	163.4	172.3	-4.8	109.2	P4 L8	P4-R6 PolarHBondContact O-N 2.98Å; R6-L8 VanDerWaalsContact C-N 3.35Å; R6-L8 PolarHBondContact O-N 3.13Å
7	T	50.1	Low	52.8	Low	145 Å²	145	145.7 Å²	145.7	89%	0.89	85%	0.849	S	S	*	*			trans	-67.6	89.4	168.9	3.7	0	0	0	0	109.8	I5	I5-T7 PolarHBondContact O-N 2.97Å
8	L	54.6	Low	53.4	Low	156 Å²	156	149.7 Å²	149.7	82%	0.817	85%	0.847	S	S	*	*			trans	-95.4	88.3	166.6	-103	151.7	0	0	0	108.2	R6	R6-L8 VanDerWaalsContact C-N 3.35Å; R6-L8 PolarHBondContact O-N 3.13Å
9	C	48.1	Very low	54.2	Low	120 Å²	120	151.5 Å²	151.5	81%	0.811	85%	0.847	S	S	*	*			trans	177.2	92.5	153.1	-104.2	0	0	0	0	110.3
10	C	48.6	Very low	55	Low	136 Å²	136	153.6 Å²	153.6	92%	0.919	85%	0.847	S	S	*	*			trans	-154.1	57.5	160.3	-92.1	0	0	0	0	109.3
11	S	55.8	Low	55.6	Low	123 Å²	123	150.7 Å²	150.7	86%	0.86	84%	0.838	S	S	*	*			trans	-142.6	40.4	175.1	55.1	0	0	0	0	113.2
12	A	56.5	Low	57.1	Low	97 Å²	97	144.8 Å²	144.8	80%	0.802	82%	0.821	S	S	*	*			trans	-137.6	23.5	173.7	0	0	0	0	0	114.4
13	L	57.5	Low	58.5	Low	171 Å²	171	144.9 Å²	144.9	90%	0.895	81%	0.811	S	S	*	*			trans	-105.2	57.6	170.8	-76.5	161.9	0	0	0	110.5
14	R	56.3	Low	59.4	Low	240 Å²	240	146 Å²	146	91%	0.906	81%	0.813	S	S	*	*	S	Bend	trans	-141.5	27.3	174.8	-72.7	-160.3	-170	-170.4	5.9	115.4
15	L	58	Low	60.2	Low	176 Å²	176	143.4 Å²	143.4	92%	0.921	81%	0.808	S	S	*	*			trans	-139.7	28.4	175.4	-68.5	174.1	0	0	0	114.7
16	S	61.8	Low	60.8	Low	115 Å²	115	142 Å²	142	80%	0.804	81%	0.806	S	S	*	*			trans	-102.4	57.5	165.9	-178.5	0	0	0	0	110.7	R18	S16-R18 PolarHBondContact O-N 3.24Å
17	G	62.2	Low	61.8	Low	50 Å²	50	136 Å²	136	52%	0.515	79%	0.788	S	S	.	*			trans	-72.9	115.7	160.5	0	0	0	0	0	108.3	H19	G17-H19 VanDerWaalsContact C-N 3.31Å; G17-H19 PolarHBondContact O-CD2 3.49Å; G17-H19 PolarHBondContact O-N 2.77Å
18	R	63.9	Low	63.4	Low	218 Å²	218	133.8 Å²	133.8	82%	0.823	78%	0.784	S	S	*	*			trans	-68.5	95.3	167.5	-67	-176.6	-173.8	-131.7	2.5	107.2	S16 F20	S16-R18 PolarHBondContact O-N 3.24Å; R18-F20 PolarHBondContact O-N 2.87Å
19	H	67.7	Low	65.1	Low	183 Å²	183	128.4 Å²	128.4	85%	0.847	77%	0.766	S	S	*	*			trans	-69.1	110.1	173.4	-71.5	-91.9	0	0	0	108.4	G17 S21	G17-H19 VanDerWaalsContact C-N 3.31Å; G17-H19 PolarHBondContact O-CD2 3.49Å; G17-H19 PolarHBondContact O-N 2.77Å; H19-S21 PolarHBondContact O-N 3.41Å
20	F	69.8	Low	67.2	Low	193 Å²	193	125.6 Å²	125.6	85%	0.846	74%	0.741	S	S	*	*			trans	-78.2	117.7	165.4	-79.8	-89.5	0	0	0	107.9	R18 S22	R18-F20 PolarHBondContact O-N 2.87Å; F20-S22 PolarHBondContact O-N 2.86Å
21	S	68.9	Low	69.3	Low	93 Å²	93	127.1 Å²	127.1	65%	0.65	73%	0.732	S	S	*	*			trans	-75.1	119	170.4	-164.9	0	0	0	0	108.8	H19 T23	H19-S21 PolarHBondContact O-N 3.41Å; S21-T23 VanDerWaalsContact C-N 3.29Å; S21-T23 PolarHBondContact OG-OG1 3.16Å
22	S	71.9	Confident	71.2	Confident	125 Å²	125	128 Å²	128	87%	0.874	72%	0.717	S	S	*	*			trans	-86.9	0	171.4	58.6	0	0	0	0	112.7	F20	F20-S22 PolarHBondContact O-N 2.86Å
23	T	72.5	Confident	73	Confident	106 Å²	106	128.1 Å²	128.1	65%	0.65	70%	0.696	S	S	*	*	S	Bend	trans	-68.9	133.4	177.9	58.2	0	0	0	0	110.2	S21 G25	S21-T23 VanDerWaalsContact C-N 3.29Å; S21-T23 PolarHBondContact OG-OG1 3.16Å; T23-G25 PolarHBondContact O-N 3.13Å
24	C	69.3	Low	74.7	Confident	116 Å²	116	124.5 Å²	124.5	78%	0.784	68%	0.677	S	S	*	*			trans	-56.9	121.8	173.1	-178.8	0	0	0	0	109	V26	C24-V26 PolarHBondContact O-N 2.84Å
25	G	67.7	Low	76.6	Confident	67 Å²	67	120 Å²	120	69%	0.691	67%	0.667	S	S	*	*			trans	-61.2	107.1	175.4	0	0	0	0	0	109.9	T23 Q27	T23-G25 PolarHBondContact O-N 3.13Å; G25-Q27 PolarHBondContact O-N 3.45Å
26	V	65.8	Low	78.4	Confident	129 Å²	129	116.7 Å²	116.7	78%	0.782	65%	0.646	S	S	*	*			trans	-68.8	122.9	173.6	-178.1	0	0	0	0	107.5	C24 A28	C24-V26 PolarHBondContact O-N 2.84Å; V26-A28 PolarHBondContact O-N 3.44Å; V26-A28 VanDerWaalsContact O-N 3.1Å
27	Q	71.6	Confident	80	Confident	97 Å²	97	114 Å²	114	45%	0.453	64%	0.637	S	S	.	*			trans	-66.6	113.4	174	-67.5	-158	-31.5	0	0	109.1	G25 G29 Q30 S41	G25-Q27 PolarHBondContact O-N 3.45Å; Q27-G29 PolarHBondContact O-N 3.36Å; Q27-Q30 HydrophobicContact CB-CB 4.45Å; Q27-Q30 WeakPolarHBondContact O-CB 3.45Å; Q27-Q30 PolarHBondContact O-N 2.98Å; Q27-S41 VanDerWaalsContact OE1-CB 3.22Å
28	A	83.9	Confident	81.5	Confident	98 Å²	98	115.2 Å²	115.2	81%	0.81	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.2	134.2	177.4	0	0	0	0	0	110.3	V26 Q30	V26-A28 PolarHBondContact O-N 3.44Å; V26-A28 VanDerWaalsContact O-N 3.1Å; A28-Q30 VanDerWaalsContact C-N 3.33Å; A28-Q30 PolarHBondContact O-N 3.18Å
29	G	90.1	Very high	82.8	Confident	43 Å²	43	105.2 Å²	105.2	44%	0.443	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	78.4	5.4	178.3	0	0	0	0	0	115.9	Q27 K31 W32 R33	Q27-G29 PolarHBondContact O-N 3.36Å; G29-K31 VanDerWaalsContact C-N 3.35Å; G29-K31 PolarHBondContact O-N 3.38Å; G29-W32 PolarHBondContact O-N 3.37Å; G29-R33 WeakPolarHBondContact O-CG 3.37Å; G29-R33 PolarHBondContact O-N 2.77Å
30	Q	91.3	Very high	84	Confident	61 Å²	61	102.6 Å²	102.6	29%	0.285	58%	0.578	S	S	.	*	H	α-helix	trans	-55.8	-45.6	178.1	-177.7	-173.6	-21.1	0	0	112.9	Q27 A28 R33 L34 R40	Q27-Q30 HydrophobicContact CB-CB 4.45Å; Q27-Q30 WeakPolarHBondContact O-CB 3.45Å; Q27-Q30 PolarHBondContact O-N 2.98Å; A28-Q30 VanDerWaalsContact C-N 3.33Å; A28-Q30 PolarHBondContact O-N 3.18Å; Q30-R33 PolarHBondContact O-N 2.84Å; Q30-L34 HydrophobicContact CG-CD1 4.16Å; Q30-L34 WeakPolarHBondContact O-CG 3.36Å; Q30-L34 PolarHBondContact O-N 2.91Å; Q30-R40 VanDerWaalsContact CD-CG 3.48Å; Q30-R40 HydrophobicContact CG-CG 3.55Å; Q30-R40 VanDerWaalsContact NE2-CG 3.31Å
31	K	93.1	Very high	84.9	Confident	169 Å²	169	93.9 Å²	93.9	74%	0.735	54%	0.54	S	S	*	.	H	α-helix	trans	-59.4	-51.3	-179.2	-68.2	-175.4	179.1	-177.6	0	111.4	G29 R33 L34 E35	G29-K31 VanDerWaalsContact C-N 3.35Å; G29-K31 PolarHBondContact O-N 3.38Å; K31-R33 VanDerWaalsContact C-N 3.31Å; K31-R33 PolarHBondContact O-N 3.32Å; K31-L34 PolarHBondContact O-N 3.37Å; K31-E35 WeakPolarHBondContact O-CG 3.43Å; K31-E35 PolarHBondContact O-N 3.24Å
32	W	94.9	Very high	85.7	Confident	142 Å²	142	90.9 Å²	90.9	54%	0.538	53%	0.525	S	S	.	.	H	α-helix	trans	-57.4	-43.5	177.5	-177.4	90	0	0	0	111.6	G29 L34 E35 H36 L38	G29-W32 PolarHBondContact O-N 3.37Å; W32-L34 PolarHBondContact O-N 2.92Å; W32-E35 PolarHBondContact O-N 2.93Å; W32-H36 AromaticContact CD1-CE1 3.44Å; W32-H36 VanDerWaalsContact CD1-CE1 3.44Å; W32-H36 AromaticContact CD1-ND1 3.85Å; W32-H36 AromaticContact CD2-CE1 3.95Å; W32-H36 AromaticContact CD2-ND1 3.75Å; W32-H36 AromaticContact CE2-CE1 3.4Å; W32-H36 AromaticContact CE2-ND1 3.59Å; W32-H36 AromaticContact CE2-NE2 3.69Å; W32-H36 AromaticContact CG-CE1 3.98Å; W32-H36 AromaticContact CG-ND1 3.92Å; W32-H36 AromaticContact CZ2-CD2 3.85Å; W32-H36 AromaticContact CZ2-CE1 3.93Å; W32-H36 AromaticContact CZ2-NE2 3.77Å; W32-H36 AromaticContact NE1-CE1 3.07Å; W32-H36 PolarHBondContact NE1-CE1 3.3Å; W32-H36 AromaticContact NE1-ND1 3.66Å; W32-H36 AromaticContact NE1-NE2 3.54Å; W32-H36 PolarHBondContact O-N 3.46Å; W32-H36 VanDerWaalsContact O-N 3.1Å; W32-H36 PolarHBondContact O-ND1 2.84Å; W32-L38 HydrophobicContact CZ3-CD1 3.99Å
33	R	94.8	Very high	86.5	Confident	98 Å²	98	88.8 Å²	88.8	37%	0.37	51%	0.51	S	S	.	.	H	α-helix	trans	-59.1	-48.1	177.2	-73.7	178.7	-174.3	-78.1	-3.4	112.1	G29 Q30 K31 H36 G37 L38	G29-R33 WeakPolarHBondContact O-CG 3.37Å; G29-R33 PolarHBondContact O-N 2.77Å; Q30-R33 PolarHBondContact O-N 2.84Å; K31-R33 VanDerWaalsContact C-N 3.31Å; K31-R33 PolarHBondContact O-N 3.32Å; R33-H36 CarbonylContact O-C 3.46Å; R33-H36 PolarHBondContact O-N 3.34Å; R33-H36 VanDerWaalsContact O-N 3.14Å; R33-G37 PolarHBondContact O-N 2.88Å; R33-L38 HydrophobicContact CB-CB 4.04Å; R33-L38 HydrophobicContact CG-CB 4.48Å; R33-L38 HydrophobicContact CG-CD1 4.4Å; R33-L38 WeakPolarHBondContact O-CB 3.47Å; R33-L38 PolarHBondContact O-N 3.43Å
34	L	93.9	Very high	87.4	Confident	95 Å²	95	87.2 Å²	87.2	50%	0.497	50%	0.495	S	S	.	.	H	α-helix	trans	-64.7	-40.1	179.9	-68.1	174.8	0	0	0	112	Q30 K31 W32 H36 G37 R40	Q30-L34 HydrophobicContact CG-CD1 4.16Å; Q30-L34 WeakPolarHBondContact O-CG 3.36Å; Q30-L34 PolarHBondContact O-N 2.91Å; K31-L34 PolarHBondContact O-N 3.37Å; W32-L34 PolarHBondContact O-N 2.92Å; L34-H36 PolarHBondContact O-N 2.82Å; L34-G37 PolarHBondContact O-N 3.25Å; L34-G37 VanDerWaalsContact O-N 3.07Å; L34-R40 HydrophobicContact CD2-CB 4.22Å
35	E	96.6	Very high	88.5	Confident	146 Å²	146	87.1 Å²	87.1	68%	0.682	48%	0.479	S	S	*	.	H	α-helix	trans	-60.4	-28.8	174.5	-72.9	165.7	-172.9	0	0	112.5	K31 W32	K31-E35 WeakPolarHBondContact O-CG 3.43Å; K31-E35 PolarHBondContact O-N 3.24Å; W32-E35 PolarHBondContact O-N 2.93Å
36	H	95.3	Very high	89.7	Confident	107 Å²	107	84.9 Å²	84.9	50%	0.495	46%	0.455	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.2	13.7	178.2	-65.5	69.3	0	0	0	113	W32 R33 L34 L38	W32-H36 AromaticContact CD1-CE1 3.44Å; W32-H36 VanDerWaalsContact CD1-CE1 3.44Å; W32-H36 AromaticContact CD1-ND1 3.85Å; W32-H36 AromaticContact CD2-CE1 3.95Å; W32-H36 AromaticContact CD2-ND1 3.75Å; W32-H36 AromaticContact CE2-CE1 3.4Å; W32-H36 AromaticContact CE2-ND1 3.59Å; W32-H36 AromaticContact CE2-NE2 3.69Å; W32-H36 AromaticContact CG-CE1 3.98Å; W32-H36 AromaticContact CG-ND1 3.92Å; W32-H36 AromaticContact CZ2-CD2 3.85Å; W32-H36 AromaticContact CZ2-CE1 3.93Å; W32-H36 AromaticContact CZ2-NE2 3.77Å; W32-H36 AromaticContact NE1-CE1 3.07Å; W32-H36 PolarHBondContact NE1-CE1 3.3Å; W32-H36 AromaticContact NE1-ND1 3.66Å; W32-H36 AromaticContact NE1-NE2 3.54Å; W32-H36 PolarHBondContact O-N 3.46Å; W32-H36 VanDerWaalsContact O-N 3.1Å; W32-H36 PolarHBondContact O-ND1 2.84Å; R33-H36 CarbonylContact O-C 3.46Å; R33-H36 PolarHBondContact O-N 3.34Å; R33-H36 VanDerWaalsContact O-N 3.14Å; L34-H36 PolarHBondContact O-N 2.82Å; H36-L38 HydrophobicContact CB-CG 4.48Å; H36-L38 PolarHBondContact O-N 3.36Å
37	G	94.2	Very high	90.9	Very high	58 Å²	58	83.5 Å²	83.5	60%	0.598	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	67.5	19.7	178.2	0	0	0	0	0	114.5	R33 L34	R33-G37 PolarHBondContact O-N 2.88Å; L34-G37 PolarHBondContact O-N 3.25Å; L34-G37 VanDerWaalsContact O-N 3.07Å
38	L	93.7	Very high	91.9	Very high	75 Å²	75	85.6 Å²	85.6	39%	0.393	46%	0.461	S	S	.	.			trans	-90	163.9	175.1	-60.1	174.9	0	0	0	111.1	W32 R33 H36 Y45	W32-L38 HydrophobicContact CZ3-CD1 3.99Å; R33-L38 HydrophobicContact CB-CB 4.04Å; R33-L38 HydrophobicContact CG-CB 4.48Å; R33-L38 HydrophobicContact CG-CD1 4.4Å; R33-L38 WeakPolarHBondContact O-CB 3.47Å; R33-L38 PolarHBondContact O-N 3.43Å; H36-L38 HydrophobicContact CB-CG 4.48Å; H36-L38 PolarHBondContact O-N 3.36Å; L38-Y45 VanDerWaalsContact C-OH 3.3Å
39	A	92.7	Very high	92.2	Very high	8 Å²	8	82.6 Å²	82.6	7%	0.066	43%	0.432	C	S	.	.			trans	-57.9	147.3	172.9	0	0	0	0	0	111.7	S41 E44 Y45	A39-S41 WeakPolarHBondContact CB-O 3.28Å; A39-S41 PolarHBondContact O-N 3.47Å; A39-E44 HydrophobicContact CB-CB 4Å; A39-Y45 WeakPolarHBondContact CA-OH 3.28Å; A39-Y45 HydrophobicContact CB-CD1 3.63Å; A39-Y45 HydrophobicContact CB-CD2 4.23Å; A39-Y45 HydrophobicContact CB-CE1 3.38Å; A39-Y45 HydrophobicContact CB-CE2 4.01Å; A39-Y45 HydrophobicContact CB-CG 4.05Å; A39-Y45 PolarHBondContact N-OH 2.94Å; A39-Y45 VanDerWaalsContact N-OH 3.17Å
40	R	91.4	Very high	92.3	Very high	129 Å²	129	83.6 Å²	83.6	49%	0.487	43%	0.428	S	S	.	.	S	Bend	trans	-57.5	-43.6	-179.7	-176.8	-173.6	62.1	147.6	-0.6	110.7	Q30 L34 E44	Q30-R40 VanDerWaalsContact CD-CG 3.48Å; Q30-R40 HydrophobicContact CG-CG 3.55Å; Q30-R40 VanDerWaalsContact NE2-CG 3.31Å; L34-R40 HydrophobicContact CD2-CB 4.22Å; R40-E44 IonicContact CZ-OE1 3.76Å; R40-E44 PolarHBondContact N-OE2 2.96Å; R40-E44 IonicContact NE-OE1 3.29Å; R40-E44 PolarHBondContact NE-OE1 2.96Å; R40-E44 IonicContact NH2-OE1 3.19Å; R40-E44 PolarHBondContact NH2-OE1 3.37Å
41	S	88.9	Confident	92.3	Very high	9 Å²	9	85.8 Å²	85.8	6%	0.063	44%	0.441	C	S	.	.	S	Bend	trans	-115.5	156.1	173.8	66.8	0	0	0	0	110.3	Q27 A39 S43 E44	Q27-S41 VanDerWaalsContact OE1-CB 3.22Å; A39-S41 WeakPolarHBondContact CB-O 3.28Å; A39-S41 PolarHBondContact O-N 3.47Å; S41-S43 PolarHBondContact O-N 3Å; S41-S43 VanDerWaalsContact O-N 3.16Å; S41-S43 PolarHBondContact OG-OG 3.31Å; S41-E44 VanDerWaalsContact OG-CG 3.25Å; S41-E44 WeakPolarHBondContact OG-CG 3.49Å; S41-E44 PolarHBondContact OG-OE1 2.99Å
42	G	86.7	Confident	92.3	Very high	31 Å²	31	81.2 Å²	81.2	32%	0.32	43%	0.429	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.4	-11.6	179.2	0	0	0	0	0	114.8	M48 T49	G42-M48 VanDerWaalsContact O-CE 3.23Å; G42-M48 WeakPolarHBondContact O-CE 3.4Å; G42-T49 PolarHBondContact O-OG1 3.01Å
43	S	88.9	Confident	92.2	Very high	80 Å²	80	80.3 Å²	80.3	56%	0.559	43%	0.434	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.5	-3.2	-171.8	55.9	0	0	0	0	114.9	S41 T49	S41-S43 PolarHBondContact O-N 3Å; S41-S43 VanDerWaalsContact O-N 3.16Å; S41-S43 PolarHBondContact OG-OG 3.31Å; S43-T49 WeakPolarHBondContact CA-OG1 3.23Å; S43-T49 WeakPolarHBondContact O-CG2 3.48Å
44	E	90.4	Very high	92.1	Very high	74 Å²	74	81.8 Å²	81.8	35%	0.346	44%	0.44	S	S	.	.	S	Bend	trans	-77.4	-59.6	-176	-84.2	160.6	-150.1	0	0	111.5	A39 R40 S41	A39-E44 HydrophobicContact CB-CB 4Å; R40-E44 IonicContact CZ-OE1 3.76Å; R40-E44 PolarHBondContact N-OE2 2.96Å; R40-E44 IonicContact NE-OE1 3.29Å; R40-E44 PolarHBondContact NE-OE1 2.96Å; R40-E44 IonicContact NH2-OE1 3.19Å; R40-E44 PolarHBondContact NH2-OE1 3.37Å; S41-E44 VanDerWaalsContact OG-CG 3.25Å; S41-E44 WeakPolarHBondContact OG-CG 3.49Å; S41-E44 PolarHBondContact OG-OE1 2.99Å
45	Y	91.9	Very high	92.1	Very high	114 Å²	114	81.2 Å²	81.2	45%	0.447	44%	0.443	S	S	.	.	S	Bend	trans	-151.3	158.3	177.5	65.3	-95.4	0	0	0	110	L38 A39	L38-Y45 VanDerWaalsContact C-OH 3.3Å; A39-Y45 WeakPolarHBondContact CA-OH 3.28Å; A39-Y45 HydrophobicContact CB-CD1 3.63Å; A39-Y45 HydrophobicContact CB-CD2 4.23Å; A39-Y45 HydrophobicContact CB-CE1 3.38Å; A39-Y45 HydrophobicContact CB-CE2 4.01Å; A39-Y45 HydrophobicContact CB-CG 4.05Å; A39-Y45 PolarHBondContact N-OH 2.94Å; A39-Y45 VanDerWaalsContact N-OH 3.17Å
46	G	92.7	Very high	92.1	Very high	19 Å²	19	78.2 Å²	78.2	20%	0.196	43%	0.429	C	S	.	.	S	Bend	trans	123.7	177.5	179.3	0	0	0	0	0	112.9	M48 T49 D50	G46-M48 PolarHBondContact O-N 3.47Å; G46-M48 VanDerWaalsContact O-N 3.17Å; G46-T49 PolarHBondContact O-N 2.94Å; G46-D50 PolarHBondContact N-OD2 3.5Å; G46-D50 WeakPolarHBondContact O-CB 3.5Å; G46-D50 PolarHBondContact O-N 2.93Å
47	P	92.1	Very high	92.2	Very high	100 Å²	100	82.6 Å²	82.6	65%	0.649	45%	0.449	S	S	*	.	H	α-helix	trans	-59.3	-35.8	-169.5	22.5	-33.3	0	0	0	112.7	T49 L51	P47-T49 PolarHBondContact O-N 3.43Å; P47-L51 HydrophobicContact CB-CD1 3.84Å; P47-L51 HydrophobicContact CB-CG 4.34Å; P47-L51 WeakPolarHBondContact O-CB 3.25Å; P47-L51 WeakPolarHBondContact O-CD1 3.46Å; P47-L51 VanDerWaalsContact O-CG 3.23Å; P47-L51 WeakPolarHBondContact O-CG 3.33Å; P47-L51 PolarHBondContact O-N 3.32Å
48	M	91.7	Very high	92.3	Very high	141 Å²	141	85.5 Å²	85.5	70%	0.695	45%	0.451	S	S	*	.	H	α-helix	trans	-64.7	-23.2	179.3	-165.4	178.6	87.7	0	0	113.8	G42 G46	G42-M48 VanDerWaalsContact O-CE 3.23Å; G42-M48 WeakPolarHBondContact O-CE 3.4Å; G46-M48 PolarHBondContact O-N 3.47Å; G46-M48 VanDerWaalsContact O-N 3.17Å
49	T	91.6	Very high	92.4	Very high	35 Å²	35	84.8 Å²	84.8	22%	0.215	46%	0.462	C	S	.	.	H	α-helix	trans	-115.8	-24.8	-176.4	-40.3	0	0	0	0	112.8	G42 S43 G46 P47 R71	G42-T49 PolarHBondContact O-OG1 3.01Å; S43-T49 WeakPolarHBondContact CA-OG1 3.23Å; S43-T49 WeakPolarHBondContact O-CG2 3.48Å; G46-T49 PolarHBondContact O-N 2.94Å; P47-T49 PolarHBondContact O-N 3.43Å; T49-R71 VanDerWaalsContact CG2-NH1 3.29Å; T49-R71 PolarHBondContact O-NH2 3.47Å
50	D	90.8	Very high	92.5	Very high	64 Å²	64	91.3 Å²	91.3	34%	0.342	49%	0.485	S	S	.	.	H	α-helix	trans	-94.6	-23.8	-175.4	-65.3	-28.3	0	0	0	112.5	G46 Q68 R71	G46-D50 PolarHBondContact N-OD2 3.5Å; G46-D50 WeakPolarHBondContact O-CB 3.5Å; G46-D50 PolarHBondContact O-N 2.93Å; D50-Q68 PolarHBondContact O-NE2 2.95Å; D50-R71 IonicContact OD1-CZ 3.19Å; D50-R71 IonicContact OD1-NH1 3.53Å; D50-R71 PolarHBondContact OD1-NH1 3.37Å; D50-R71 IonicContact OD1-NH2 2.67Å
51	L	92.3	Very high	92.7	Very high	107 Å²	107	90.4 Å²	90.4	56%	0.56	50%	0.496	S	S	*	.	S	Bend	trans	-77	154.5	173.6	-64.7	176.3	0	0	0	111.6	P47 Q68	P47-L51 HydrophobicContact CB-CD1 3.84Å; P47-L51 HydrophobicContact CB-CG 4.34Å; P47-L51 WeakPolarHBondContact O-CB 3.25Å; P47-L51 WeakPolarHBondContact O-CD1 3.46Å; P47-L51 VanDerWaalsContact O-CG 3.23Å; P47-L51 WeakPolarHBondContact O-CG 3.33Å; P47-L51 PolarHBondContact O-N 3.32Å; L51-Q68 PolarHBondContact O-NE2 2.66Å
52	P	92.7	Very high	92.9	Very high	74 Å²	74	90.8 Å²	90.8	48%	0.481	50%	0.499	S	S	.	.			trans	-71.7	139	173.2	30.5	-34.2	0	0	0	110.8	W54 A62	P52-W54 PolarHBondContact O-N 3.47Å; P52-A62 HydrophobicContact CB-CB 4.39Å
53	D	92.2	Very high	93.3	Very high	123 Å²	123	93 Å²	93	66%	0.658	51%	0.508	S	S	*	.	S	Bend	trans	-71.2	-18.6	-179.5	-58.7	-41.8	0	0	0	113.1
54	W	93.7	Very high	93.5	Very high	129 Å²	129	93 Å²	93	49%	0.489	51%	0.506	S	S	.	.			trans	-152.2	167.1	-178.1	62.7	-83.8	0	0	0	111.5	P52 F56 A62 P63	P52-W54 PolarHBondContact O-N 3.47Å; W54-F56 HydrophobicContact CH2-CE1 4.4Å; W54-F56 HydrophobicContact CH2-CE2 4.08Å; W54-F56 AromaticContact CH2-CZ 3.86Å; W54-F56 HydrophobicContact CH2-CZ 3.86Å; W54-F56 HydrophobicContact CZ3-CD1 4.28Å; W54-F56 HydrophobicContact CZ3-CD2 4.13Å; W54-F56 AromaticContact CZ3-CE1 3.99Å; W54-F56 HydrophobicContact CZ3-CE1 3.99Å; W54-F56 AromaticContact CZ3-CE2 3.85Å; W54-F56 HydrophobicContact CZ3-CE2 3.85Å; W54-F56 HydrophobicContact CZ3-CG 4.35Å; W54-F56 AromaticContact CZ3-CZ 3.77Å; W54-F56 HydrophobicContact CZ3-CZ 3.77Å; W54-A62 HydrophobicContact CD2-CB 3.86Å; W54-A62 HydrophobicContact CE3-CB 4.02Å; W54-A62 HydrophobicContact CG-CB 4.47Å; W54-A62 HydrophobicContact CH2-CB 4.08Å; W54-A62 HydrophobicContact CZ2-CB 3.91Å; W54-A62 HydrophobicContact CZ3-CB 4.12Å; W54-A62 WeakPolarHBondContact O-CB 3.47Å; W54-P63 HydrophobicContact CH2-CG 4.38Å; W54-P63 HydrophobicContact CZ2-CG 4.26Å
55	S	94.6	Very high	93.7	Very high	82 Å²	82	92.7 Å²	92.7	57%	0.573	51%	0.507	S	S	*	.	B	Isolated β-bridge	trans	-146	163	171.9	57.4	0	0	0	0	109.6
56	F	96.4	Very high	93.9	Very high	84 Å²	84	96.3 Å²	96.3	37%	0.368	53%	0.525	S	S	.	.			trans	-73.2	149	173.7	-66.2	-84.3	0	0	0	110	W54 D58 G59 R60	W54-F56 HydrophobicContact CH2-CE1 4.4Å; W54-F56 HydrophobicContact CH2-CE2 4.08Å; W54-F56 AromaticContact CH2-CZ 3.86Å; W54-F56 HydrophobicContact CH2-CZ 3.86Å; W54-F56 HydrophobicContact CZ3-CD1 4.28Å; W54-F56 HydrophobicContact CZ3-CD2 4.13Å; W54-F56 AromaticContact CZ3-CE1 3.99Å; W54-F56 HydrophobicContact CZ3-CE1 3.99Å; W54-F56 AromaticContact CZ3-CE2 3.85Å; W54-F56 HydrophobicContact CZ3-CE2 3.85Å; W54-F56 HydrophobicContact CZ3-CG 4.35Å; W54-F56 AromaticContact CZ3-CZ 3.77Å; W54-F56 HydrophobicContact CZ3-CZ 3.77Å; F56-D58 PolarHBondContact O-N 2.96Å; F56-G59 WeakPolarHBondContact O-CA 3.47Å; F56-G59 PolarHBondContact O-N 3.35Å; F56-R60 HydrophobicContact CB-CB 4.01Å; F56-R60 HydrophobicContact CD2-CB 3.75Å; F56-R60 WeakPolarHBondContact CD2-O 3.35Å; F56-R60 HydrophobicContact CG-CB 4.18Å; F56-R60 PolarHBondContact N-O 2.99Å; F56-R60 VanDerWaalsContact N-O 3.14Å
57	E	96.8	Very high	93.9	Very high	198 Å²	198	96.9 Å²	96.9	93%	0.925	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.1	-34	177.5	-172.7	173.4	-171.3	0	0	112.4	G59	E57-G59 PolarHBondContact O-N 3.29Å
58	D	96.6	Very high	94	Very high	119 Å²	119	93.6 Å²	93.6	64%	0.636	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-3	174.4	-48.3	-47.5	0	0	0	114	F56 R60	F56-D58 PolarHBondContact O-N 2.96Å; D58-R60 VanDerWaalsContact C-N 3.3Å; D58-R60 HydrophobicContact CB-CG 4.38Å; D58-R60 PolarHBondContact O-N 3.24Å; D58-R60 IonicContact OD2-CZ 3.7Å; D58-R60 IonicContact OD2-NE 3.71Å; D58-R60 PolarHBondContact OD2-NE 2.99Å; D58-R60 IonicContact OD2-NH2 3.84Å; D58-R60 PolarHBondContact OD2-NH2 3.38Å
59	G	94.6	Very high	94.2	Very high	61 Å²	61	90.2 Å²	90.2	63%	0.629	49%	0.49	S	S	*	.	S	Bend	trans	81.3	5.3	-175	0	0	0	0	0	114.4	F56 E57	F56-G59 WeakPolarHBondContact O-CA 3.47Å; F56-G59 PolarHBondContact O-N 3.35Å; E57-G59 PolarHBondContact O-N 3.29Å
60	R	95.9	Very high	94.5	Very high	145 Å²	145	94.8 Å²	94.8	55%	0.547	50%	0.503	S	S	.	.	P	Polyproline II helix	trans	-65.2	137.7	173	-65.3	-179.5	-78.6	-178.4	-2.9	109.5	F56 D58	F56-R60 HydrophobicContact CB-CB 4.01Å; F56-R60 HydrophobicContact CD2-CB 3.75Å; F56-R60 WeakPolarHBondContact CD2-O 3.35Å; F56-R60 HydrophobicContact CG-CB 4.18Å; F56-R60 PolarHBondContact N-O 2.99Å; F56-R60 VanDerWaalsContact N-O 3.14Å; D58-R60 VanDerWaalsContact C-N 3.3Å; D58-R60 HydrophobicContact CB-CG 4.38Å; D58-R60 PolarHBondContact O-N 3.24Å; D58-R60 IonicContact OD2-CZ 3.7Å; D58-R60 IonicContact OD2-NE 3.71Å; D58-R60 PolarHBondContact OD2-NE 2.99Å; D58-R60 IonicContact OD2-NH2 3.84Å; D58-R60 PolarHBondContact OD2-NH2 3.38Å
61	P	94.6	Very high	94.7	Very high	110 Å²	110	94 Å²	94	71%	0.714	50%	0.496	S	S	*	.	B	Isolated β-bridge	trans	-69	146.3	179.2	28.7	-34.3	0	0	0	110.7
62	A	93.9	Very high	94.8	Very high	16 Å²	16	97.2 Å²	97.2	13%	0.132	50%	0.5	C	S	.	.	P	Polyproline II helix	trans	-64.8	146.4	170.8	0	0	0	0	0	110.6	P52 W54	P52-A62 HydrophobicContact CB-CB 4.39Å; W54-A62 HydrophobicContact CD2-CB 3.86Å; W54-A62 HydrophobicContact CE3-CB 4.02Å; W54-A62 HydrophobicContact CG-CB 4.47Å; W54-A62 HydrophobicContact CH2-CB 4.08Å; W54-A62 HydrophobicContact CZ2-CB 3.91Å; W54-A62 HydrophobicContact CZ3-CB 4.12Å; W54-A62 WeakPolarHBondContact O-CB 3.47Å
63	P	94.7	Very high	95.1	Very high	79 Å²	79	99 Å²	99	51%	0.513	50%	0.503	S	S	.	.	P	Polyproline II helix	trans	-59.4	143.6	170.8	26.4	-33.8	0	0	0	110.2	W54	W54-P63 HydrophobicContact CH2-CG 4.38Å; W54-P63 HydrophobicContact CZ2-CG 4.26Å
64	P	94.1	Very high	95.3	Very high	79 Å²	79	97.5 Å²	97.5	51%	0.513	49%	0.492	S	S	.	.	P	Polyproline II helix	trans	-65.5	139.1	-175.6	25.9	-34	0	0	0	111.8	I69	P64-I69 HydrophobicContact CB-CD1 4.29Å; P64-I69 HydrophobicContact CB-CG1 4.01Å; P64-I69 HydrophobicContact CG-CD1 4.07Å; P64-I69 HydrophobicContact CG-CG1 4.22Å
65	L	93.6	Very high	95.5	Very high	68 Å²	68	96.8 Å²	96.8	36%	0.356	49%	0.492	S	S	.	.	P	Polyproline II helix	trans	-71.1	145.6	177.8	-66.5	93	0	0	0	110.6	G67 Q68 I69	L65-G67 PolarHBondContact O-N 2.93Å; L65-G67 VanDerWaalsContact O-N 3.12Å; L65-Q68 HydrophobicContact CB-CG 4.23Å; L65-Q68 WeakPolarHBondContact O-CB 3.27Å; L65-Q68 PolarHBondContact O-N 3.14Å; L65-I69 PolarHBondContact O-N 2.93Å
66	K	95.8	Very high	95.7	Very high	190 Å²	190	97.2 Å²	97.2	83%	0.826	49%	0.485	S	S	*	.	H	α-helix	trans	-51.3	-41	177.9	-64.3	-177.7	-179.5	179.6	0	112.6	I69 R70	K66-I69 PolarHBondContact O-N 3.5Å; K66-R70 PolarHBondContact O-N 3.12Å
67	G	93.8	Very high	95.8	Very high	30 Å²	30	97.4 Å²	97.4	31%	0.309	49%	0.493	S	S	.	.	H	α-helix	trans	-68.2	-32.6	177.7	0	0	0	0	0	114	L65 R71	L65-G67 PolarHBondContact O-N 2.93Å; L65-G67 VanDerWaalsContact O-N 3.12Å; G67-R71 WeakPolarHBondContact O-CB 3.46Å; G67-R71 VanDerWaalsContact O-CG 3.29Å; G67-R71 WeakPolarHBondContact O-CG 3.29Å; G67-R71 PolarHBondContact O-N 3.46Å; G67-R71 VanDerWaalsContact O-N 3.08Å; G67-R71 PolarHBondContact O-NE 3.23Å
68	Q	93.6	Very high	95.8	Very high	32 Å²	32	92.8 Å²	92.8	15%	0.15	47%	0.474	C	S	.	.	H	α-helix	trans	-70.1	-42.6	173.8	-71	171.7	-37.5	0	0	110.9	D50 L51 L65 R71 R72	D50-Q68 PolarHBondContact O-NE2 2.95Å; L51-Q68 PolarHBondContact O-NE2 2.66Å; L65-Q68 HydrophobicContact CB-CG 4.23Å; L65-Q68 WeakPolarHBondContact O-CB 3.27Å; L65-Q68 PolarHBondContact O-N 3.14Å; Q68-R71 PolarHBondContact O-N 3.4Å; Q68-R72 WeakPolarHBondContact O-CB 3.45Å; Q68-R72 PolarHBondContact O-N 2.94Å
69	I	96.1	Very high	95.9	Very high	70 Å²	70	89.5 Å²	89.5	36%	0.359	46%	0.463	S	S	.	.	H	α-helix	trans	-59.1	-50.8	176.9	-61.6	170.8	0	0	0	110.1	P64 L65 K66 R71 R72 Q73	P64-I69 HydrophobicContact CB-CD1 4.29Å; P64-I69 HydrophobicContact CB-CG1 4.01Å; P64-I69 HydrophobicContact CG-CD1 4.07Å; P64-I69 HydrophobicContact CG-CG1 4.22Å; L65-I69 PolarHBondContact O-N 2.93Å; K66-I69 PolarHBondContact O-N 3.5Å; I69-R71 PolarHBondContact O-N 3.49Å; I69-R72 WeakPolarHBondContact O-CB 3.33Å; I69-R72 PolarHBondContact O-N 3.4Å; I69-Q73 WeakPolarHBondContact O-CG 3.42Å; I69-Q73 PolarHBondContact O-N 3.33Å
70	R	97	Very high	96.1	Very high	130 Å²	130	94.3 Å²	94.3	49%	0.491	46%	0.463	S	S	.	.	H	α-helix	trans	-57.5	-50.1	177.9	-178.4	177	61	75	-0.7	111.8	K66 R72 Q73 E74	K66-R70 PolarHBondContact O-N 3.12Å; R70-R72 VanDerWaalsContact C-N 3.28Å; R70-R72 PolarHBondContact O-N 2.99Å; R70-Q73 PolarHBondContact O-N 3Å; R70-E74 HydrophobicContact CG-CG 4.47Å; R70-E74 VanDerWaalsContact CG-OE1 3.25Å; R70-E74 WeakPolarHBondContact CG-OE1 3.41Å; R70-E74 IonicContact CZ-OE1 3.33Å; R70-E74 VanDerWaalsContact NH1-CD 3.34Å; R70-E74 IonicContact NH1-OE1 2.63Å; R70-E74 PolarHBondContact NH1-OE1 3.24Å; R70-E74 IonicContact NH1-OE2 2.72Å; R70-E74 PolarHBondContact NH1-OE2 3.07Å; R70-E74 WeakPolarHBondContact O-CG 3.47Å; R70-E74 PolarHBondContact O-N 3.03Å
71	R	95.6	Very high	96.3	Very high	47 Å²	47	95 Å²	95	18%	0.177	47%	0.465	C	S	.	.	H	α-helix	trans	-60.7	-36.1	178.4	-75.6	-177	-69.8	149.2	1.7	112.4	T49 D50 G67 Q68 I69 K75	T49-R71 VanDerWaalsContact CG2-NH1 3.29Å; T49-R71 PolarHBondContact O-NH2 3.47Å; D50-R71 IonicContact OD1-CZ 3.19Å; D50-R71 IonicContact OD1-NH1 3.53Å; D50-R71 PolarHBondContact OD1-NH1 3.37Å; D50-R71 IonicContact OD1-NH2 2.67Å; G67-R71 WeakPolarHBondContact O-CB 3.46Å; G67-R71 VanDerWaalsContact O-CG 3.29Å; G67-R71 WeakPolarHBondContact O-CG 3.29Å; G67-R71 PolarHBondContact O-N 3.46Å; G67-R71 VanDerWaalsContact O-N 3.08Å; G67-R71 PolarHBondContact O-NE 3.23Å; Q68-R71 PolarHBondContact O-N 3.4Å; I69-R71 PolarHBondContact O-N 3.49Å; R71-K75 WeakPolarHBondContact O-CB 3.39Å; R71-K75 VanDerWaalsContact O-CG 3.27Å; R71-K75 WeakPolarHBondContact O-CG 3.39Å; R71-K75 PolarHBondContact O-N 3.4Å
72	R	95.2	Very high	96.5	Very high	175 Å²	175	93.9 Å²	93.9	66%	0.66	45%	0.452	S	S	*	.	H	α-helix	trans	-64.4	-46.2	175.4	-173.9	-177.7	-64.1	176	-0.4	111.3	Q68 I69 R70 K75 E76	Q68-R72 WeakPolarHBondContact O-CB 3.45Å; Q68-R72 PolarHBondContact O-N 2.94Å; I69-R72 WeakPolarHBondContact O-CB 3.33Å; I69-R72 PolarHBondContact O-N 3.4Å; R70-R72 VanDerWaalsContact C-N 3.28Å; R70-R72 PolarHBondContact O-N 2.99Å; R72-K75 PolarHBondContact O-N 3.07Å; R72-E76 WeakPolarHBondContact O-CB 3.49Å; R72-E76 PolarHBondContact O-N 3.02Å
73	Q	98	Very high	96.7	Very high	113 Å²	113	97.9 Å²	97.9	53%	0.528	48%	0.475	S	S	.	.	H	α-helix	trans	-62.8	-43.5	177.4	-70	173.3	-16.5	0	0	111.7	I69 R70 K75 E76 T77	I69-Q73 WeakPolarHBondContact O-CG 3.42Å; I69-Q73 PolarHBondContact O-N 3.33Å; R70-Q73 PolarHBondContact O-N 3Å; Q73-K75 PolarHBondContact O-N 3.17Å; Q73-E76 PolarHBondContact O-N 3.45Å; Q73-T77 WeakPolarHBondContact O-CG2 3.41Å; Q73-T77 PolarHBondContact O-N 3.48Å; Q73-T77 PolarHBondContact O-OG1 3.38Å
74	E	97.6	Very high	96.9	Very high	91 Å²	91	97.9 Å²	97.9	43%	0.425	47%	0.469	S	S	.	.	H	α-helix	trans	-61.6	-41.7	175.6	-71.7	167.7	-177	0	0	112.1	R70 E76 T77 L78	R70-E74 HydrophobicContact CG-CG 4.47Å; R70-E74 VanDerWaalsContact CG-OE1 3.25Å; R70-E74 WeakPolarHBondContact CG-OE1 3.41Å; R70-E74 IonicContact CZ-OE1 3.33Å; R70-E74 VanDerWaalsContact NH1-CD 3.34Å; R70-E74 IonicContact NH1-OE1 2.63Å; R70-E74 PolarHBondContact NH1-OE1 3.24Å; R70-E74 IonicContact NH1-OE2 2.72Å; R70-E74 PolarHBondContact NH1-OE2 3.07Å; R70-E74 WeakPolarHBondContact O-CG 3.47Å; R70-E74 PolarHBondContact O-N 3.03Å; E74-E76 VanDerWaalsContact C-N 3.34Å; E74-T77 PolarHBondContact O-OG1 3.39Å; E74-L78 WeakPolarHBondContact O-CB 3.36Å; E74-L78 PolarHBondContact O-N 2.96Å
75	K	96.9	Very high	97.1	Very high	114 Å²	114	97.6 Å²	97.6	50%	0.496	46%	0.463	S	S	.	.	H	α-helix	trans	-65.2	-38.8	174.9	-75.2	177.6	-180	-178.2	0	111.8	R71 R72 Q73 A79	R71-K75 WeakPolarHBondContact O-CB 3.39Å; R71-K75 VanDerWaalsContact O-CG 3.27Å; R71-K75 WeakPolarHBondContact O-CG 3.39Å; R71-K75 PolarHBondContact O-N 3.4Å; R72-K75 PolarHBondContact O-N 3.07Å; Q73-K75 PolarHBondContact O-N 3.17Å; K75-A79 WeakPolarHBondContact O-CB 3.38Å; K75-A79 PolarHBondContact O-N 3.47Å
76	E	98.3	Very high	97.3	Very high	90 Å²	90	98.8 Å²	98.8	42%	0.421	47%	0.47	S	S	.	.	H	α-helix	trans	-66.7	-46	178.2	-177.8	176.8	-170.6	0	0	112	R72 Q73 E74 L78 A79 R80	R72-E76 WeakPolarHBondContact O-CB 3.49Å; R72-E76 PolarHBondContact O-N 3.02Å; Q73-E76 PolarHBondContact O-N 3.45Å; E74-E76 VanDerWaalsContact C-N 3.34Å; E76-L78 VanDerWaalsContact C-N 3.3Å; E76-L78 PolarHBondContact O-N 2.96Å; E76-A79 PolarHBondContact O-N 3.07Å; E76-R80 VanDerWaalsContact O-CG 3.32Å; E76-R80 WeakPolarHBondContact O-CG 3.44Å; E76-R80 PolarHBondContact O-N 3.07Å; E76-R80 IonicContact OE1-CZ 3.45Å; E76-R80 IonicContact OE1-NE 3.35Å; E76-R80 PolarHBondContact OE1-NE 3.26Å; E76-R80 IonicContact OE1-NH2 3.87Å; E76-R80 PolarHBondContact OE1-NH2 3.38Å
77	T	98.6	Very high	97.5	Very high	88 Å²	88	92 Å²	92	54%	0.54	45%	0.445	S	S	.	.	H	α-helix	trans	-63.3	-39.6	177.3	56.9	0	0	0	0	111.4	Q73 E74 R81	Q73-T77 WeakPolarHBondContact O-CG2 3.41Å; Q73-T77 PolarHBondContact O-N 3.48Å; Q73-T77 PolarHBondContact O-OG1 3.38Å; E74-T77 PolarHBondContact O-OG1 3.39Å; T77-R81 PolarHBondContact O-N 3.14Å; T77-R81 VanDerWaalsContact O-N 3.07Å
78	L	98.4	Very high	97.7	Very high	102 Å²	102	95.9 Å²	95.9	53%	0.534	46%	0.456	S	S	.	.	H	α-helix	trans	-61.6	-48.3	173.6	179.9	61.1	0	0	0	111.7	E74 E76 R80 R81 I82	E74-L78 WeakPolarHBondContact O-CB 3.36Å; E74-L78 PolarHBondContact O-N 2.96Å; E76-L78 VanDerWaalsContact C-N 3.3Å; E76-L78 PolarHBondContact O-N 2.96Å; L78-R80 PolarHBondContact O-N 3.25Å; L78-R81 WeakPolarHBondContact O-CB 3.37Å; L78-R81 PolarHBondContact O-N 3.1Å; L78-I82 HydrophobicContact CD1-CD1 4.22Å; L78-I82 HydrophobicContact CD1-CG1 4.4Å; L78-I82 HydrophobicContact CG-CD1 4Å; L78-I82 WeakPolarHBondContact O-CG1 3.34Å; L78-I82 PolarHBondContact O-N 3.34Å
79	A	98.6	Very high	97.9	Very high	50 Å²	50	98.8 Å²	98.8	41%	0.413	48%	0.475	S	S	.	.	H	α-helix	trans	-60.6	-44.7	179.7	0	0	0	0	0	111.9	K75 E76 R81 I82 V83	K75-A79 WeakPolarHBondContact O-CB 3.38Å; K75-A79 PolarHBondContact O-N 3.47Å; E76-A79 PolarHBondContact O-N 3.07Å; A79-R81 VanDerWaalsContact C-N 3.29Å; A79-R81 PolarHBondContact O-N 3.27Å; A79-I82 PolarHBondContact O-N 2.95Å; A79-V83 WeakPolarHBondContact O-CG2 3.34Å; A79-V83 PolarHBondContact O-N 3.27Å
80	R	98.6	Very high	98	Very high	162 Å²	162	100 Å²	100	61%	0.611	48%	0.483	S	S	*	.	H	α-helix	trans	-58.1	-42.6	175.2	-71.1	174.6	-176	-170.2	0.4	111.7	E76 L78 V83 M84	E76-R80 VanDerWaalsContact O-CG 3.32Å; E76-R80 WeakPolarHBondContact O-CG 3.44Å; E76-R80 PolarHBondContact O-N 3.07Å; E76-R80 IonicContact OE1-CZ 3.45Å; E76-R80 IonicContact OE1-NE 3.35Å; E76-R80 PolarHBondContact OE1-NE 3.26Å; E76-R80 IonicContact OE1-NH2 3.87Å; E76-R80 PolarHBondContact OE1-NH2 3.38Å; L78-R80 PolarHBondContact O-N 3.25Å; R80-V83 PolarHBondContact O-N 3.07Å; R80-M84 WeakPolarHBondContact O-CB 3.32Å; R80-M84 PolarHBondContact O-N 2.73Å
81	R	98.7	Very high	98.1	Very high	160 Å²	160	99.4 Å²	99.4	60%	0.604	49%	0.485	S	S	*	.	H	α-helix	trans	-65.1	-42.9	178.2	-175.5	175.6	-177.6	-179	0.4	112.2	T77 L78 A79 V83 M84 L85	T77-R81 PolarHBondContact O-N 3.14Å; T77-R81 VanDerWaalsContact O-N 3.07Å; L78-R81 WeakPolarHBondContact O-CB 3.37Å; L78-R81 PolarHBondContact O-N 3.1Å; A79-R81 VanDerWaalsContact C-N 3.29Å; A79-R81 PolarHBondContact O-N 3.27Å; R81-V83 VanDerWaalsContact C-N 3.34Å; R81-M84 HydrophobicContact CG-CE 4.17Å; R81-M84 PolarHBondContact O-N 2.63Å; R81-L85 HydrophobicContact CG-CD1 3.97Å; R81-L85 HydrophobicContact CG-CG 4.35Å; R81-L85 WeakPolarHBondContact O-CG 3.23Å; R81-L85 PolarHBondContact O-N 3.27Å
82	I	98.6	Very high	98.3	Very high	85 Å²	85	99.1 Å²	99.1	44%	0.436	50%	0.497	S	S	.	.	H	α-helix	trans	-59.5	-47.9	177.5	-68.7	166.2	0	0	0	110.3	L78 A79 M84 L85 N86	L78-I82 HydrophobicContact CD1-CD1 4.22Å; L78-I82 HydrophobicContact CD1-CG1 4.4Å; L78-I82 HydrophobicContact CG-CD1 4Å; L78-I82 WeakPolarHBondContact O-CG1 3.34Å; L78-I82 PolarHBondContact O-N 3.34Å; A79-I82 PolarHBondContact O-N 2.95Å; I82-M84 PolarHBondContact O-N 3.46Å; I82-L85 PolarHBondContact O-N 2.94Å; I82-N86 WeakPolarHBondContact O-CB 3.44Å; I82-N86 PolarHBondContact O-N 2.93Å
83	V	98.7	Very high	98.4	Very high	100 Å²	100	94.4 Å²	94.4	61%	0.606	49%	0.487	S	S	*	.	H	α-helix	trans	-61.1	-45.9	179.2	173	0	0	0	0	111.4	A79 R80 R81 N86 S87	A79-V83 WeakPolarHBondContact O-CG2 3.34Å; A79-V83 PolarHBondContact O-N 3.27Å; R80-V83 PolarHBondContact O-N 3.07Å; R81-V83 VanDerWaalsContact C-N 3.34Å; V83-N86 PolarHBondContact O-N 2.93Å; V83-S87 PolarHBondContact O-N 3.17Å; V83-S87 PolarHBondContact O-OG 3.19Å
84	M	98.6	Very high	98.4	Very high	80 Å²	80	93.5 Å²	93.5	39%	0.394	48%	0.483	S	S	.	.	H	α-helix	trans	-59	-50.6	177.5	170.8	-90.9	-74.6	0	0	111.6	R80 R81 I82 N86 S87 E88	R80-M84 WeakPolarHBondContact O-CB 3.32Å; R80-M84 PolarHBondContact O-N 2.73Å; R81-M84 HydrophobicContact CG-CE 4.17Å; R81-M84 PolarHBondContact O-N 2.63Å; I82-M84 PolarHBondContact O-N 3.46Å; M84-N86 VanDerWaalsContact C-N 3.32Å; M84-N86 PolarHBondContact O-N 3.01Å; M84-S87 PolarHBondContact O-N 3.45Å; M84-S87 VanDerWaalsContact O-N 3.12Å; M84-S87 PolarHBondContact O-OG 3.29Å; M84-E88 PolarHBondContact O-N 2.92Å; M84-E88 HydrophobicContact SD-CG 4.38Å; M84-E88 VanDerWaalsContact SD-OE1 3.37Å
85	L	98.8	Very high	98.5	Very high	72 Å²	72	92 Å²	92	38%	0.377	49%	0.486	S	S	.	.	H	α-helix	trans	-62.5	-39.5	-179.4	-70.2	173.1	0	0	0	112.3	R81 I82 S87 E88 V89	R81-L85 HydrophobicContact CG-CD1 3.97Å; R81-L85 HydrophobicContact CG-CG 4.35Å; R81-L85 WeakPolarHBondContact O-CG 3.23Å; R81-L85 PolarHBondContact O-N 3.27Å; I82-L85 PolarHBondContact O-N 2.94Å; L85-S87 VanDerWaalsContact C-N 3.34Å; L85-S87 PolarHBondContact O-N 3.06Å; L85-E88 PolarHBondContact O-N 3.44Å; L85-V89 WeakPolarHBondContact O-CG2 3.49Å; L85-V89 PolarHBondContact O-N 3.23Å; L85-V89 VanDerWaalsContact O-N 3.07Å
86	N	98.6	Very high	98.6	Very high	94 Å²	94	93.7 Å²	93.7	50%	0.503	49%	0.49	S	S	.	.	H	α-helix	trans	-60.7	-45.3	174.9	-74.8	-12.1	0	0	0	111.1	I82 V83 M84 E88 V89 D90	I82-N86 WeakPolarHBondContact O-CB 3.44Å; I82-N86 PolarHBondContact O-N 2.93Å; V83-N86 PolarHBondContact O-N 2.93Å; M84-N86 VanDerWaalsContact C-N 3.32Å; M84-N86 PolarHBondContact O-N 3.01Å; N86-E88 VanDerWaalsContact C-N 3.33Å; N86-E88 PolarHBondContact O-N 3.06Å; N86-V89 PolarHBondContact O-N 2.87Å; N86-D90 VanDerWaalsContact O-CG 3.28Å; N86-D90 PolarHBondContact O-N 3.04Å
87	S	98.5	Very high	98.6	Very high	46 Å²	46	93.8 Å²	93.8	32%	0.322	49%	0.493	S	S	.	.	H	α-helix	trans	-63.3	-37.4	178.1	67.9	0	0	0	0	113	V83 M84 L85 D90 H91	V83-S87 PolarHBondContact O-N 3.17Å; V83-S87 PolarHBondContact O-OG 3.19Å; M84-S87 PolarHBondContact O-N 3.45Å; M84-S87 VanDerWaalsContact O-N 3.12Å; M84-S87 PolarHBondContact O-OG 3.29Å; L85-S87 VanDerWaalsContact C-N 3.34Å; L85-S87 PolarHBondContact O-N 3.06Å; S87-D90 PolarHBondContact O-N 3.35Å; S87-H91 WeakPolarHBondContact O-CB 3.35Å; S87-H91 PolarHBondContact O-CD2 2.9Å; S87-H91 VanDerWaalsContact O-CG 3.27Å; S87-H91 PolarHBondContact O-N 3.48Å
88	E	98.6	Very high	98.6	Very high	113 Å²	113	95.4 Å²	95.4	53%	0.528	49%	0.493	S	S	.	.	H	α-helix	trans	-64.3	-41.5	176	-71.4	-178.7	172.8	0	0	111.8	M84 L85 N86 G92	M84-E88 PolarHBondContact O-N 2.92Å; M84-E88 HydrophobicContact SD-CG 4.38Å; M84-E88 VanDerWaalsContact SD-OE1 3.37Å; L85-E88 PolarHBondContact O-N 3.44Å; N86-E88 VanDerWaalsContact C-N 3.33Å; N86-E88 PolarHBondContact O-N 3.06Å; E88-G92 PolarHBondContact O-N 3.14Å
89	V	98.7	Very high	98.5	Very high	92 Å²	92	97.1 Å²	97.1	56%	0.558	50%	0.496	S	S	*	.	H	α-helix	trans	-63	-48.1	175.7	171.8	0	0	0	0	110.5	L85 N86 H91 G92 V93	L85-V89 WeakPolarHBondContact O-CG2 3.49Å; L85-V89 PolarHBondContact O-N 3.23Å; L85-V89 VanDerWaalsContact O-N 3.07Å; N86-V89 PolarHBondContact O-N 2.87Å; V89-H91 PolarHBondContact O-N 3Å; V89-G92 PolarHBondContact O-N 3.34Å; V89-G92 VanDerWaalsContact O-N 3.14Å; V89-V93 WeakPolarHBondContact O-CG2 3.5Å; V89-V93 PolarHBondContact O-N 2.98Å
90	D	98.6	Very high	98.5	Very high	96 Å²	96	99.2 Å²	99.2	51%	0.513	50%	0.497	S	S	.	.	H	α-helix	trans	-59.5	-47.8	179.6	-68.9	-24.2	0	0	0	111.1	N86 S87 G92 V93 E94	N86-D90 VanDerWaalsContact O-CG 3.28Å; N86-D90 PolarHBondContact O-N 3.04Å; S87-D90 PolarHBondContact O-N 3.35Å; D90-G92 VanDerWaalsContact C-N 3.31Å; D90-G92 PolarHBondContact O-N 3.44Å; D90-V93 PolarHBondContact O-N 3.23Å; D90-E94 WeakPolarHBondContact O-CG 3.38Å; D90-E94 PolarHBondContact O-N 3.21Å
91	H	98.6	Very high	98.5	Very high	117 Å²	117	94.1 Å²	94.1	54%	0.542	48%	0.48	S	S	.	.	H	α-helix	trans	-60.7	-39.1	175.3	-72.4	-45.1	0	0	0	112.7	S87 V89 E94 A95	S87-H91 WeakPolarHBondContact O-CB 3.35Å; S87-H91 PolarHBondContact O-CD2 2.9Å; S87-H91 VanDerWaalsContact O-CG 3.27Å; S87-H91 PolarHBondContact O-N 3.48Å; V89-H91 PolarHBondContact O-N 3Å; H91-E94 PolarHBondContact O-N 3.4Å; H91-A95 WeakPolarHBondContact O-CB 3.49Å; H91-A95 PolarHBondContact O-N 3.02Å
92	G	98.4	Very high	98.4	Very high	42 Å²	42	92.5 Å²	92.5	43%	0.433	48%	0.479	S	S	.	.	H	α-helix	trans	-62.1	-43.8	175.6	0	0	0	0	0	112.5	E88 V89 D90 A95 W96	E88-G92 PolarHBondContact O-N 3.14Å; V89-G92 PolarHBondContact O-N 3.34Å; V89-G92 VanDerWaalsContact O-N 3.14Å; D90-G92 VanDerWaalsContact C-N 3.31Å; D90-G92 PolarHBondContact O-N 3.44Å; G92-A95 PolarHBondContact O-N 3.32Å; G92-W96 WeakPolarHBondContact O-CB 3.43Å; G92-W96 PolarHBondContact O-N 3.2Å
93	V	98.5	Very high	98.4	Very high	75 Å²	75	90.7 Å²	90.7	46%	0.455	48%	0.477	S	S	.	.	H	α-helix	trans	-64.5	-45.2	176.6	172.5	0	0	0	0	110.9	V89 D90 W96 N97	V89-V93 WeakPolarHBondContact O-CG2 3.5Å; V89-V93 PolarHBondContact O-N 2.98Å; D90-V93 PolarHBondContact O-N 3.23Å; V93-W96 PolarHBondContact O-N 2.98Å; V93-N97 WeakPolarHBondContact O-CB 3.43Å; V93-N97 PolarHBondContact O-N 3.48Å; V93-N97 PolarHBondContact O-ND2 3.17Å
94	E	98.4	Very high	98.3	Very high	95 Å²	95	92.2 Å²	92.2	44%	0.444	47%	0.472	S	S	.	.	H	α-helix	trans	-60.7	-46.8	177	-74.5	-176	-172.2	0	0	112.5	D90 H91 W96 N97 K98	D90-E94 WeakPolarHBondContact O-CG 3.38Å; D90-E94 PolarHBondContact O-N 3.21Å; H91-E94 PolarHBondContact O-N 3.4Å; E94-W96 VanDerWaalsContact C-N 3.32Å; E94-W96 PolarHBondContact O-N 2.92Å; E94-N97 PolarHBondContact O-N 3.18Å; E94-K98 VanDerWaalsContact O-CG 3.29Å; E94-K98 WeakPolarHBondContact O-CG 3.41Å; E94-K98 PolarHBondContact O-N 3.23Å; E94-K98 IonicContact OE2-NZ 3.33Å
95	A	98.5	Very high	98.3	Very high	58 Å²	58	95.4 Å²	95.4	48%	0.479	48%	0.48	S	S	.	.	H	α-helix	trans	-62.5	-41.3	179.1	0	0	0	0	0	111.4	H91 G92 K98 K99	H91-A95 WeakPolarHBondContact O-CB 3.49Å; H91-A95 PolarHBondContact O-N 3.02Å; G92-A95 PolarHBondContact O-N 3.32Å; A95-K98 PolarHBondContact O-N 2.85Å; A95-K99 WeakPolarHBondContact O-CB 3.43Å; A95-K99 PolarHBondContact O-N 3.32Å
96	W	98.5	Very high	98.2	Very high	151 Å²	151	94.9 Å²	94.9	57%	0.572	49%	0.486	S	S	*	.	H	α-helix	trans	-60.9	-47.8	175.1	179.3	-97.2	0	0	0	111.9	G92 V93 E94 K98 K99 Q100	G92-W96 WeakPolarHBondContact O-CB 3.43Å; G92-W96 PolarHBondContact O-N 3.2Å; V93-W96 PolarHBondContact O-N 2.98Å; E94-W96 VanDerWaalsContact C-N 3.32Å; E94-W96 PolarHBondContact O-N 2.92Å; W96-K98 PolarHBondContact O-N 2.83Å; W96-K99 PolarHBondContact O-N 2.93Å; W96-Q100 WeakPolarHBondContact O-CG 3.49Å; W96-Q100 PolarHBondContact O-N 3.37Å
97	N	98.3	Very high	98.1	Very high	92 Å²	92	95.1 Å²	95.1	49%	0.492	48%	0.484	S	S	.	.	H	α-helix	trans	-62.5	-42.9	179.7	-70.1	-21.2	0	0	0	111.9	V93 E94 K99 Q100 E101	V93-N97 WeakPolarHBondContact O-CB 3.43Å; V93-N97 PolarHBondContact O-N 3.48Å; V93-N97 PolarHBondContact O-ND2 3.17Å; E94-N97 PolarHBondContact O-N 3.18Å; N97-K99 VanDerWaalsContact C-N 3.35Å; N97-K99 PolarHBondContact O-N 3.48Å; N97-Q100 PolarHBondContact O-N 3.29Å; N97-E101 WeakPolarHBondContact O-CB 3.44Å; N97-E101 PolarHBondContact O-N 2.96Å
98	K	98.4	Very high	98	Very high	122 Å²	122	97.8 Å²	97.8	53%	0.53	49%	0.491	S	S	.	.	H	α-helix	trans	-59	-45.9	174.8	-72.8	169.2	-172.9	166.3	0	111.3	E94 A95 W96 Q100 E101 E102	E94-K98 VanDerWaalsContact O-CG 3.29Å; E94-K98 WeakPolarHBondContact O-CG 3.41Å; E94-K98 PolarHBondContact O-N 3.23Å; E94-K98 IonicContact OE2-NZ 3.33Å; A95-K98 PolarHBondContact O-N 2.85Å; W96-K98 PolarHBondContact O-N 2.83Å; K98-Q100 PolarHBondContact O-N 3Å; K98-E101 PolarHBondContact O-N 2.73Å; K98-E102 WeakPolarHBondContact O-CB 3.19Å; K98-E102 WeakPolarHBondContact O-CG 3.43Å; K98-E102 PolarHBondContact O-N 3.34Å
99	K	98.3	Very high	97.9	Very high	137 Å²	137	97.9 Å²	97.9	60%	0.596	49%	0.491	S	S	*	.	H	α-helix	trans	-61.7	-41.2	178.3	-172.4	179	-177.9	179.2	0	112.6	A95 W96 N97 A103	A95-K99 WeakPolarHBondContact O-CB 3.43Å; A95-K99 PolarHBondContact O-N 3.32Å; W96-K99 PolarHBondContact O-N 2.93Å; N97-K99 VanDerWaalsContact C-N 3.35Å; N97-K99 PolarHBondContact O-N 3.48Å; K99-A103 WeakPolarHBondContact O-CB 3.46Å; K99-A103 PolarHBondContact O-N 3.32Å
100	Q	98	Very high	97.8	Very high	95 Å²	95	101.3 Å²	101.3	44%	0.444	49%	0.494	S	S	.	.	H	α-helix	trans	-64.5	-43.3	176.5	-70.9	-63.3	-24.2	0	0	111.6	W96 N97 K98 A103 R104	W96-Q100 WeakPolarHBondContact O-CG 3.49Å; W96-Q100 PolarHBondContact O-N 3.37Å; N97-Q100 PolarHBondContact O-N 3.29Å; K98-Q100 PolarHBondContact O-N 3Å; Q100-A103 PolarHBondContact O-N 2.87Å; Q100-R104 PolarHBondContact O-N 3.33Å
101	E	97.8	Very high	97.6	Very high	55 Å²	55	102.6 Å²	102.6	26%	0.257	50%	0.495	S	S	.	.	H	α-helix	trans	-65	-43.8	178.1	-176	58.8	-155.5	0	0	111.8	N97 K98 R104 R105	N97-E101 WeakPolarHBondContact O-CB 3.44Å; N97-E101 PolarHBondContact O-N 2.96Å; K98-E101 PolarHBondContact O-N 2.73Å; E101-R104 PolarHBondContact O-N 3.45Å; E101-R104 IonicContact OE1-CZ 2.84Å; E101-R104 IonicContact OE1-NE 3.95Å; E101-R104 IonicContact OE1-NH2 2.77Å; E101-R104 PolarHBondContact OE1-NH2 3.39Å; E101-R104 IonicContact OE2-CZ 2.73Å; E101-R104 IonicContact OE2-NE 3.83Å; E101-R104 IonicContact OE2-NH1 3.56Å; E101-R104 IonicContact OE2-NH2 2.98Å; E101-R104 PolarHBondContact OE2-NH2 3.43Å; E101-R105 WeakPolarHBondContact O-CB 3.34Å; E101-R105 VanDerWaalsContact O-CG 3.28Å; E101-R105 WeakPolarHBondContact O-CG 3.5Å; E101-R105 PolarHBondContact O-N 3.37Å; E101-R105 IonicContact OE1-CZ 3.93Å; E101-R105 IonicContact OE1-NE 3.37Å; E101-R105 PolarHBondContact OE1-NE 3.4Å; E101-R105 IonicContact OE1-NH2 3.6Å; E101-R105 PolarHBondContact OE1-NH2 2.67Å
102	E	97.9	Very high	97.3	Very high	125 Å²	125	101.3 Å²	101.3	58%	0.584	50%	0.499	S	S	*	.	H	α-helix	trans	-61.7	-42.7	174.8	-74.5	171.5	-172.4	0	0	111.9	K98 R105 A106	K98-E102 WeakPolarHBondContact O-CB 3.19Å; K98-E102 WeakPolarHBondContact O-CG 3.43Å; K98-E102 PolarHBondContact O-N 3.34Å; E102-R105 PolarHBondContact O-N 3.28Å; E102-A106 VanDerWaalsContact O-CB 3.27Å; E102-A106 WeakPolarHBondContact O-CB 3.27Å; E102-A106 PolarHBondContact O-N 3.29Å
103	A	97.6	Very high	97.2	Very high	48 Å²	48	105 Å²	105	40%	0.397	51%	0.508	S	S	.	.	H	α-helix	trans	-61.4	-44.7	175.8	0	0	0	0	0	111.5	K99 Q100 A106 E107	K99-A103 WeakPolarHBondContact O-CB 3.46Å; K99-A103 PolarHBondContact O-N 3.32Å; Q100-A103 PolarHBondContact O-N 2.87Å; A103-A106 PolarHBondContact O-N 3.05Å; A103-E107 WeakPolarHBondContact O-CG 3.39Å; A103-E107 PolarHBondContact O-N 3.12Å
104	R	97.3	Very high	96.9	Very high	131 Å²	131	107.1 Å²	107.1	49%	0.494	52%	0.517	S	S	.	.	H	α-helix	trans	-60.8	-47.3	175.9	-172	-179.8	70	179.5	2	111.5	Q100 E101 A106 E107 E108	Q100-R104 PolarHBondContact O-N 3.33Å; E101-R104 PolarHBondContact O-N 3.45Å; E101-R104 IonicContact OE1-CZ 2.84Å; E101-R104 IonicContact OE1-NE 3.95Å; E101-R104 IonicContact OE1-NH2 2.77Å; E101-R104 PolarHBondContact OE1-NH2 3.39Å; E101-R104 IonicContact OE2-CZ 2.73Å; E101-R104 IonicContact OE2-NE 3.83Å; E101-R104 IonicContact OE2-NH1 3.56Å; E101-R104 IonicContact OE2-NH2 2.98Å; E101-R104 PolarHBondContact OE2-NH2 3.43Å; R104-A106 VanDerWaalsContact C-N 3.35Å; R104-A106 PolarHBondContact O-N 2.92Å; R104-E107 WeakPolarHBondContact O-CB 3.38Å; R104-E107 PolarHBondContact O-N 3.42Å; R104-E108 IonicContact NE-OE1 3.46Å; R104-E108 WeakPolarHBondContact O-CG 3.19Å; R104-E108 PolarHBondContact O-N 3.25Å
105	R	97.1	Very high	96.5	Very high	148 Å²	148	110.5 Å²	110.5	56%	0.558	54%	0.537	S	S	*	.	H	α-helix	trans	-62.3	-41.2	177.4	-71.7	176.2	-170.5	-179.9	3.3	112.1	E101 E102 E107 E108 H109	E101-R105 WeakPolarHBondContact O-CB 3.34Å; E101-R105 VanDerWaalsContact O-CG 3.28Å; E101-R105 WeakPolarHBondContact O-CG 3.5Å; E101-R105 PolarHBondContact O-N 3.37Å; E101-R105 IonicContact OE1-CZ 3.93Å; E101-R105 IonicContact OE1-NE 3.37Å; E101-R105 PolarHBondContact OE1-NE 3.4Å; E101-R105 IonicContact OE1-NH2 3.6Å; E101-R105 PolarHBondContact OE1-NH2 2.67Å; E102-R105 PolarHBondContact O-N 3.28Å; R105-E107 VanDerWaalsContact C-N 3.34Å; R105-E108 PolarHBondContact O-N 3.08Å; R105-H109 VanDerWaalsContact O-CB 3.23Å; R105-H109 WeakPolarHBondContact O-CB 3.25Å; R105-H109 PolarHBondContact O-N 3.19Å
106	A	96.9	Very high	96	Very high	60 Å²	60	116.6 Å²	116.6	50%	0.496	55%	0.552	S	S	.	*	H	α-helix	trans	-64.9	-38.7	176.7	0	0	0	0	0	111.6	E102 A103 R104 R110	E102-A106 VanDerWaalsContact O-CB 3.27Å; E102-A106 WeakPolarHBondContact O-CB 3.27Å; E102-A106 PolarHBondContact O-N 3.29Å; A103-A106 PolarHBondContact O-N 3.05Å; R104-A106 VanDerWaalsContact C-N 3.35Å; R104-A106 PolarHBondContact O-N 2.92Å; A106-R110 VanDerWaalsContact O-CB 3.25Å; A106-R110 WeakPolarHBondContact O-CB 3.43Å; A106-R110 PolarHBondContact O-N 3.16Å
107	E	96.8	Very high	95.6	Very high	99 Å²	99	113.2 Å²	113.2	46%	0.463	55%	0.55	S	S	.	*	H	α-helix	trans	-65.4	-44.6	173.3	-77.3	-168.4	-178.1	0	0	112.8	A103 R104 R105 R110 K111	A103-E107 WeakPolarHBondContact O-CG 3.39Å; A103-E107 PolarHBondContact O-N 3.12Å; R104-E107 WeakPolarHBondContact O-CB 3.38Å; R104-E107 PolarHBondContact O-N 3.42Å; R105-E107 VanDerWaalsContact C-N 3.34Å; E107-R110 PolarHBondContact O-N 3.42Å; E107-K111 WeakPolarHBondContact O-CB 3.18Å; E107-K111 VanDerWaalsContact O-CG 3.28Å; E107-K111 WeakPolarHBondContact O-CG 3.29Å; E107-K111 PolarHBondContact O-N 3.1Å; E107-K111 IonicContact OE2-NZ 3.98Å
108	E	96.4	Very high	95	Very high	102 Å²	102	117.5 Å²	117.5	48%	0.477	56%	0.564	S	S	.	*	H	α-helix	trans	-61.1	-46.6	175.9	-73.6	170.4	-175.5	0	0	111	R104 R105 R110 K111 S112	R104-E108 IonicContact NE-OE1 3.46Å; R104-E108 WeakPolarHBondContact O-CG 3.19Å; R104-E108 PolarHBondContact O-N 3.25Å; R105-E108 PolarHBondContact O-N 3.08Å; E108-R110 VanDerWaalsContact C-N 3.34Å; E108-R110 PolarHBondContact O-N 3.03Å; E108-K111 WeakPolarHBondContact O-CB 3.23Å; E108-K111 PolarHBondContact O-N 3.33Å; E108-K111 VanDerWaalsContact O-N 3.16Å; E108-S112 PolarHBondContact O-N 3.19Å; E108-S112 PolarHBondContact O-OG 3.49Å
109	H	96.8	Very high	94.4	Very high	115 Å²	115	114.1 Å²	114.1	53%	0.532	56%	0.564	S	S	.	*	H	α-helix	trans	-59.7	-44.2	174.6	-179.1	-105.1	0	0	0	111.5	R105 K111 S112 L113	R105-H109 VanDerWaalsContact O-CB 3.23Å; R105-H109 WeakPolarHBondContact O-CB 3.25Å; R105-H109 PolarHBondContact O-N 3.19Å; H109-K111 VanDerWaalsContact C-N 3.32Å; H109-K111 PolarHBondContact O-N 2.99Å; H109-S112 WeakPolarHBondContact CA-OG 3.41Å; H109-S112 PolarHBondContact O-N 2.76Å; H109-S112 PolarHBondContact O-OG 3.17Å; H109-L113 VanDerWaalsContact CE1-CD1 3.45Å; H109-L113 WeakPolarHBondContact CE1-CD1 3.43Å; H109-L113 WeakPolarHBondContact O-CG 3.25Å; H109-L113 PolarHBondContact O-N 2.72Å; H109-L113 VanDerWaalsContact O-N 3.13Å
110	R	96.1	Very high	93.5	Very high	165 Å²	165	116.3 Å²	116.3	62%	0.623	57%	0.574	S	S	*	*	H	α-helix	trans	-60.5	-42.8	175.2	-173.6	173.1	72.6	117.7	-4.2	111.3	A106 E107 E108 L113 L114	A106-R110 VanDerWaalsContact O-CB 3.25Å; A106-R110 WeakPolarHBondContact O-CB 3.43Å; A106-R110 PolarHBondContact O-N 3.16Å; E107-R110 PolarHBondContact O-N 3.42Å; E108-R110 VanDerWaalsContact C-N 3.34Å; E108-R110 PolarHBondContact O-N 3.03Å; R110-L113 PolarHBondContact O-N 3.43Å; R110-L114 PolarHBondContact O-N 2.93Å
111	K	94.1	Very high	92.5	Very high	123 Å²	123	117.6 Å²	117.6	54%	0.535	58%	0.583	S	S	.	*	H	α-helix	trans	-64.5	-40.1	176.8	-72.9	168.4	-171.3	165.9	0	111.7	E107 E108 H109 L113 L114	E107-K111 WeakPolarHBondContact O-CB 3.18Å; E107-K111 VanDerWaalsContact O-CG 3.28Å; E107-K111 WeakPolarHBondContact O-CG 3.29Å; E107-K111 PolarHBondContact O-N 3.1Å; E107-K111 IonicContact OE2-NZ 3.98Å; E108-K111 WeakPolarHBondContact O-CB 3.23Å; E108-K111 PolarHBondContact O-N 3.33Å; E108-K111 VanDerWaalsContact O-N 3.16Å; H109-K111 VanDerWaalsContact C-N 3.32Å; H109-K111 PolarHBondContact O-N 2.99Å; K111-L113 VanDerWaalsContact C-N 3.26Å; K111-L113 PolarHBondContact O-N 3.21Å; K111-L114 WeakPolarHBondContact O-CB 3.42Å; K111-L114 PolarHBondContact O-N 3.43Å
112	S	93.8	Very high	91.3	Very high	89 Å²	89	120.3 Å²	120.3	62%	0.622	60%	0.598	S	S	*	*	H	α-helix	trans	-66.7	-27.8	178.2	61	0	0	0	0	113.4	E108 H109 L114	E108-S112 PolarHBondContact O-N 3.19Å; E108-S112 PolarHBondContact O-OG 3.49Å; H109-S112 WeakPolarHBondContact CA-OG 3.41Å; H109-S112 PolarHBondContact O-N 2.76Å; H109-S112 PolarHBondContact O-OG 3.17Å; S112-L114 VanDerWaalsContact C-N 3.32Å
113	L	94.8	Very high	90.1	Very high	119 Å²	119	118.9 Å²	118.9	62%	0.623	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.3	-10.9	176.1	-67.2	175.7	0	0	0	113.5	H109 R110 K111	H109-L113 VanDerWaalsContact CE1-CD1 3.45Å; H109-L113 WeakPolarHBondContact CE1-CD1 3.43Å; H109-L113 WeakPolarHBondContact O-CG 3.25Å; H109-L113 PolarHBondContact O-N 2.72Å; H109-L113 VanDerWaalsContact O-N 3.13Å; R110-L113 PolarHBondContact O-N 3.43Å; K111-L113 VanDerWaalsContact C-N 3.26Å; K111-L113 PolarHBondContact O-N 3.21Å
114	L	93.3	Very high	88.6	Confident	121 Å²	121	125.1 Å²	125.1	63%	0.634	62%	0.616	S	S	*	*	S	Bend	trans	-67.2	138.2	179.1	-67.8	174.5	0	0	0	111	R110 K111 S112	R110-L114 PolarHBondContact O-N 2.93Å; K111-L114 WeakPolarHBondContact O-CB 3.42Å; K111-L114 PolarHBondContact O-N 3.43Å; S112-L114 VanDerWaalsContact C-N 3.32Å
115	L	89.5	Confident	86.8	Confident	165 Å²	165	128.2 Å²	128.2	86%	0.864	63%	0.634	S	S	*	*	P	Polyproline II helix	trans	-66.6	154.4	172.8	-64.3	175.1	0	0	0	110.9
116	K	88.8	Confident	84.8	Confident	186 Å²	186	126 Å²	126	81%	0.809	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-55.1	136.7	174.7	-68.7	-178	179.6	176.9	0	110.4
117	P	89.5	Confident	83	Confident	81 Å²	81	133 Å²	133	53%	0.526	66%	0.66	S	S	.	*	P	Polyproline II helix	trans	-64.6	140.4	179	26.7	-33.7	0	0	0	110.8	L121	P117-L121 HydrophobicContact CB-CB 4.35Å; P117-L121 HydrophobicContact CB-CD1 3.8Å
118	K	85.6	Confident	80.6	Confident	182 Å²	182	137 Å²	137	79%	0.791	70%	0.699	S	S	*	*			trans	-118	167.1	178.9	-64.2	-167.4	179.5	-176.3	0	112
119	G	85.7	Confident	79.8	Confident	50 Å²	50	138.8 Å²	138.8	52%	0.515	71%	0.71	S	S	.	*	G	3₁₀ helix	trans	77.5	-137.8	170	0	0	0	0	0	114.6	L121 L122	G119-L121 PolarHBondContact O-N 2.97Å; G119-L122 PolarHBondContact O-N 3.19Å
120	K	79.9	Confident	78.9	Confident	184 Å²	184	140.1 Å²	140.1	80%	0.8	72%	0.72	S	S	*	*	G	3₁₀ helix	trans	-57.9	-14.6	-174.9	-66.2	-174.8	179.4	-178.1	0	114.8	L122 T123	K120-L122 VanDerWaalsContact C-N 3.33Å; K120-T123 PolarHBondContact O-OG1 3.45Å; K120-T123 VanDerWaalsContact O-OG1 3.13Å
121	L	76.9	Confident	78	Confident	122 Å²	122	138.7 Å²	138.7	64%	0.639	73%	0.725	S	S	*	*	G	3₁₀ helix	trans	-73.2	-23.3	174.7	-73.6	166.3	0	0	0	112.9	P117 G119	P117-L121 HydrophobicContact CB-CB 4.35Å; P117-L121 HydrophobicContact CB-CD1 3.8Å; G119-L121 PolarHBondContact O-N 2.97Å
122	L	72.6	Confident	77	Confident	111 Å²	111	139.6 Å²	139.6	58%	0.581	74%	0.736	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.4	-29.8	178.2	-63	173.6	0	0	0	112.6	G119 K120 K124	G119-L122 PolarHBondContact O-N 3.19Å; K120-L122 VanDerWaalsContact C-N 3.33Å; L122-K124 VanDerWaalsContact C-N 3.28Å; L122-K124 PolarHBondContact O-N 3.18Å
123	T	73.7	Confident	76	Confident	96 Å²	96	142.8 Å²	142.8	59%	0.589	74%	0.743	S	S	*	*	G	3₁₀ helix	trans	-76.1	-9.9	-173.8	56.5	0	0	0	0	114.4	K120 K125	K120-T123 PolarHBondContact O-OG1 3.45Å; K120-T123 VanDerWaalsContact O-OG1 3.13Å; T123-K125 VanDerWaalsContact C-N 3.34Å
124	K	64.6	Low	74.7	Confident	178 Å²	178	144.3 Å²	144.3	77%	0.774	75%	0.751	S	S	*	*	G	3₁₀ helix	trans	-78.7	-12.1	178	-70.5	-172.2	178.1	-174.7	0	114.2	L122	L122-K124 VanDerWaalsContact C-N 3.28Å; L122-K124 PolarHBondContact O-N 3.18Å
125	K	59.9	Low	73.4	Confident	197 Å²	197	146 Å²	146	86%	0.857	76%	0.76	S	S	*	*	G	3₁₀ helix	trans	-88.8	-6.8	-174.6	-86.8	-171.1	173.8	-174.9	0	115.6	T123	T123-K125 VanDerWaalsContact C-N 3.34Å
126	S	55.1	Low	72.2	Confident	102 Å²	102	144.5 Å²	144.5	71%	0.713	75%	0.752	S	S	*	*			trans	-100.1	22.1	-170.6	67.2	0	0	0	0	115.6
127	K	58.2	Low	70.8	Confident	207 Å²	207	141.1 Å²	141.1	90%	0.9	75%	0.747	S	S	*	*			trans	-113.5	72.9	170.4	-74.1	-171.2	178.4	-175.7	0	110.1
128	S	47.9	Very low	69.1	Low	183 Å²	183	146.5 Å²	146.5	100%	1.28	77%	0.767	S	S	*	*			trans	-164	0	153.5	-177	0	0	0	0	109

Retrieved 128 of 128 residues in 32.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).