A0A087XVD3_POEFO Loading...

Protein S100

AlphaFold DB , UniProt , Accession A0A087XVD3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 111 aa.

						>A0A087XVD3_POEFO|A0A087XVD3
MSKEPSSNLESAMQMLIKTFHKYSGKEGDKYTLSRGELKELLTEELGSYLGNSKDNEAVEKVMNDLDANNDGEVDFTEFIILMGALTVACNDFFLDSKPDDKGKDGAEKKD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.3	Very low	72.3	Confident	242 Å²	242	118.6 Å²	118.6	100%	1.192	64%	0.641	S	S	*	*				0	94.9	0	-84.8	170.1	153.6	0	0	107.4	K3	M1-K3 PolarHBondContact O-N 3.4Å
2	S	47.8	Very low	73.9	Confident	119 Å²	119	111.9 Å²	111.9	83%	0.832	61%	0.614	S	S	*	*			trans	-83.9	100.8	172.9	-44.9	0	0	0	0	106.2	E4	S2-E4 PolarHBondContact O-N 2.94Å
3	K	56.1	Low	75.4	Confident	192 Å²	192	112.5 Å²	112.5	84%	0.835	61%	0.612	S	S	*	*			trans	-70.6	109.3	165.1	-84.4	-177.3	174.7	-180	0	105.9	M1	M1-K3 PolarHBondContact O-N 3.4Å
4	E	64	Low	76.7	Confident	162 Å²	162	109.1 Å²	109.1	76%	0.757	59%	0.59	S	S	*	*			trans	-43.1	133.6	159.7	-67.9	-71	140	0	0	108.4	S2 S6	S2-E4 PolarHBondContact O-N 2.94Å; E4-S6 PolarHBondContact O-N 2.92Å
5	P	56.8	Low	77.9	Confident	46 Å²	46	109.7 Å²	109.7	30%	0.299	59%	0.589	S	S	.	*			trans	-58.6	127.8	-178.5	22.7	-31	0	0	0	109.6	S7 E10 S11	P5-S7 VanDerWaalsContact C-N 3.28Å; P5-S7 PolarHBondContact O-N 3.49Å; P5-E10 HydrophobicContact CB-CB 4.38Å; P5-S11 WeakPolarHBondContact CB-OG 3.44Å; P5-S11 WeakPolarHBondContact CG-OG 3.5Å
6	S	70.7	Confident	79	Confident	94 Å²	94	106.4 Å²	106.4	66%	0.657	57%	0.572	S	S	*	*	S	Bend	trans	-86.3	6	-166.1	83.8	0	0	0	0	114	E4 E10	E4-S6 PolarHBondContact O-N 2.92Å; S6-E10 VanDerWaalsContact CA-OE2 3.23Å; S6-E10 WeakPolarHBondContact CA-OE2 3.42Å; S6-E10 WeakPolarHBondContact CB-OE2 3.44Å; S6-E10 PolarHBondContact N-OE2 3.14Å; S6-E10 PolarHBondContact OG-OE1 2.83Å; S6-E10 PolarHBondContact OG-OE2 2.82Å
7	S	90.1	Very high	80	Confident	54 Å²	54	104.4 Å²	104.4	38%	0.378	56%	0.56	S	S	.	*	S	Bend	trans	-168	166.9	167.2	64.8	0	0	0	0	111.2	P5 L9 E10 S11	P5-S7 VanDerWaalsContact C-N 3.28Å; P5-S7 PolarHBondContact O-N 3.49Å; S7-L9 PolarHBondContact O-N 2.94Å; S7-E10 PolarHBondContact O-N 3.27Å; S7-E10 VanDerWaalsContact O-N 3.17Å; S7-E10 WeakPolarHBondContact OG-CG 3.05Å; S7-E10 PolarHBondContact OG-N 3.28Å; S7-S11 PolarHBondContact O-N 2.83Å; S7-S11 PolarHBondContact O-OG 2.81Å
8	N	91.9	Very high	80.8	Confident	147 Å²	147	106.1 Å²	106.1	79%	0.786	56%	0.561	S	S	*	*	H	α-helix	trans	-55.8	-36.5	175.8	-70.9	-14.2	0	0	0	112.9	S11 A12	N8-S11 WeakPolarHBondContact O-CB 3.3Å; N8-S11 PolarHBondContact O-N 2.56Å; N8-A12 PolarHBondContact O-N 3.27Å
9	L	92.4	Very high	81.6	Confident	136 Å²	136	102.4 Å²	102.4	71%	0.712	54%	0.543	S	S	*	.	H	α-helix	trans	-68.8	-43.5	178.6	-68.7	177.1	0	0	0	111.4	S7 S11 A12 M13	S7-L9 PolarHBondContact O-N 2.94Å; L9-S11 VanDerWaalsContact C-N 3.31Å; L9-S11 PolarHBondContact O-N 3.33Å; L9-A12 PolarHBondContact O-N 2.66Å; L9-M13 WeakPolarHBondContact O-CG 3.32Å; L9-M13 PolarHBondContact O-N 2.91Å
10	E	90.9	Very high	82.3	Confident	79 Å²	79	97.3 Å²	97.3	37%	0.369	52%	0.516	S	S	.	.	H	α-helix	trans	-63.3	-39.1	175.1	-70.4	-179.4	-176.6	0	0	111.9	P5 S6 S7 M13 Q14	P5-E10 HydrophobicContact CB-CB 4.38Å; S6-E10 VanDerWaalsContact CA-OE2 3.23Å; S6-E10 WeakPolarHBondContact CA-OE2 3.42Å; S6-E10 WeakPolarHBondContact CB-OE2 3.44Å; S6-E10 PolarHBondContact N-OE2 3.14Å; S6-E10 PolarHBondContact OG-OE1 2.83Å; S6-E10 PolarHBondContact OG-OE2 2.82Å; S7-E10 PolarHBondContact O-N 3.27Å; S7-E10 VanDerWaalsContact O-N 3.17Å; S7-E10 WeakPolarHBondContact OG-CG 3.05Å; S7-E10 PolarHBondContact OG-N 3.28Å; E10-M13 PolarHBondContact O-N 3.24Å; E10-Q14 WeakPolarHBondContact O-CB 3.44Å; E10-Q14 VanDerWaalsContact O-CG 3.3Å; E10-Q14 WeakPolarHBondContact O-CG 3.23Å; E10-Q14 PolarHBondContact O-N 2.77Å
11	S	92	Very high	82.9	Confident	34 Å²	34	97.1 Å²	97.1	24%	0.238	51%	0.512	C	S	.	.	H	α-helix	trans	-59.4	-46.2	172.7	-62.9	0	0	0	0	111.5	P5 S7 N8 L9 Q14 M15	P5-S11 WeakPolarHBondContact CB-OG 3.44Å; P5-S11 WeakPolarHBondContact CG-OG 3.5Å; S7-S11 PolarHBondContact O-N 2.83Å; S7-S11 PolarHBondContact O-OG 2.81Å; N8-S11 WeakPolarHBondContact O-CB 3.3Å; N8-S11 PolarHBondContact O-N 2.56Å; L9-S11 VanDerWaalsContact C-N 3.31Å; L9-S11 PolarHBondContact O-N 3.33Å; S11-Q14 PolarHBondContact O-N 3.34Å; S11-M15 WeakPolarHBondContact O-CG 3.06Å; S11-M15 PolarHBondContact O-N 2.85Å
12	A	92.3	Very high	85.5	Confident	38 Å²	38	90.8 Å²	90.8	31%	0.314	48%	0.478	S	S	.	.	H	α-helix	trans	-62.2	-45.9	178.4	0	0	0	0	0	111.8	N8 L9 Q14 M15 L16	N8-A12 PolarHBondContact O-N 3.27Å; L9-A12 PolarHBondContact O-N 2.66Å; A12-Q14 VanDerWaalsContact C-N 3.33Å; A12-Q14 PolarHBondContact O-N 3.34Å; A12-M15 HydrophobicContact CB-CE 4.47Å; A12-M15 WeakPolarHBondContact O-CB 3.31Å; A12-M15 PolarHBondContact O-N 2.94Å; A12-M15 VanDerWaalsContact O-N 3.15Å; A12-L16 WeakPolarHBondContact O-CG 3.44Å; A12-L16 PolarHBondContact O-N 2.95Å
13	M	93.4	Very high	87.8	Confident	120 Å²	120	85.1 Å²	85.1	59%	0.591	44%	0.438	S	S	*	.	H	α-helix	trans	-59.2	-44.5	174.9	-68.6	175.6	70.6	0	0	111.6	L9 E10 M15 L16 I17	L9-M13 WeakPolarHBondContact O-CG 3.32Å; L9-M13 PolarHBondContact O-N 2.91Å; E10-M13 PolarHBondContact O-N 3.24Å; M13-M15 VanDerWaalsContact C-N 3.32Å; M13-M15 PolarHBondContact O-N 3.48Å; M13-L16 PolarHBondContact O-N 3.26Å; M13-I17 WeakPolarHBondContact O-CG1 3.5Å; M13-I17 PolarHBondContact O-N 3.31Å
14	Q	92.9	Very high	89.7	Confident	64 Å²	64	76.5 Å²	76.5	30%	0.299	40%	0.402	S	S	.	.	H	α-helix	trans	-63.6	-36.8	176	-74.4	-177.6	15.9	0	0	112.4	E10 S11 A12 K18	E10-Q14 WeakPolarHBondContact O-CB 3.44Å; E10-Q14 VanDerWaalsContact O-CG 3.3Å; E10-Q14 WeakPolarHBondContact O-CG 3.23Å; E10-Q14 PolarHBondContact O-N 2.77Å; S11-Q14 PolarHBondContact O-N 3.34Å; A12-Q14 VanDerWaalsContact C-N 3.33Å; A12-Q14 PolarHBondContact O-N 3.34Å; Q14-K18 VanDerWaalsContact O-CB 3.28Å; Q14-K18 WeakPolarHBondContact O-CB 3.43Å; Q14-K18 WeakPolarHBondContact O-CG 3.43Å; Q14-K18 PolarHBondContact O-N 2.83Å
15	M	94.6	Very high	90.9	Very high	118 Å²	118	70.5 Å²	70.5	58%	0.581	38%	0.384	S	S	*	.	H	α-helix	trans	-64.8	-43.2	175.5	-74.4	-170.7	-60.6	0	0	111.4	S11 A12 M13 K18 T19	S11-M15 WeakPolarHBondContact O-CG 3.06Å; S11-M15 PolarHBondContact O-N 2.85Å; A12-M15 HydrophobicContact CB-CE 4.47Å; A12-M15 WeakPolarHBondContact O-CB 3.31Å; A12-M15 PolarHBondContact O-N 2.94Å; A12-M15 VanDerWaalsContact O-N 3.15Å; M13-M15 VanDerWaalsContact C-N 3.32Å; M13-M15 PolarHBondContact O-N 3.48Å; M15-K18 PolarHBondContact O-N 3Å; M15-T19 VanDerWaalsContact O-CB 3.31Å; M15-T19 WeakPolarHBondContact O-CB 3.26Å; M15-T19 PolarHBondContact O-N 3.44Å; M15-T19 PolarHBondContact O-OG1 2.93Å
16	L	95.5	Very high	92.5	Very high	58 Å²	58	73.3 Å²	73.3	30%	0.304	39%	0.391	S	S	.	.	H	α-helix	trans	-59.8	-49.3	175.9	-68.7	167.2	0	0	0	111.5	A12 M13 K18 T19 F20 I80 M83	A12-L16 WeakPolarHBondContact O-CG 3.44Å; A12-L16 PolarHBondContact O-N 2.95Å; M13-L16 PolarHBondContact O-N 3.26Å; L16-K18 PolarHBondContact O-N 3.36Å; L16-T19 PolarHBondContact O-N 3.37Å; L16-F20 PolarHBondContact O-N 3.2Å; L16-I80 HydrophobicContact CB-CD1 4Å; L16-I80 HydrophobicContact CD1-CD1 3.85Å; L16-I80 HydrophobicContact CD2-CD1 4.32Å; L16-I80 HydrophobicContact CG-CD1 4.28Å; L16-M83 HydrophobicContact CD2-CB 4.21Å; L16-M83 HydrophobicContact CD2-CG 3.91Å; L16-M83 HydrophobicContact CD2-SD 4.42Å
17	I	95.5	Very high	93.3	Very high	72 Å²	72	74.7 Å²	74.7	37%	0.369	39%	0.388	S	S	.	.	H	α-helix	trans	-60.6	-46.7	178.3	-66.2	164.2	0	0	0	111.2	M13 T19 F20 H21 F76	M13-I17 WeakPolarHBondContact O-CG1 3.5Å; M13-I17 PolarHBondContact O-N 3.31Å; I17-T19 VanDerWaalsContact C-N 3.32Å; I17-T19 PolarHBondContact O-N 2.77Å; I17-F20 PolarHBondContact O-N 2.68Å; I17-H21 PolarHBondContact O-CD2 2.92Å; I17-H21 PolarHBondContact O-N 3.32Å; I17-H21 VanDerWaalsContact O-N 3.07Å; I17-F76 HydrophobicContact CB-CZ 4.49Å; I17-F76 HydrophobicContact CG1-CE1 4.35Å; I17-F76 HydrophobicContact CG1-CE2 4.07Å; I17-F76 HydrophobicContact CG1-CZ 3.57Å
18	K	95.3	Very high	93.2	Very high	135 Å²	135	75.8 Å²	75.8	59%	0.587	41%	0.407	S	S	*	.	H	α-helix	trans	-64.3	-38.2	179.4	-76.3	172.3	-178.4	172.7	0	112.1	Q14 M15 L16 K22	Q14-K18 VanDerWaalsContact O-CB 3.28Å; Q14-K18 WeakPolarHBondContact O-CB 3.43Å; Q14-K18 WeakPolarHBondContact O-CG 3.43Å; Q14-K18 PolarHBondContact O-N 2.83Å; M15-K18 PolarHBondContact O-N 3Å; L16-K18 PolarHBondContact O-N 3.36Å; K18-K22 WeakPolarHBondContact O-CB 3.42Å; K18-K22 PolarHBondContact O-N 3.46Å
19	T	95.6	Very high	93.2	Very high	36 Å²	36	72.3 Å²	72.3	22%	0.221	39%	0.389	C	S	.	.	H	α-helix	trans	-67.4	-46.8	179.1	-55.4	0	0	0	0	110.1	M15 L16 I17 H21 K22 Y23 E45	M15-T19 VanDerWaalsContact O-CB 3.31Å; M15-T19 WeakPolarHBondContact O-CB 3.26Å; M15-T19 PolarHBondContact O-N 3.44Å; M15-T19 PolarHBondContact O-OG1 2.93Å; L16-T19 PolarHBondContact O-N 3.37Å; I17-T19 VanDerWaalsContact C-N 3.32Å; I17-T19 PolarHBondContact O-N 2.77Å; T19-H21 VanDerWaalsContact C-N 3.35Å; T19-H21 PolarHBondContact O-N 3.29Å; T19-K22 WeakPolarHBondContact O-CB 3.19Å; T19-K22 PolarHBondContact O-N 2.8Å; T19-K22 VanDerWaalsContact O-N 3.12Å; T19-Y23 HydrophobicContact CG2-CD2 4.42Å; T19-Y23 HydrophobicContact CG2-CE2 4.15Å; T19-Y23 VanDerWaalsContact O-CD2 3.25Å; T19-Y23 WeakPolarHBondContact O-CD2 3.43Å; T19-E45 HydrophobicContact CG2-CG 3.8Å
20	F	95.8	Very high	93.2	Very high	0 Å²	0	71.7 Å²	71.7	0%	0	38%	0.38	C	S	.	.	H	α-helix	trans	-53.9	-52.2	174.1	-179.5	-94.4	0	0	0	111.6	L16 I17 K22 Y23 S24 Y31 L33 F76 F79	L16-F20 PolarHBondContact O-N 3.2Å; I17-F20 PolarHBondContact O-N 2.68Å; F20-K22 PolarHBondContact O-N 3.3Å; F20-Y23 PolarHBondContact O-N 3.02Å; F20-S24 PolarHBondContact O-N 2.87Å; F20-S24 PolarHBondContact O-OG 2.93Å; F20-Y31 WeakPolarHBondContact CE1-O 3.28Å; F20-Y31 VanDerWaalsContact CZ-O 3.31Å; F20-Y31 WeakPolarHBondContact CZ-O 3.34Å; F20-L33 HydrophobicContact CD2-CD1 3.73Å; F20-L33 HydrophobicContact CD2-CG 4.09Å; F20-L33 HydrophobicContact CE2-CD1 3.61Å; F20-L33 HydrophobicContact CE2-CG 3.67Å; F20-L33 HydrophobicContact CZ-CG 4.24Å; F20-F76 HydrophobicContact CB-CD2 3.86Å; F20-F76 HydrophobicContact CB-CE2 3.96Å; F20-F76 AromaticContact CD1-CD2 3.78Å; F20-F76 HydrophobicContact CD1-CD2 3.78Å; F20-F76 AromaticContact CD2-CD2 3.95Å; F20-F76 HydrophobicContact CD2-CD2 3.95Å; F20-F76 HydrophobicContact CE1-CB 4.19Å; F20-F76 HydrophobicContact CE1-CD2 4.3Å; F20-F76 HydrophobicContact CE2-CB 4.42Å; F20-F76 HydrophobicContact CE2-CD2 4.43Å; F20-F76 AromaticContact CG-CD2 3.59Å; F20-F76 HydrophobicContact CG-CD2 3.59Å; F20-F76 HydrophobicContact CG-CE2 4.21Å; F20-F76 HydrophobicContact CZ-CB 4.14Å; F20-F79 HydrophobicContact CB-CD1 4.09Å; F20-F79 HydrophobicContact CB-CE1 4Å; F20-F79 HydrophobicContact CB-CZ 4.49Å; F20-F79 HydrophobicContact CD2-CB 3.73Å; F20-F79 AromaticContact CD2-CD1 3.75Å; F20-F79 HydrophobicContact CD2-CD1 3.75Å; F20-F79 HydrophobicContact CD2-CD2 4.15Å; F20-F79 HydrophobicContact CD2-CE1 4.41Å; F20-F79 AromaticContact CD2-CG 3.59Å; F20-F79 HydrophobicContact CD2-CG 3.59Å; F20-F79 HydrophobicContact CE2-CB 3.86Å; F20-F79 HydrophobicContact CE2-CG 4.23Å; F20-F79 HydrophobicContact CG-CD1 4.3Å
21	H	95.9	Very high	93.4	Very high	94 Å²	94	74.4 Å²	74.4	44%	0.435	39%	0.388	S	S	.	.	H	α-helix	trans	-72.1	-10.5	-179.2	-72.6	-52.6	0	0	0	115.5	I17 T19 Y23 S24	I17-H21 PolarHBondContact O-CD2 2.92Å; I17-H21 PolarHBondContact O-N 3.32Å; I17-H21 VanDerWaalsContact O-N 3.07Å; T19-H21 VanDerWaalsContact C-N 3.35Å; T19-H21 PolarHBondContact O-N 3.29Å; H21-Y23 VanDerWaalsContact C-N 3.31Å; H21-S24 WeakPolarHBondContact CA-OG 3.42Å; H21-S24 PolarHBondContact ND1-OG 2.78Å
22	K	95.9	Very high	93.5	Very high	108 Å²	108	73.5 Å²	73.5	47%	0.47	38%	0.381	S	S	.	.	H	α-helix	trans	-71.7	-29.9	169.6	174.9	-173.2	165.1	-162.2	0	111	K18 T19 F20 K26 E44 E45	K18-K22 WeakPolarHBondContact O-CB 3.42Å; K18-K22 PolarHBondContact O-N 3.46Å; T19-K22 WeakPolarHBondContact O-CB 3.19Å; T19-K22 PolarHBondContact O-N 2.8Å; T19-K22 VanDerWaalsContact O-N 3.12Å; F20-K22 PolarHBondContact O-N 3.3Å; K22-K26 VanDerWaalsContact O-CE 3.22Å; K22-K26 WeakPolarHBondContact O-CE 3.31Å; K22-E44 IonicContact NZ-OE2 3.99Å; K22-E45 IonicContact NZ-OE1 2.71Å; K22-E45 PolarHBondContact NZ-OE1 3.19Å
23	Y	95.8	Very high	93.7	Very high	0 Å²	0	71.7 Å²	71.7	0%	0	37%	0.366	C	S	.	.	H	α-helix	trans	-104.8	-34.9	-176.6	-65	-81.5	0	0	0	113.3	T19 F20 H21 E37 E40 L41 E44 E45	T19-Y23 HydrophobicContact CG2-CD2 4.42Å; T19-Y23 HydrophobicContact CG2-CE2 4.15Å; T19-Y23 VanDerWaalsContact O-CD2 3.25Å; T19-Y23 WeakPolarHBondContact O-CD2 3.43Å; F20-Y23 PolarHBondContact O-N 3.02Å; H21-Y23 VanDerWaalsContact C-N 3.31Å; Y23-E37 WeakPolarHBondContact O-CG 3.42Å; Y23-E40 HydrophobicContact CD1-CB 4.06Å; Y23-E40 HydrophobicContact CD1-CG 4.02Å; Y23-E40 HydrophobicContact CE1-CB 4.25Å; Y23-E40 HydrophobicContact CE1-CG 3.84Å; Y23-L41 HydrophobicContact CD1-CB 4.11Å; Y23-L41 HydrophobicContact CD2-CB 3.79Å; Y23-L41 HydrophobicContact CD2-CD1 3.77Å; Y23-L41 HydrophobicContact CD2-CG 3.74Å; Y23-L41 HydrophobicContact CE1-CB 4.5Å; Y23-L41 HydrophobicContact CE2-CB 4.2Å; Y23-L41 HydrophobicContact CE2-CG 4.08Å; Y23-L41 HydrophobicContact CG-CB 3.76Å; Y23-L41 HydrophobicContact CG-CD1 4.22Å; Y23-L41 HydrophobicContact CG-CG 4.22Å; Y23-E44 WeakPolarHBondContact CE1-OE2 3.37Å; Y23-E44 VanDerWaalsContact OH-CB 3.3Å; Y23-E44 WeakPolarHBondContact OH-CB 3.42Å; Y23-E44 PolarHBondContact OH-OE2 3.42Å; Y23-E45 HydrophobicContact CE2-CG 3.66Å; Y23-E45 PolarHBondContact OH-OE1 3.1Å; Y23-E45 VanDerWaalsContact OH-OE1 3.06Å
24	S	95.4	Very high	93.7	Very high	12 Å²	12	66.7 Å²	66.7	8%	0.084	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-67	145.2	180	68.2	0	0	0	0	112.8	F20 H21 K26 K30 T32	F20-S24 PolarHBondContact O-N 2.87Å; F20-S24 PolarHBondContact O-OG 2.93Å; H21-S24 WeakPolarHBondContact CA-OG 3.42Å; H21-S24 PolarHBondContact ND1-OG 2.78Å; S24-K26 VanDerWaalsContact C-N 3.31Å; S24-K26 PolarHBondContact O-N 2.92Å; S24-K30 PolarHBondContact OG-O 3.46Å; S24-T32 WeakPolarHBondContact CA-O 3.32Å; S24-T32 WeakPolarHBondContact CB-O 3.13Å
25	G	90.5	Very high	93.5	Very high	36 Å²	36	67.3 Å²	67.3	37%	0.371	34%	0.343	S	S	.	.	T	Hydrogen-bonded Turn	trans	76.5	13.2	170.6	0	0	0	0	0	115.7	E37	G25-E37 PolarHBondContact N-OE1 3.38Å
26	K	90.9	Very high	93.3	Very high	104 Å²	104	63.6 Å²	63.6	45%	0.452	34%	0.335	S	S	.	.	S	Bend	trans	-68.2	-32.4	160.4	-61.6	177.1	-177.9	173.4	0	109.9	K22 S24 E37 E40	K22-K26 VanDerWaalsContact O-CE 3.22Å; K22-K26 WeakPolarHBondContact O-CE 3.31Å; S24-K26 VanDerWaalsContact C-N 3.31Å; S24-K26 PolarHBondContact O-N 2.92Å; K26-E37 VanDerWaalsContact CA-OE1 3.27Å; K26-E37 WeakPolarHBondContact CA-OE1 3.48Å; K26-E37 HydrophobicContact CB-CG 4.33Å; K26-E37 VanDerWaalsContact CB-OE1 3.29Å; K26-E37 WeakPolarHBondContact CB-OE1 3.29Å; K26-E37 PolarHBondContact N-OE1 3.13Å; K26-E40 IonicContact NZ-OE1 2.73Å; K26-E40 PolarHBondContact NZ-OE1 2.77Å; K26-E40 IonicContact NZ-OE2 2.68Å; K26-E40 PolarHBondContact NZ-OE2 3.43Å
27	E	86.4	Confident	93.3	Very high	124 Å²	124	61 Å²	61	58%	0.579	32%	0.321	S	S	*	.	S	Bend	trans	-137.9	138.1	177.4	-60.3	-179.3	177.2	0	0	109.9	E37	E27-E37 PolarHBondContact N-OE1 3.38Å
28	G	88.1	Confident	93	Very high	77 Å²	77	57.6 Å²	57.6	79%	0.794	30%	0.303	S	S	*	.	S	Bend	trans	72.1	-132.7	173.6	0	0	0	0	0	114.7
29	D	91.7	Very high	92.7	Very high	74 Å²	74	54.3 Å²	54.3	40%	0.396	29%	0.289	S	S	.	.			trans	-80.9	137	-179.5	-168.6	-24.1	0	0	0	111.1	Y31 T32	D29-Y31 PolarHBondContact O-N 3.36Å; D29-Y31 WeakPolarHBondContact OD1-CD2 3.45Å; D29-Y31 PolarHBondContact OD1-N 2.95Å; D29-T32 WeakPolarHBondContact CB-OG1 3.36Å
30	K	92.9	Very high	92.5	Very high	122 Å²	122	55.8 Å²	55.8	53%	0.53	29%	0.293	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.4	-7.5	180	70.7	-176.6	-173.9	178	0	114.5	S24	S24-K30 PolarHBondContact OG-O 3.46Å
31	Y	94.3	Very high	92.4	Very high	137 Å²	137	55.9 Å²	55.9	54%	0.537	29%	0.294	S	S	.	.	T	Hydrogen-bonded Turn	trans	-105.1	-1	-179.8	-61	-65.5	0	0	0	113.4	F20 D29	F20-Y31 WeakPolarHBondContact CE1-O 3.28Å; F20-Y31 VanDerWaalsContact CZ-O 3.31Å; F20-Y31 WeakPolarHBondContact CZ-O 3.34Å; D29-Y31 PolarHBondContact O-N 3.36Å; D29-Y31 WeakPolarHBondContact OD1-CD2 3.45Å; D29-Y31 PolarHBondContact OD1-N 2.95Å
32	T	95.6	Very high	91.9	Very high	14 Å²	14	51.5 Å²	51.5	9%	0.086	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	163.2	179.9	62.3	0	0	0	0	109.8	S24 D29 E73 V74 D75	S24-T32 WeakPolarHBondContact CA-O 3.32Å; S24-T32 WeakPolarHBondContact CB-O 3.13Å; D29-T32 WeakPolarHBondContact CB-OG1 3.36Å; T32-E73 VanDerWaalsContact CB-OE2 3.31Å; T32-E73 WeakPolarHBondContact CB-OE2 3.33Å; T32-E73 HydrophobicContact CG2-CB 4.27Å; T32-E73 WeakPolarHBondContact CG2-OE2 3.19Å; T32-E73 PolarHBondContact OG1-OE2 3.38Å; T32-V74 CarbonylContact C-O 3.6Å; T32-V74 VanDerWaalsContact CA-O 3.31Å; T32-V74 WeakPolarHBondContact CA-O 3.28Å; T32-D75 HydrophobicContact CG2-CB 4.3Å
33	L	95.1	Very high	91.5	Very high	0 Å²	0	48.6 Å²	48.6	0%	0	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	122.6	168.7	-66.8	163.5	0	0	0	108.5	F20 E37 L38 L41 E73 V74 F79	F20-L33 HydrophobicContact CD2-CD1 3.73Å; F20-L33 HydrophobicContact CD2-CG 4.09Å; F20-L33 HydrophobicContact CE2-CD1 3.61Å; F20-L33 HydrophobicContact CE2-CG 3.67Å; F20-L33 HydrophobicContact CZ-CG 4.24Å; L33-E37 VanDerWaalsContact CA-OE2 3.32Å; L33-E37 WeakPolarHBondContact CA-OE2 3.48Å; L33-E37 HydrophobicContact CB-CB 4.35Å; L33-E37 HydrophobicContact CD2-CB 3.83Å; L33-L38 HydrophobicContact CB-CB 4.39Å; L33-L38 HydrophobicContact CD1-CD1 4.3Å; L33-L41 HydrophobicContact CD1-CD1 3.93Å; L33-E73 CarbonylContact O-C 3.27Å; L33-E73 WeakPolarHBondContact O-CA 3.27Å; L33-V74 HydrophobicContact CB-CB 4.26Å; L33-V74 PolarHBondContact N-O 3.46Å; L33-V74 PolarHBondContact O-N 2.89Å; L33-F79 HydrophobicContact CD1-CD2 4.38Å
34	S	93.5	Very high	91.2	Very high	15 Å²	15	54 Å²	54	11%	0.105	29%	0.29	C	S	.	.			trans	-65.6	163.6	164.4	94.6	0	0	0	0	110	G36 E37 L38	S34-G36 PolarHBondContact O-N 2.84Å; S34-G36 PolarHBondContact OG-N 3.35Å; S34-E37 PolarHBondContact N-OE2 2.83Å; S34-E37 PolarHBondContact O-N 3.08Å; S34-E37 VanDerWaalsContact O-N 3.08Å; S34-E37 PolarHBondContact OG-N 2.81Å; S34-L38 PolarHBondContact O-N 3.19Å
35	R	89.4	Confident	90.9	Very high	78 Å²	78	57.1 Å²	57.1	29%	0.294	30%	0.303	S	S	.	.	H	α-helix	trans	-50.6	-40.7	172.2	-174.8	176.3	-168.6	58.5	47.9	113.7	K39 E60	R35-K39 WeakPolarHBondContact O-CB 3.27Å; R35-K39 PolarHBondContact O-N 3.08Å; R35-K39 VanDerWaalsContact O-N 3.13Å; R35-E60 IonicContact CZ-OE1 2.7Å; R35-E60 IonicContact CZ-OE2 3Å; R35-E60 IonicContact NE-OE1 2.77Å; R35-E60 PolarHBondContact NE-OE1 3.05Å; R35-E60 IonicContact NE-OE2 3.79Å; R35-E60 IonicContact NH1-OE1 3.24Å; R35-E60 PolarHBondContact NH1-OE1 3.24Å; R35-E60 IonicContact NH1-OE2 2.66Å; R35-E60 PolarHBondContact NH1-OE2 3.24Å; R35-E60 IonicContact NH2-OE1 2.91Å; R35-E60 PolarHBondContact NH2-OE1 3.5Å; R35-E60 IonicContact NH2-OE2 3.27Å; R35-E60 PolarHBondContact NH2-OE2 3.13Å
36	G	90.8	Very high	90.6	Very high	40 Å²	40	56.8 Å²	56.8	41%	0.412	29%	0.293	S	S	.	.	H	α-helix	trans	-69.3	-41.4	179	0	0	0	0	0	112	S34 K39 E40	S34-G36 PolarHBondContact O-N 2.84Å; S34-G36 PolarHBondContact OG-N 3.35Å; G36-K39 WeakPolarHBondContact O-CB 3.35Å; G36-K39 PolarHBondContact O-N 2.68Å; G36-E40 PolarHBondContact O-N 3.26Å; G36-E40 VanDerWaalsContact O-N 3.08Å
37	E	94.1	Very high	89.9	Confident	3 Å²	3	53 Å²	53	1%	0.014	28%	0.283	C	S	.	.	H	α-helix	trans	-69.2	-41.5	179.1	-63.5	174.1	151.4	0	0	111.9	Y23 G25 K26 E27 L33 S34 K39 E40 L41	Y23-E37 WeakPolarHBondContact O-CG 3.42Å; G25-E37 PolarHBondContact N-OE1 3.38Å; K26-E37 VanDerWaalsContact CA-OE1 3.27Å; K26-E37 WeakPolarHBondContact CA-OE1 3.48Å; K26-E37 HydrophobicContact CB-CG 4.33Å; K26-E37 VanDerWaalsContact CB-OE1 3.29Å; K26-E37 WeakPolarHBondContact CB-OE1 3.29Å; K26-E37 PolarHBondContact N-OE1 3.13Å; E27-E37 PolarHBondContact N-OE1 3.38Å; L33-E37 VanDerWaalsContact CA-OE2 3.32Å; L33-E37 WeakPolarHBondContact CA-OE2 3.48Å; L33-E37 HydrophobicContact CB-CB 4.35Å; L33-E37 HydrophobicContact CD2-CB 3.83Å; S34-E37 PolarHBondContact N-OE2 2.83Å; S34-E37 PolarHBondContact O-N 3.08Å; S34-E37 VanDerWaalsContact O-N 3.08Å; S34-E37 PolarHBondContact OG-N 2.81Å; E37-K39 VanDerWaalsContact C-N 3.33Å; E37-K39 PolarHBondContact O-N 3.03Å; E37-E40 PolarHBondContact O-N 3.26Å; E37-L41 PolarHBondContact O-N 3.47Å
38	L	90.9	Very high	89.3	Confident	0 Å²	0	52.8 Å²	52.8	0%	0	30%	0.295	C	S	.	.	H	α-helix	trans	-60	-44.9	173.3	-179.9	64.3	0	0	0	110.6	L33 S34 E40 L41 L42 M63 L66 V74	L33-L38 HydrophobicContact CB-CB 4.39Å; L33-L38 HydrophobicContact CD1-CD1 4.3Å; S34-L38 PolarHBondContact O-N 3.19Å; L38-E40 VanDerWaalsContact C-N 3.3Å; L38-E40 PolarHBondContact O-N 2.95Å; L38-L41 PolarHBondContact O-N 3.25Å; L38-L42 HydrophobicContact CD1-CD1 4.22Å; L38-L42 HydrophobicContact CD1-CD2 4.35Å; L38-L42 HydrophobicContact CD1-CG 4.05Å; L38-L42 HydrophobicContact CD2-CD1 4.5Å; L38-L42 HydrophobicContact CG-CD1 3.98Å; L38-L42 HydrophobicContact CG-CG 4.21Å; L38-L42 WeakPolarHBondContact O-CB 3.29Å; L38-L42 VanDerWaalsContact O-CG 3.25Å; L38-L42 WeakPolarHBondContact O-CG 3.14Å; L38-L42 PolarHBondContact O-N 2.73Å; L38-M63 HydrophobicContact CD2-CB 4.16Å; L38-M63 HydrophobicContact CD2-CG 4.47Å; L38-M63 HydrophobicContact CD2-SD 3.45Å; L38-M63 WeakPolarHBondContact CD2-SD 3.34Å; L38-L66 HydrophobicContact CD2-CD1 4.49Å; L38-V74 HydrophobicContact CD2-CG2 4.11Å
39	K	89	Confident	88.4	Confident	66 Å²	66	55 Å²	55	29%	0.287	28%	0.281	S	S	.	.	H	α-helix	trans	-56.3	-46	176.1	-179.5	168.9	178.9	-175.1	0	112.1	R35 G36 E37 T43 N56 V59	R35-K39 WeakPolarHBondContact O-CB 3.27Å; R35-K39 PolarHBondContact O-N 3.08Å; R35-K39 VanDerWaalsContact O-N 3.13Å; G36-K39 WeakPolarHBondContact O-CB 3.35Å; G36-K39 PolarHBondContact O-N 2.68Å; E37-K39 VanDerWaalsContact C-N 3.33Å; E37-K39 PolarHBondContact O-N 3.03Å; K39-T43 WeakPolarHBondContact O-CB 3.35Å; K39-T43 PolarHBondContact O-N 3.46Å; K39-T43 PolarHBondContact O-OG1 3.46Å; K39-N56 PolarHBondContact NZ-OD1 3.06Å; K39-V59 HydrophobicContact CB-CG1 3.93Å; K39-V59 HydrophobicContact CB-CG2 4.35Å; K39-V59 HydrophobicContact CD-CG2 4.43Å; K39-V59 HydrophobicContact CG-CG1 4.42Å; K39-V59 HydrophobicContact CG-CG2 4.01Å
40	E	91.2	Very high	87.3	Confident	67 Å²	67	54.7 Å²	54.7	31%	0.313	28%	0.279	S	S	.	.	H	α-helix	trans	-62.3	-47.9	179.6	-163.1	-171.6	166.8	0	0	110.7	Y23 K26 G36 E37 L38 L42 T43 E44	Y23-E40 HydrophobicContact CD1-CB 4.06Å; Y23-E40 HydrophobicContact CD1-CG 4.02Å; Y23-E40 HydrophobicContact CE1-CB 4.25Å; Y23-E40 HydrophobicContact CE1-CG 3.84Å; K26-E40 IonicContact NZ-OE1 2.73Å; K26-E40 PolarHBondContact NZ-OE1 2.77Å; K26-E40 IonicContact NZ-OE2 2.68Å; K26-E40 PolarHBondContact NZ-OE2 3.43Å; G36-E40 PolarHBondContact O-N 3.26Å; G36-E40 VanDerWaalsContact O-N 3.08Å; E37-E40 PolarHBondContact O-N 3.26Å; L38-E40 VanDerWaalsContact C-N 3.3Å; L38-E40 PolarHBondContact O-N 2.95Å; E40-L42 PolarHBondContact O-N 3.37Å; E40-T43 PolarHBondContact O-N 2.74Å; E40-E44 WeakPolarHBondContact O-CB 3.31Å; E40-E44 WeakPolarHBondContact O-CG 3.48Å; E40-E44 PolarHBondContact O-N 3.27Å
41	L	92.3	Very high	85.8	Confident	3 Å²	3	51.5 Å²	51.5	2%	0.016	28%	0.281	C	S	.	.	H	α-helix	trans	-56.1	-51.9	176	-174.5	159	0	0	0	111.6	Y23 L33 E37 L38 T43 E44 E45 F79	Y23-L41 HydrophobicContact CD1-CB 4.11Å; Y23-L41 HydrophobicContact CD2-CB 3.79Å; Y23-L41 HydrophobicContact CD2-CD1 3.77Å; Y23-L41 HydrophobicContact CD2-CG 3.74Å; Y23-L41 HydrophobicContact CE1-CB 4.5Å; Y23-L41 HydrophobicContact CE2-CB 4.2Å; Y23-L41 HydrophobicContact CE2-CG 4.08Å; Y23-L41 HydrophobicContact CG-CB 3.76Å; Y23-L41 HydrophobicContact CG-CD1 4.22Å; Y23-L41 HydrophobicContact CG-CG 4.22Å; L33-L41 HydrophobicContact CD1-CD1 3.93Å; E37-L41 PolarHBondContact O-N 3.47Å; L38-L41 PolarHBondContact O-N 3.25Å; L41-T43 PolarHBondContact O-N 2.75Å; L41-E44 PolarHBondContact O-N 3.02Å; L41-E45 WeakPolarHBondContact O-CB 3.22Å; L41-E45 PolarHBondContact O-N 2.68Å; L41-F79 HydrophobicContact CD1-CD2 4.34Å; L41-F79 HydrophobicContact CD1-CE2 3.81Å; L41-F79 HydrophobicContact CD2-CE2 4.17Å
42	L	87.2	Confident	83.9	Confident	2 Å²	2	50.9 Å²	50.9	1%	0.01	29%	0.287	C	S	.	.	H	α-helix	trans	-63.9	-28.9	-179.1	-65.7	179	0	0	0	112.5	L38 E40 L46 G47 L50 S53 V62 L82	L38-L42 HydrophobicContact CD1-CD1 4.22Å; L38-L42 HydrophobicContact CD1-CD2 4.35Å; L38-L42 HydrophobicContact CD1-CG 4.05Å; L38-L42 HydrophobicContact CD2-CD1 4.5Å; L38-L42 HydrophobicContact CG-CD1 3.98Å; L38-L42 HydrophobicContact CG-CG 4.21Å; L38-L42 WeakPolarHBondContact O-CB 3.29Å; L38-L42 VanDerWaalsContact O-CG 3.25Å; L38-L42 WeakPolarHBondContact O-CG 3.14Å; L38-L42 PolarHBondContact O-N 2.73Å; E40-L42 PolarHBondContact O-N 3.37Å; L42-L46 HydrophobicContact CD2-CD1 3.86Å; L42-L46 CarbonylContact O-C 3.48Å; L42-L46 VanDerWaalsContact O-C 3.27Å; L42-G47 PolarHBondContact O-N 2.89Å; L42-G47 VanDerWaalsContact O-N 3.1Å; L42-L50 HydrophobicContact CB-CD1 4.34Å; L42-L50 HydrophobicContact CD2-CD1 3.93Å; L42-S53 PolarHBondContact O-OG 3.4Å; L42-S53 VanDerWaalsContact O-OG 3.11Å; L42-V62 HydrophobicContact CD1-CB 4.13Å; L42-V62 HydrophobicContact CD1-CG1 3.75Å; L42-L82 HydrophobicContact CD2-CD2 4.1Å
43	T	85.4	Confident	82	Confident	46 Å²	46	50.6 Å²	50.6	28%	0.282	29%	0.285	S	S	.	.	H	α-helix	trans	-79	-45.3	178.7	-57.2	0	0	0	0	111.6	K39 E40 L41 G47 S53	K39-T43 WeakPolarHBondContact O-CB 3.35Å; K39-T43 PolarHBondContact O-N 3.46Å; K39-T43 PolarHBondContact O-OG1 3.46Å; E40-T43 PolarHBondContact O-N 2.74Å; L41-T43 PolarHBondContact O-N 2.75Å; T43-G47 WeakPolarHBondContact O-CA 3.26Å; T43-G47 PolarHBondContact O-N 2.96Å; T43-S53 WeakPolarHBondContact CA-OG 3.41Å
44	E	89.9	Confident	80.4	Confident	113 Å²	113	57.6 Å²	57.6	53%	0.528	32%	0.316	S	S	.	.	H	α-helix	trans	-82.4	-43.9	-173.3	-68.8	-167.9	169.1	0	0	113.3	K22 Y23 E40 L41	K22-E44 IonicContact NZ-OE2 3.99Å; Y23-E44 WeakPolarHBondContact CE1-OE2 3.37Å; Y23-E44 VanDerWaalsContact OH-CB 3.3Å; Y23-E44 WeakPolarHBondContact OH-CB 3.42Å; Y23-E44 PolarHBondContact OH-OE2 3.42Å; E40-E44 WeakPolarHBondContact O-CB 3.31Å; E40-E44 WeakPolarHBondContact O-CG 3.48Å; E40-E44 PolarHBondContact O-N 3.27Å; L41-E44 PolarHBondContact O-N 3.02Å
45	E	89.9	Confident	79.2	Confident	78 Å²	78	61 Å²	61	36%	0.364	33%	0.333	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90.4	-31.1	-174.6	-57.5	-67.6	170.2	0	0	111.8	T19 K22 Y23 L41	T19-E45 HydrophobicContact CG2-CG 3.8Å; K22-E45 IonicContact NZ-OE1 2.71Å; K22-E45 PolarHBondContact NZ-OE1 3.19Å; Y23-E45 HydrophobicContact CE2-CG 3.66Å; Y23-E45 PolarHBondContact OH-OE1 3.1Å; Y23-E45 VanDerWaalsContact OH-OE1 3.06Å; L41-E45 WeakPolarHBondContact O-CB 3.22Å; L41-E45 PolarHBondContact O-N 2.68Å
46	L	83.1	Confident	78.6	Confident	30 Å²	30	61.9 Å²	61.9	16%	0.157	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-122	6.1	-172.4	-59.7	175.5	0	0	0	114.3	L42 S48 Y49 L50 M83 L86	L42-L46 HydrophobicContact CD2-CD1 3.86Å; L42-L46 CarbonylContact O-C 3.48Å; L42-L46 VanDerWaalsContact O-C 3.27Å; L46-S48 PolarHBondContact O-N 3.32Å; L46-S48 VanDerWaalsContact O-N 3.17Å; L46-Y49 WeakPolarHBondContact O-CA 3.25Å; L46-Y49 WeakPolarHBondContact O-CB 3.49Å; L46-Y49 PolarHBondContact O-N 3.21Å; L46-L50 HydrophobicContact CB-CD1 3.82Å; L46-L50 HydrophobicContact CB-CG 4.16Å; L46-L50 HydrophobicContact CD1-CD1 4.28Å; L46-L50 PolarHBondContact O-N 3.29Å; L46-M83 HydrophobicContact CD1-CE 3.88Å; L46-L86 HydrophobicContact CD1-CD1 3.88Å
47	G	77.4	Confident	78.1	Confident	23 Å²	23	67 Å²	67	24%	0.237	36%	0.356	C	S	.	.	H	α-helix	trans	-60.7	-29.7	-174.5	0	0	0	0	0	114.3	L42 T43 G51	L42-G47 PolarHBondContact O-N 2.89Å; L42-G47 VanDerWaalsContact O-N 3.1Å; T43-G47 WeakPolarHBondContact O-CA 3.26Å; T43-G47 PolarHBondContact O-N 2.96Å; G47-G51 PolarHBondContact O-N 3.43Å
48	S	74.4	Confident	77.3	Confident	120 Å²	120	68.9 Å²	68.9	84%	0.839	37%	0.373	S	S	*	.	H	α-helix	trans	-74	-28.7	173.5	57.2	0	0	0	0	113.1	L46	L46-S48 PolarHBondContact O-N 3.32Å; L46-S48 VanDerWaalsContact O-N 3.17Å
49	Y	68.1	Low	76.8	Confident	125 Å²	125	69 Å²	69	49%	0.49	37%	0.374	S	S	.	.	H	α-helix	trans	-86.2	-40.6	-176.8	-145.1	-93.7	0	0	0	111.8	L46 C90	L46-Y49 WeakPolarHBondContact O-CA 3.25Å; L46-Y49 WeakPolarHBondContact O-CB 3.49Å; L46-Y49 PolarHBondContact O-N 3.21Å; Y49-C90 PolarHBondContact OH-SG 3.14Å
50	L	68.1	Low	76.6	Confident	66 Å²	66	69.8 Å²	69.8	35%	0.346	38%	0.378	S	S	.	.	H	α-helix	trans	-90.3	-9.4	-175.2	-64.8	174.7	0	0	0	113.7	L42 L46 L86	L42-L50 HydrophobicContact CB-CD1 4.34Å; L42-L50 HydrophobicContact CD2-CD1 3.93Å; L46-L50 HydrophobicContact CB-CD1 3.82Å; L46-L50 HydrophobicContact CB-CG 4.16Å; L46-L50 HydrophobicContact CD1-CD1 4.28Å; L46-L50 PolarHBondContact O-N 3.29Å; L50-L86 HydrophobicContact CD2-CD2 4.38Å
51	G	61.1	Low	76.2	Confident	56 Å²	56	73.2 Å²	73.2	58%	0.577	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.3	96.8	177.8	0	0	0	0	0	112.7	G47 S53	G47-G51 PolarHBondContact O-N 3.43Å; G51-S53 PolarHBondContact O-N 2.9Å
52	N	55.2	Low	75.8	Confident	123 Å²	123	74.6 Å²	74.6	66%	0.658	40%	0.401	S	S	*	.			trans	46.9	59.2	178.6	-93.9	-1.4	0	0	0	113.7	K54 D55	N52-K54 PolarHBondContact O-N 3.47Å; N52-D55 PolarHBondContact O-N 2.92Å
53	S	56.2	Low	75.7	Confident	8 Å²	8	74.7 Å²	74.7	6%	0.056	40%	0.401	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60.2	14.9	165.1	44.9	0	0	0	0	114.7	L42 T43 G51 D55	L42-S53 PolarHBondContact O-OG 3.4Å; L42-S53 VanDerWaalsContact O-OG 3.11Å; T43-S53 WeakPolarHBondContact CA-OG 3.41Å; G51-S53 PolarHBondContact O-N 2.9Å; S53-D55 PolarHBondContact O-N 3.28Å
54	K	60.5	Low	75.7	Confident	147 Å²	147	77.1 Å²	77.1	64%	0.639	41%	0.412	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.5	-15.9	170.5	-65.2	-175.9	178.7	179.2	0	112.3	N52 N56	N52-K54 PolarHBondContact O-N 3.47Å; K54-N56 PolarHBondContact O-N 3.28Å
55	D	69.4	Low	75.4	Confident	87 Å²	87	77.4 Å²	77.4	47%	0.465	42%	0.417	S	S	.	.			trans	-72.3	116.9	174.9	-166.2	-11.8	0	0	0	110.3	N52 S53 E57 A58 V59	N52-D55 PolarHBondContact O-N 2.92Å; S53-D55 PolarHBondContact O-N 3.28Å; D55-E57 PolarHBondContact O-N 3.22Å; D55-E57 WeakPolarHBondContact OD1-CB 3.25Å; D55-E57 PolarHBondContact OD1-N 3.37Å; D55-A58 HydrophobicContact CB-CB 4.13Å; D55-A58 PolarHBondContact O-N 2.9Å; D55-V59 PolarHBondContact O-N 3.32Å
56	N	76.5	Confident	75.1	Confident	96 Å²	96	74.3 Å²	74.3	51%	0.513	40%	0.403	S	S	.	.	H	α-helix	trans	-58.5	-32.5	176.1	-73.5	-24.6	0	0	0	111.4	K39 K54 V59 E60	K39-N56 PolarHBondContact NZ-OD1 3.06Å; K54-N56 PolarHBondContact O-N 3.28Å; N56-V59 PolarHBondContact O-N 2.94Å; N56-E60 WeakPolarHBondContact O-CG 3.48Å; N56-E60 PolarHBondContact O-N 3.1Å
57	E	79.9	Confident	75.3	Confident	147 Å²	147	73.4 Å²	73.4	69%	0.687	40%	0.398	S	S	*	.	H	α-helix	trans	-69.7	-38.2	-179.2	-169.1	174.4	-177.5	0	0	112	D55 V59 E60 K61	D55-E57 PolarHBondContact O-N 3.22Å; D55-E57 WeakPolarHBondContact OD1-CB 3.25Å; D55-E57 PolarHBondContact OD1-N 3.37Å; E57-V59 VanDerWaalsContact C-N 3.32Å; E57-V59 PolarHBondContact O-N 3.39Å; E57-E60 WeakPolarHBondContact O-CB 3.42Å; E57-E60 PolarHBondContact O-N 2.59Å; E57-K61 PolarHBondContact O-N 3.11Å
58	A	78.1	Confident	75.7	Confident	44 Å²	44	76.1 Å²	76.1	36%	0.364	42%	0.419	S	S	.	.	H	α-helix	trans	-64.5	-39.9	174	0	0	0	0	0	111.3	D55 K61 V62	D55-A58 HydrophobicContact CB-CB 4.13Å; D55-A58 PolarHBondContact O-N 2.9Å; A58-K61 PolarHBondContact O-N 3.13Å; A58-V62 WeakPolarHBondContact O-CG2 3.42Å; A58-V62 PolarHBondContact O-N 3.47Å
59	V	80.9	Confident	76.4	Confident	3 Å²	3	74.6 Å²	74.6	2%	0.018	40%	0.401	C	S	.	.	H	α-helix	trans	-68.3	-40.1	175.7	177.8	0	0	0	0	111.3	K39 D55 N56 E57 K61 V62 M63	K39-V59 HydrophobicContact CB-CG1 3.93Å; K39-V59 HydrophobicContact CB-CG2 4.35Å; K39-V59 HydrophobicContact CD-CG2 4.43Å; K39-V59 HydrophobicContact CG-CG1 4.42Å; K39-V59 HydrophobicContact CG-CG2 4.01Å; D55-V59 PolarHBondContact O-N 3.32Å; N56-V59 PolarHBondContact O-N 2.94Å; E57-V59 VanDerWaalsContact C-N 3.32Å; E57-V59 PolarHBondContact O-N 3.39Å; V59-K61 VanDerWaalsContact C-N 3.3Å; V59-K61 PolarHBondContact O-N 3.35Å; V59-V62 PolarHBondContact O-N 3.24Å; V59-M63 VanDerWaalsContact O-CB 3.28Å; V59-M63 WeakPolarHBondContact O-CB 3.33Å; V59-M63 PolarHBondContact O-N 3.18Å
60	E	83.4	Confident	77.4	Confident	81 Å²	81	74.9 Å²	74.9	38%	0.379	41%	0.411	S	S	.	.	H	α-helix	trans	-54.1	-49.3	170.6	-75.1	-67.9	159.3	0	0	110.9	R35 N56 E57 M63 N64	R35-E60 IonicContact CZ-OE1 2.7Å; R35-E60 IonicContact CZ-OE2 3Å; R35-E60 IonicContact NE-OE1 2.77Å; R35-E60 PolarHBondContact NE-OE1 3.05Å; R35-E60 IonicContact NE-OE2 3.79Å; R35-E60 IonicContact NH1-OE1 3.24Å; R35-E60 PolarHBondContact NH1-OE1 3.24Å; R35-E60 IonicContact NH1-OE2 2.66Å; R35-E60 PolarHBondContact NH1-OE2 3.24Å; R35-E60 IonicContact NH2-OE1 2.91Å; R35-E60 PolarHBondContact NH2-OE1 3.5Å; R35-E60 IonicContact NH2-OE2 3.27Å; R35-E60 PolarHBondContact NH2-OE2 3.13Å; N56-E60 WeakPolarHBondContact O-CG 3.48Å; N56-E60 PolarHBondContact O-N 3.1Å; E57-E60 WeakPolarHBondContact O-CB 3.42Å; E57-E60 PolarHBondContact O-N 2.59Å; E60-M63 PolarHBondContact O-N 3.06Å; E60-N64 WeakPolarHBondContact O-CB 3.47Å; E60-N64 PolarHBondContact O-N 2.92Å; E60-N64 PolarHBondContact O-ND2 3.47Å; E60-N64 VanDerWaalsContact O-ND2 3.14Å
61	K	83.3	Confident	78.4	Confident	140 Å²	140	75.9 Å²	75.9	61%	0.609	42%	0.417	S	S	*	.	H	α-helix	trans	-62.9	-47.3	-179.6	-168.9	-177.2	175	-166.5	0	111.8	E57 A58 V59 M63 N64 D65	E57-K61 PolarHBondContact O-N 3.11Å; A58-K61 PolarHBondContact O-N 3.13Å; V59-K61 VanDerWaalsContact C-N 3.3Å; V59-K61 PolarHBondContact O-N 3.35Å; K61-M63 VanDerWaalsContact C-N 3.33Å; K61-M63 PolarHBondContact O-N 2.87Å; K61-N64 PolarHBondContact O-N 3.36Å; K61-D65 WeakPolarHBondContact O-CB 3.32Å; K61-D65 PolarHBondContact O-N 2.85Å
62	V	83	Confident	79.8	Confident	32 Å²	32	75.2 Å²	75.2	19%	0.194	41%	0.41	C	S	.	.	H	α-helix	trans	-62.6	-41.7	177.9	173.8	0	0	0	0	111.1	L42 A58 V59 D65 L66 L82	L42-V62 HydrophobicContact CD1-CB 4.13Å; L42-V62 HydrophobicContact CD1-CG1 3.75Å; A58-V62 WeakPolarHBondContact O-CG2 3.42Å; A58-V62 PolarHBondContact O-N 3.47Å; V59-V62 PolarHBondContact O-N 3.24Å; V62-D65 PolarHBondContact O-N 3.05Å; V62-L66 HydrophobicContact CG1-CD1 3.69Å; V62-L66 HydrophobicContact CG1-CG 4.28Å; V62-L66 WeakPolarHBondContact O-CB 3.48Å; V62-L66 WeakPolarHBondContact O-CG 3.3Å; V62-L66 PolarHBondContact O-N 3.07Å; V62-L66 VanDerWaalsContact O-N 3.1Å; V62-L82 HydrophobicContact CG1-CD2 4.35Å
63	M	85.6	Confident	81.6	Confident	4 Å²	4	72 Å²	72	2%	0.02	39%	0.391	C	S	.	.	H	α-helix	trans	-57.7	-51.7	174.7	-171.9	81.6	-170.2	0	0	110.7	L38 V59 E60 K61 D65 L66 D67 G72 V74	L38-M63 HydrophobicContact CD2-CB 4.16Å; L38-M63 HydrophobicContact CD2-CG 4.47Å; L38-M63 HydrophobicContact CD2-SD 3.45Å; L38-M63 WeakPolarHBondContact CD2-SD 3.34Å; V59-M63 VanDerWaalsContact O-CB 3.28Å; V59-M63 WeakPolarHBondContact O-CB 3.33Å; V59-M63 PolarHBondContact O-N 3.18Å; E60-M63 PolarHBondContact O-N 3.06Å; K61-M63 VanDerWaalsContact C-N 3.33Å; K61-M63 PolarHBondContact O-N 2.87Å; M63-D65 VanDerWaalsContact C-N 3.25Å; M63-D65 PolarHBondContact O-N 3.38Å; M63-L66 PolarHBondContact O-N 3.47Å; M63-D67 HydrophobicContact CE-CB 4.39Å; M63-D67 VanDerWaalsContact O-CB 3.26Å; M63-D67 WeakPolarHBondContact O-CB 3.49Å; M63-D67 PolarHBondContact O-N 2.98Å; M63-G72 WeakPolarHBondContact CE-O 3.36Å; M63-V74 HydrophobicContact CE-CG2 3.72Å; M63-V74 HydrophobicContact SD-CG2 3.71Å
64	N	86	Confident	83.4	Confident	97 Å²	97	71.7 Å²	71.7	52%	0.519	39%	0.389	S	S	.	.	H	α-helix	trans	-64.6	-29.6	-178.8	-64.9	-24.8	0	0	0	113.1	E60 K61 L66	E60-N64 WeakPolarHBondContact O-CB 3.47Å; E60-N64 PolarHBondContact O-N 2.92Å; E60-N64 PolarHBondContact O-ND2 3.47Å; E60-N64 VanDerWaalsContact O-ND2 3.14Å; K61-N64 PolarHBondContact O-N 3.36Å; N64-L66 VanDerWaalsContact C-N 3.31Å
65	D	83.1	Confident	85.1	Confident	118 Å²	118	67.2 Å²	67.2	63%	0.631	37%	0.372	S	S	*	.	H	α-helix	trans	-75.9	-21.4	175.7	-70.4	-19.8	0	0	0	112	K61 V62 M63	K61-D65 WeakPolarHBondContact O-CB 3.32Å; K61-D65 PolarHBondContact O-N 2.85Å; V62-D65 PolarHBondContact O-N 3.05Å; M63-D65 VanDerWaalsContact C-N 3.25Å; M63-D65 PolarHBondContact O-N 3.38Å
66	L	84.2	Confident	86.3	Confident	13 Å²	13	66.4 Å²	66.4	7%	0.068	37%	0.365	C	S	.	.	H	α-helix	trans	-102.1	-39.4	-176.8	-67.5	178.6	0	0	0	114.9	L38 V62 M63 N64 A68 V74 E78 L82	L38-L66 HydrophobicContact CD2-CD1 4.49Å; V62-L66 HydrophobicContact CG1-CD1 3.69Å; V62-L66 HydrophobicContact CG1-CG 4.28Å; V62-L66 WeakPolarHBondContact O-CB 3.48Å; V62-L66 WeakPolarHBondContact O-CG 3.3Å; V62-L66 PolarHBondContact O-N 3.07Å; V62-L66 VanDerWaalsContact O-N 3.1Å; M63-L66 PolarHBondContact O-N 3.47Å; N64-L66 VanDerWaalsContact C-N 3.31Å; L66-A68 PolarHBondContact O-N 3.45Å; L66-V74 HydrophobicContact CB-CG1 4.48Å; L66-V74 HydrophobicContact CB-CG2 4.15Å; L66-E78 WeakPolarHBondContact O-CB 3.47Å; L66-E78 VanDerWaalsContact O-CG 3.29Å; L66-E78 WeakPolarHBondContact O-CG 3.29Å; L66-L82 HydrophobicContact CD1-CB 3.98Å; L66-L82 HydrophobicContact CD1-CD1 4.23Å; L66-L82 HydrophobicContact CD1-CD2 3.57Å; L66-L82 HydrophobicContact CD1-CG 4.08Å; L66-L82 HydrophobicContact CD2-CB 3.49Å; L66-L82 VanDerWaalsContact CD2-CB 3.49Å; L66-L82 HydrophobicContact CD2-CD1 3.94Å; L66-L82 HydrophobicContact CD2-CG 4.11Å; L66-L82 HydrophobicContact CG-CB 4.36Å; L66-L82 HydrophobicContact CG-CD1 4.44Å
67	D	87.1	Confident	87.2	Confident	11 Å²	11	66.2 Å²	66.2	6%	0.059	37%	0.367	C	S	.	.			trans	-70.8	74.8	177.5	178.2	8.9	0	0	0	109.3	M63 N69 N70 D71 G72	M63-D67 HydrophobicContact CE-CB 4.39Å; M63-D67 VanDerWaalsContact O-CB 3.26Å; M63-D67 WeakPolarHBondContact O-CB 3.49Å; M63-D67 PolarHBondContact O-N 2.98Å; D67-N69 VanDerWaalsContact C-N 3.27Å; D67-N69 PolarHBondContact O-N 3.29Å; D67-N69 PolarHBondContact OD1-OD1 2.89Å; D67-N70 VanDerWaalsContact CG-CA 3.5Å; D67-N70 PolarHBondContact O-N 2.87Å; D67-N70 WeakPolarHBondContact OD1-CA 3.33Å; D67-N70 PolarHBondContact OD1-N 3.34Å; D67-N70 WeakPolarHBondContact OD2-CA 3.39Å; D67-D71 PolarHBondContact OD1-N 3.17Å; D67-D71 PolarHBondContact OD2-N 2.71Å; D67-G72 VanDerWaalsContact OD2-CA 3.23Å; D67-G72 WeakPolarHBondContact OD2-CA 3.49Å; D67-G72 PolarHBondContact OD2-N 3.4Å
68	A	85.9	Confident	87.9	Confident	81 Å²	81	59.8 Å²	59.8	67%	0.669	34%	0.337	S	S	*	.	S	Bend	trans	-71.2	-30	-171.8	0	0	0	0	0	111	L66 N70 E78	L66-A68 PolarHBondContact O-N 3.45Å; A68-N70 PolarHBondContact O-ND2 2.9Å; A68-E78 PolarHBondContact N-OE1 3.46Å
69	N	89.1	Confident	88.6	Confident	88 Å²	88	57.9 Å²	57.9	47%	0.471	32%	0.32	S	S	.	.	S	Bend	trans	-86.2	-9.7	178.4	75.5	8.9	0	0	0	112.9	D67 D71	D67-N69 VanDerWaalsContact C-N 3.27Å; D67-N69 PolarHBondContact O-N 3.29Å; D67-N69 PolarHBondContact OD1-OD1 2.89Å; N69-D71 PolarHBondContact ND2-OD2 3.19Å; N69-D71 VanDerWaalsContact OD1-CB 3.3Å; N69-D71 WeakPolarHBondContact OD1-CB 3.31Å; N69-D71 PolarHBondContact OD1-N 2.96Å; N69-D71 PolarHBondContact OD1-OD1 3.12Å; N69-D71 PolarHBondContact OD1-OD2 2.95Å
70	N	88.1	Confident	89.2	Confident	131 Å²	131	60.5 Å²	60.5	70%	0.701	33%	0.333	S	S	*	.			trans	58.9	39.9	-178.2	-61.7	-95.5	0	0	0	113.4	D67 A68	D67-N70 VanDerWaalsContact CG-CA 3.5Å; D67-N70 PolarHBondContact O-N 2.87Å; D67-N70 WeakPolarHBondContact OD1-CA 3.33Å; D67-N70 PolarHBondContact OD1-N 3.34Å; D67-N70 WeakPolarHBondContact OD2-CA 3.39Å; A68-N70 PolarHBondContact O-ND2 2.9Å
71	D	90.1	Very high	89.5	Confident	87 Å²	87	61.9 Å²	61.9	47%	0.465	34%	0.343	S	S	.	.	S	Bend	trans	-89.9	-7.3	175.9	73.2	15.4	0	0	0	113.6	D67 N69 E73	D67-D71 PolarHBondContact OD1-N 3.17Å; D67-D71 PolarHBondContact OD2-N 2.71Å; N69-D71 PolarHBondContact ND2-OD2 3.19Å; N69-D71 VanDerWaalsContact OD1-CB 3.3Å; N69-D71 WeakPolarHBondContact OD1-CB 3.31Å; N69-D71 PolarHBondContact OD1-N 2.96Å; N69-D71 PolarHBondContact OD1-OD1 3.12Å; N69-D71 PolarHBondContact OD1-OD2 2.95Å; D71-E73 VanDerWaalsContact C-N 3.33Å; D71-E73 WeakPolarHBondContact OD1-CA 3.43Å; D71-E73 PolarHBondContact OD1-N 3.35Å
72	G	89.5	Confident	89.6	Confident	42 Å²	42	56.4 Å²	56.4	43%	0.433	32%	0.32	S	S	.	.	S	Bend	trans	83.1	8.4	179.4	0	0	0	0	0	114.1	M63 D67	M63-G72 WeakPolarHBondContact CE-O 3.36Å; D67-G72 VanDerWaalsContact OD2-CA 3.23Å; D67-G72 WeakPolarHBondContact OD2-CA 3.49Å; D67-G72 PolarHBondContact OD2-N 3.4Å
73	E	93.3	Very high	89.9	Confident	56 Å²	56	56 Å²	56	26%	0.262	32%	0.316	S	S	.	.	S	Bend	trans	-125.7	170.6	173.7	-55.8	-169.6	160.6	0	0	110.1	T32 L33 D71	T32-E73 VanDerWaalsContact CB-OE2 3.31Å; T32-E73 WeakPolarHBondContact CB-OE2 3.33Å; T32-E73 HydrophobicContact CG2-CB 4.27Å; T32-E73 WeakPolarHBondContact CG2-OE2 3.19Å; T32-E73 PolarHBondContact OG1-OE2 3.38Å; L33-E73 CarbonylContact O-C 3.27Å; L33-E73 WeakPolarHBondContact O-CA 3.27Å; D71-E73 VanDerWaalsContact C-N 3.33Å; D71-E73 WeakPolarHBondContact OD1-CA 3.43Å; D71-E73 PolarHBondContact OD1-N 3.35Å
74	V	94.6	Very high	90.1	Very high	0 Å²	0	57.6 Å²	57.6	0%	0	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	113.9	175.5	175.5	0	0	0	0	109.4	T32 L33 L38 M63 L66 E78 F79	T32-V74 CarbonylContact C-O 3.6Å; T32-V74 VanDerWaalsContact CA-O 3.31Å; T32-V74 WeakPolarHBondContact CA-O 3.28Å; L33-V74 HydrophobicContact CB-CB 4.26Å; L33-V74 PolarHBondContact N-O 3.46Å; L33-V74 PolarHBondContact O-N 2.89Å; L38-V74 HydrophobicContact CD2-CG2 4.11Å; M63-V74 HydrophobicContact CE-CG2 3.72Å; M63-V74 HydrophobicContact SD-CG2 3.71Å; L66-V74 HydrophobicContact CB-CG1 4.48Å; L66-V74 HydrophobicContact CB-CG2 4.15Å; V74-E78 WeakPolarHBondContact CA-OE2 3.45Å; V74-E78 HydrophobicContact CG1-CB 3.74Å; V74-F79 HydrophobicContact CG1-CB 4.27Å
75	D	95.6	Very high	90	Very high	53 Å²	53	55.8 Å²	55.8	28%	0.283	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.1	174.3	176.5	85.2	14.9	0	0	0	112.5	T32 T77 E78 F79	T32-D75 HydrophobicContact CG2-CB 4.3Å; D75-T77 VanDerWaalsContact C-N 3.26Å; D75-T77 PolarHBondContact O-N 3.19Å; D75-T77 VanDerWaalsContact OD1-CA 3.26Å; D75-T77 WeakPolarHBondContact OD1-CA 3.5Å; D75-T77 WeakPolarHBondContact OD1-CB 3.44Å; D75-T77 PolarHBondContact OD1-N 2.68Å; D75-E78 PolarHBondContact N-OE2 3.04Å; D75-E78 PolarHBondContact O-N 3.01Å; D75-E78 PolarHBondContact OD1-N 2.94Å; D75-F79 WeakPolarHBondContact O-CB 3.34Å; D75-F79 PolarHBondContact O-N 3.31Å
76	F	95.3	Very high	90	Very high	71 Å²	71	51.8 Å²	51.8	31%	0.311	31%	0.31	S	S	.	.	H	α-helix	trans	-63.9	-31.1	-179.1	-174	-104.7	0	0	0	113.5	I17 F20 F79 I80	I17-F76 HydrophobicContact CB-CZ 4.49Å; I17-F76 HydrophobicContact CG1-CE1 4.35Å; I17-F76 HydrophobicContact CG1-CE2 4.07Å; I17-F76 HydrophobicContact CG1-CZ 3.57Å; F20-F76 HydrophobicContact CB-CD2 3.86Å; F20-F76 HydrophobicContact CB-CE2 3.96Å; F20-F76 AromaticContact CD1-CD2 3.78Å; F20-F76 HydrophobicContact CD1-CD2 3.78Å; F20-F76 AromaticContact CD2-CD2 3.95Å; F20-F76 HydrophobicContact CD2-CD2 3.95Å; F20-F76 HydrophobicContact CE1-CB 4.19Å; F20-F76 HydrophobicContact CE1-CD2 4.3Å; F20-F76 HydrophobicContact CE2-CB 4.42Å; F20-F76 HydrophobicContact CE2-CD2 4.43Å; F20-F76 AromaticContact CG-CD2 3.59Å; F20-F76 HydrophobicContact CG-CD2 3.59Å; F20-F76 HydrophobicContact CG-CE2 4.21Å; F20-F76 HydrophobicContact CZ-CB 4.14Å; F76-F79 HydrophobicContact CD2-CD1 4.06Å; F76-F79 AromaticContact CE2-CD1 3.95Å; F76-F79 HydrophobicContact CE2-CD1 3.95Å; F76-F79 HydrophobicContact CE2-CE1 4.25Å; F76-I80 HydrophobicContact CD1-CG1 4.3Å; F76-I80 HydrophobicContact CE1-CG1 3.7Å; F76-I80 HydrophobicContact CE2-CD1 4.37Å; F76-I80 HydrophobicContact CE2-CG1 4.07Å; F76-I80 HydrophobicContact CZ-CD1 3.98Å; F76-I80 HydrophobicContact CZ-CG1 3.57Å; F76-I80 PolarHBondContact O-N 2.98Å
77	T	95.1	Very high	90.1	Very high	91 Å²	91	55.6 Å²	55.6	56%	0.558	33%	0.334	S	S	*	.	H	α-helix	trans	-66.7	-48.9	178	-50.1	0	0	0	0	109.8	D75 I80 I81	D75-T77 VanDerWaalsContact C-N 3.26Å; D75-T77 PolarHBondContact O-N 3.19Å; D75-T77 VanDerWaalsContact OD1-CA 3.26Å; D75-T77 WeakPolarHBondContact OD1-CA 3.5Å; D75-T77 WeakPolarHBondContact OD1-CB 3.44Å; D75-T77 PolarHBondContact OD1-N 2.68Å; T77-I80 PolarHBondContact O-N 2.92Å; T77-I81 HydrophobicContact CG2-CD1 4.26Å; T77-I81 WeakPolarHBondContact O-CG1 3.44Å; T77-I81 PolarHBondContact O-N 3.18Å
78	E	94.2	Very high	90.1	Very high	13 Å²	13	59 Å²	59	6%	0.061	36%	0.355	C	S	.	.	H	α-helix	trans	-62.4	-42.7	178.1	-68.4	169.7	147	0	0	111.2	L66 A68 V74 D75 I80 I81 L82	L66-E78 WeakPolarHBondContact O-CB 3.47Å; L66-E78 VanDerWaalsContact O-CG 3.29Å; L66-E78 WeakPolarHBondContact O-CG 3.29Å; A68-E78 PolarHBondContact N-OE1 3.46Å; V74-E78 WeakPolarHBondContact CA-OE2 3.45Å; V74-E78 HydrophobicContact CG1-CB 3.74Å; D75-E78 PolarHBondContact N-OE2 3.04Å; D75-E78 PolarHBondContact O-N 3.01Å; D75-E78 PolarHBondContact OD1-N 2.94Å; E78-I80 PolarHBondContact O-N 2.83Å; E78-I81 PolarHBondContact O-N 3.4Å; E78-L82 PolarHBondContact O-N 2.93Å
79	F	92.9	Very high	89.8	Confident	3 Å²	3	58 Å²	58	1%	0.013	35%	0.346	C	S	.	.	H	α-helix	trans	-57	-46.2	172.6	168.8	-103.8	0	0	0	113	F20 L33 L41 V74 D75 F76 I81 L82 M83	F20-F79 HydrophobicContact CB-CD1 4.09Å; F20-F79 HydrophobicContact CB-CE1 4Å; F20-F79 HydrophobicContact CB-CZ 4.49Å; F20-F79 HydrophobicContact CD2-CB 3.73Å; F20-F79 AromaticContact CD2-CD1 3.75Å; F20-F79 HydrophobicContact CD2-CD1 3.75Å; F20-F79 HydrophobicContact CD2-CD2 4.15Å; F20-F79 HydrophobicContact CD2-CE1 4.41Å; F20-F79 AromaticContact CD2-CG 3.59Å; F20-F79 HydrophobicContact CD2-CG 3.59Å; F20-F79 HydrophobicContact CE2-CB 3.86Å; F20-F79 HydrophobicContact CE2-CG 4.23Å; F20-F79 HydrophobicContact CG-CD1 4.3Å; L33-F79 HydrophobicContact CD1-CD2 4.38Å; L41-F79 HydrophobicContact CD1-CD2 4.34Å; L41-F79 HydrophobicContact CD1-CE2 3.81Å; L41-F79 HydrophobicContact CD2-CE2 4.17Å; V74-F79 HydrophobicContact CG1-CB 4.27Å; D75-F79 WeakPolarHBondContact O-CB 3.34Å; D75-F79 PolarHBondContact O-N 3.31Å; F76-F79 HydrophobicContact CD2-CD1 4.06Å; F76-F79 AromaticContact CE2-CD1 3.95Å; F76-F79 HydrophobicContact CE2-CD1 3.95Å; F76-F79 HydrophobicContact CE2-CE1 4.25Å; F79-I81 VanDerWaalsContact C-N 3.33Å; F79-I81 PolarHBondContact O-N 3.15Å; F79-L82 WeakPolarHBondContact O-CB 3.13Å; F79-L82 PolarHBondContact O-N 3.12Å; F79-M83 HydrophobicContact CD1-CG 4.47Å; F79-M83 HydrophobicContact CD2-CG 4.46Å; F79-M83 HydrophobicContact CE1-CG 3.96Å; F79-M83 HydrophobicContact CE2-CE 4.02Å; F79-M83 HydrophobicContact CE2-CG 3.94Å; F79-M83 HydrophobicContact CE2-SD 4.1Å; F79-M83 HydrophobicContact CZ-CG 3.66Å; F79-M83 HydrophobicContact CZ-SD 4.04Å; F79-M83 WeakPolarHBondContact O-CG 3.44Å; F79-M83 PolarHBondContact O-N 3.07Å; F79-M83 VanDerWaalsContact O-N 3.13Å
80	I	93.3	Very high	89.3	Confident	58 Å²	58	55.1 Å²	55.1	30%	0.297	33%	0.333	S	S	.	.	H	α-helix	trans	-69.1	-32.1	-179.6	-79.8	-52.2	0	0	0	112.5	L16 F76 T77 E78 L82 M83 G84	L16-I80 HydrophobicContact CB-CD1 4Å; L16-I80 HydrophobicContact CD1-CD1 3.85Å; L16-I80 HydrophobicContact CD2-CD1 4.32Å; L16-I80 HydrophobicContact CG-CD1 4.28Å; F76-I80 HydrophobicContact CD1-CG1 4.3Å; F76-I80 HydrophobicContact CE1-CG1 3.7Å; F76-I80 HydrophobicContact CE2-CD1 4.37Å; F76-I80 HydrophobicContact CE2-CG1 4.07Å; F76-I80 HydrophobicContact CZ-CD1 3.98Å; F76-I80 HydrophobicContact CZ-CG1 3.57Å; F76-I80 PolarHBondContact O-N 2.98Å; T77-I80 PolarHBondContact O-N 2.92Å; E78-I80 PolarHBondContact O-N 2.83Å; I80-L82 VanDerWaalsContact C-N 3.3Å; I80-L82 PolarHBondContact O-N 3.32Å; I80-M83 HydrophobicContact CD1-CB 4.44Å; I80-M83 HydrophobicContact CD1-CG 4.49Å; I80-M83 PolarHBondContact O-N 3.37Å; I80-G84 PolarHBondContact O-N 3.44Å
81	I	90	Very high	88.9	Confident	111 Å²	111	52.7 Å²	52.7	57%	0.569	32%	0.32	S	S	*	.	H	α-helix	trans	-60.8	-42.6	173.1	-69.6	165.8	0	0	0	110.1	T77 E78 F79 M83 G84 A85	T77-I81 HydrophobicContact CG2-CD1 4.26Å; T77-I81 WeakPolarHBondContact O-CG1 3.44Å; T77-I81 PolarHBondContact O-N 3.18Å; E78-I81 PolarHBondContact O-N 3.4Å; F79-I81 VanDerWaalsContact C-N 3.33Å; F79-I81 PolarHBondContact O-N 3.15Å; I81-M83 PolarHBondContact O-N 2.89Å; I81-G84 PolarHBondContact O-N 2.88Å; I81-A85 PolarHBondContact O-N 2.69Å
82	L	85.1	Confident	88.1	Confident	25 Å²	25	52.4 Å²	52.4	13%	0.131	32%	0.319	C	S	.	.	H	α-helix	trans	-57.3	-51	172.3	-174	59.6	0	0	0	111.7	L42 V62 L66 E78 F79 I80 G84 A85 L86	L42-L82 HydrophobicContact CD2-CD2 4.1Å; V62-L82 HydrophobicContact CG1-CD2 4.35Å; L66-L82 HydrophobicContact CD1-CB 3.98Å; L66-L82 HydrophobicContact CD1-CD1 4.23Å; L66-L82 HydrophobicContact CD1-CD2 3.57Å; L66-L82 HydrophobicContact CD1-CG 4.08Å; L66-L82 HydrophobicContact CD2-CB 3.49Å; L66-L82 VanDerWaalsContact CD2-CB 3.49Å; L66-L82 HydrophobicContact CD2-CD1 3.94Å; L66-L82 HydrophobicContact CD2-CG 4.11Å; L66-L82 HydrophobicContact CG-CB 4.36Å; L66-L82 HydrophobicContact CG-CD1 4.44Å; E78-L82 PolarHBondContact O-N 2.93Å; F79-L82 WeakPolarHBondContact O-CB 3.13Å; F79-L82 PolarHBondContact O-N 3.12Å; I80-L82 VanDerWaalsContact C-N 3.3Å; I80-L82 PolarHBondContact O-N 3.32Å; L82-G84 PolarHBondContact O-N 2.95Å; L82-A85 PolarHBondContact O-N 3.47Å; L82-A85 VanDerWaalsContact O-N 3.13Å; L82-L86 HydrophobicContact CD1-CD1 4.31Å; L82-L86 HydrophobicContact CD1-CG 4.28Å; L82-L86 HydrophobicContact CD2-CD1 4.43Å; L82-L86 HydrophobicContact CG-CD1 4.02Å; L82-L86 HydrophobicContact CG-CG 4.37Å; L82-L86 WeakPolarHBondContact O-CG 3.5Å; L82-L86 PolarHBondContact O-N 2.92Å
83	M	89.4	Confident	86.8	Confident	24 Å²	24	57.1 Å²	57.1	12%	0.118	33%	0.327	C	S	.	.	H	α-helix	trans	-62.5	-37.6	-176	-65.9	-59.7	101.4	0	0	110.8	L16 L46 F79 I80 I81 L86 T87	L16-M83 HydrophobicContact CD2-CB 4.21Å; L16-M83 HydrophobicContact CD2-CG 3.91Å; L16-M83 HydrophobicContact CD2-SD 4.42Å; L46-M83 HydrophobicContact CD1-CE 3.88Å; F79-M83 HydrophobicContact CD1-CG 4.47Å; F79-M83 HydrophobicContact CD2-CG 4.46Å; F79-M83 HydrophobicContact CE1-CG 3.96Å; F79-M83 HydrophobicContact CE2-CE 4.02Å; F79-M83 HydrophobicContact CE2-CG 3.94Å; F79-M83 HydrophobicContact CE2-SD 4.1Å; F79-M83 HydrophobicContact CZ-CG 3.66Å; F79-M83 HydrophobicContact CZ-SD 4.04Å; F79-M83 WeakPolarHBondContact O-CG 3.44Å; F79-M83 PolarHBondContact O-N 3.07Å; F79-M83 VanDerWaalsContact O-N 3.13Å; I80-M83 HydrophobicContact CD1-CB 4.44Å; I80-M83 HydrophobicContact CD1-CG 4.49Å; I80-M83 PolarHBondContact O-N 3.37Å; I81-M83 PolarHBondContact O-N 2.89Å; M83-L86 HydrophobicContact CE-CD1 3.74Å; M83-T87 VanDerWaalsContact O-CB 3.27Å; M83-T87 WeakPolarHBondContact O-CB 3.35Å; M83-T87 PolarHBondContact O-N 3.46Å; M83-T87 PolarHBondContact O-OG1 2.66Å
84	G	89.8	Confident	85	Confident	36 Å²	36	61.3 Å²	61.3	37%	0.371	35%	0.345	S	S	.	.	H	α-helix	trans	-60.7	-50.8	171.1	0	0	0	0	0	112.1	I80 I81 L82 L86 T87 V88	I80-G84 PolarHBondContact O-N 3.44Å; I81-G84 PolarHBondContact O-N 2.88Å; L82-G84 PolarHBondContact O-N 2.95Å; G84-L86 PolarHBondContact O-N 3.01Å; G84-T87 PolarHBondContact O-N 3.37Å; G84-V88 WeakPolarHBondContact O-CG2 3.44Å; G84-V88 PolarHBondContact O-N 3.3Å
85	A	84.6	Confident	83.3	Confident	60 Å²	60	65.4 Å²	65.4	50%	0.496	37%	0.367	S	S	.	.	H	α-helix	trans	-60.4	-45.5	179.6	0	0	0	0	0	112.3	I81 L82 V88 A89	I81-A85 PolarHBondContact O-N 2.69Å; L82-A85 PolarHBondContact O-N 3.47Å; L82-A85 VanDerWaalsContact O-N 3.13Å; A85-V88 PolarHBondContact O-N 2.91Å; A85-A89 PolarHBondContact O-N 2.97Å
86	L	82.6	Confident	81.4	Confident	34 Å²	34	69.9 Å²	69.9	18%	0.178	39%	0.39	C	S	.	.	H	α-helix	trans	-60.7	-45.9	174.1	-70.6	174.2	0	0	0	111	L46 L50 L82 M83 G84 V88 A89 C90	L46-L86 HydrophobicContact CD1-CD1 3.88Å; L50-L86 HydrophobicContact CD2-CD2 4.38Å; L82-L86 HydrophobicContact CD1-CD1 4.31Å; L82-L86 HydrophobicContact CD1-CG 4.28Å; L82-L86 HydrophobicContact CD2-CD1 4.43Å; L82-L86 HydrophobicContact CG-CD1 4.02Å; L82-L86 HydrophobicContact CG-CG 4.37Å; L82-L86 WeakPolarHBondContact O-CG 3.5Å; L82-L86 PolarHBondContact O-N 2.92Å; M83-L86 HydrophobicContact CE-CD1 3.74Å; G84-L86 PolarHBondContact O-N 3.01Å; L86-V88 VanDerWaalsContact C-N 3.31Å; L86-V88 PolarHBondContact O-N 3.43Å; L86-A89 PolarHBondContact O-N 3.44Å; L86-C90 PolarHBondContact O-N 2.93Å; L86-C90 PolarHBondContact O-SG 3.49Å
87	T	87.6	Confident	79.4	Confident	92 Å²	92	69.7 Å²	69.7	56%	0.564	40%	0.398	S	S	*	.	H	α-helix	trans	-61.2	-39.7	179.1	-59.3	0	0	0	0	112	M83 G84 C90 N91	M83-T87 VanDerWaalsContact O-CB 3.27Å; M83-T87 WeakPolarHBondContact O-CB 3.35Å; M83-T87 PolarHBondContact O-N 3.46Å; M83-T87 PolarHBondContact O-OG1 2.66Å; G84-T87 PolarHBondContact O-N 3.37Å; T87-C90 WeakPolarHBondContact O-CB 3.3Å; T87-C90 PolarHBondContact O-N 3.29Å; T87-N91 VanDerWaalsContact O-CB 3.29Å; T87-N91 WeakPolarHBondContact O-CB 3.37Å; T87-N91 PolarHBondContact O-N 3.43Å
88	V	86.4	Confident	77.3	Confident	84 Å²	84	72.2 Å²	72.2	51%	0.509	40%	0.401	S	S	.	.	H	α-helix	trans	-64.2	-47.5	174.6	171.5	0	0	0	0	110.5	G84 A85 L86 C90 N91 D92	G84-V88 WeakPolarHBondContact O-CG2 3.44Å; G84-V88 PolarHBondContact O-N 3.3Å; A85-V88 PolarHBondContact O-N 2.91Å; L86-V88 VanDerWaalsContact C-N 3.31Å; L86-V88 PolarHBondContact O-N 3.43Å; V88-C90 VanDerWaalsContact C-N 3.32Å; V88-C90 PolarHBondContact O-N 2.92Å; V88-N91 WeakPolarHBondContact O-CB 3.5Å; V88-N91 PolarHBondContact O-N 3.21Å; V88-N91 VanDerWaalsContact O-N 3.07Å; V88-D92 PolarHBondContact O-N 2.93Å
89	A	80.1	Confident	75.3	Confident	58 Å²	58	77.2 Å²	77.2	48%	0.479	44%	0.435	S	S	.	.	H	α-helix	trans	-60.1	-40.6	176.8	0	0	0	0	0	112.4	A85 L86 F93	A85-A89 PolarHBondContact O-N 2.97Å; L86-A89 PolarHBondContact O-N 3.44Å; A89-F93 PolarHBondContact O-N 3.33Å
90	C	77	Confident	73.4	Confident	29 Å²	29	84.1 Å²	84.1	20%	0.196	47%	0.472	C	S	.	.	H	α-helix	trans	-59.8	-48.5	171.6	-61.7	0	0	0	0	111	Y49 L86 T87 V88 D92 F93 F94	Y49-C90 PolarHBondContact OH-SG 3.14Å; L86-C90 PolarHBondContact O-N 2.93Å; L86-C90 PolarHBondContact O-SG 3.49Å; T87-C90 WeakPolarHBondContact O-CB 3.3Å; T87-C90 PolarHBondContact O-N 3.29Å; V88-C90 VanDerWaalsContact C-N 3.32Å; V88-C90 PolarHBondContact O-N 2.92Å; C90-D92 PolarHBondContact O-N 3.4Å; C90-F93 WeakPolarHBondContact O-CB 3.23Å; C90-F93 PolarHBondContact O-N 3.24Å; C90-F94 WeakPolarHBondContact O-CD2 3.37Å; C90-F94 PolarHBondContact O-N 3.23Å
91	N	80.5	Confident	71.6	Confident	80 Å²	80	88.9 Å²	88.9	43%	0.428	50%	0.498	S	S	.	.	H	α-helix	trans	-61.3	-43.6	-177.1	174.8	80.1	0	0	0	111.7	T87 V88 F93 F94 L95	T87-N91 VanDerWaalsContact O-CB 3.29Å; T87-N91 WeakPolarHBondContact O-CB 3.37Å; T87-N91 PolarHBondContact O-N 3.43Å; V88-N91 WeakPolarHBondContact O-CB 3.5Å; V88-N91 PolarHBondContact O-N 3.21Å; V88-N91 VanDerWaalsContact O-N 3.07Å; N91-F93 VanDerWaalsContact C-N 3.34Å; N91-F93 PolarHBondContact O-N 3.38Å; N91-F94 PolarHBondContact O-N 2.55Å; N91-F94 VanDerWaalsContact O-N 3.14Å; N91-L95 WeakPolarHBondContact ND2-CD1 3.18Å; N91-L95 WeakPolarHBondContact O-CG 3.49Å; N91-L95 PolarHBondContact O-N 2.76Å
92	D	72.9	Confident	69.8	Low	81 Å²	81	92.9 Å²	92.9	43%	0.433	51%	0.511	S	S	.	.	H	α-helix	trans	-63.2	-42.5	177.9	-66.8	-11.2	0	0	0	110.9	V88 C90 F94 L95 D96	V88-D92 PolarHBondContact O-N 2.93Å; C90-D92 PolarHBondContact O-N 3.4Å; D92-F94 VanDerWaalsContact C-N 3.29Å; D92-F94 PolarHBondContact O-N 3.45Å; D92-L95 PolarHBondContact O-N 2.96Å; D92-L95 VanDerWaalsContact O-N 3.12Å; D92-D96 WeakPolarHBondContact O-CB 3.16Å; D92-D96 PolarHBondContact O-N 3.17Å
93	F	62.5	Low	67.9	Low	140 Å²	140	94.2 Å²	94.2	61%	0.614	53%	0.531	S	S	*	.	H	α-helix	trans	-58.5	-38.5	172.8	-178.5	-93.6	0	0	0	112.8	A89 C90 N91 S97	A89-F93 PolarHBondContact O-N 3.33Å; C90-F93 WeakPolarHBondContact O-CB 3.23Å; C90-F93 PolarHBondContact O-N 3.24Å; N91-F93 VanDerWaalsContact C-N 3.34Å; N91-F93 PolarHBondContact O-N 3.38Å; F93-S97 WeakPolarHBondContact O-CB 3.45Å; F93-S97 PolarHBondContact O-N 3.23Å; F93-S97 PolarHBondContact O-OG 3.34Å
94	F	55.7	Low	66.2	Low	145 Å²	145	102.5 Å²	102.5	64%	0.636	57%	0.566	S	S	*	*	H	α-helix	trans	-74.7	-26.2	176.6	-83.6	-70.7	0	0	0	113.8	C90 N91 D92 S97	C90-F94 WeakPolarHBondContact O-CD2 3.37Å; C90-F94 PolarHBondContact O-N 3.23Å; N91-F94 PolarHBondContact O-N 2.55Å; N91-F94 VanDerWaalsContact O-N 3.14Å; D92-F94 VanDerWaalsContact C-N 3.29Å; D92-F94 PolarHBondContact O-N 3.45Å; F94-S97 WeakPolarHBondContact CA-OG 3.09Å; F94-S97 PolarHBondContact O-OG 3.22Å
95	L	58.9	Low	64.2	Low	86 Å²	86	108.9 Å²	108.9	45%	0.45	59%	0.592	S	S	.	*	H	α-helix	trans	-81.5	-34.8	177	-70.6	177.1	0	0	0	112.4	N91 D92 S97	N91-L95 WeakPolarHBondContact ND2-CD1 3.18Å; N91-L95 WeakPolarHBondContact O-CG 3.49Å; N91-L95 PolarHBondContact O-N 2.76Å; D92-L95 PolarHBondContact O-N 2.96Å; D92-L95 VanDerWaalsContact O-N 3.12Å; L95-S97 VanDerWaalsContact C-N 3.31Å
96	D	56.2	Low	62.3	Low	146 Å²	146	109.5 Å²	109.5	78%	0.781	61%	0.605	S	S	*	*	H	α-helix	trans	-75.8	-17.5	177.2	-78.8	-7.2	0	0	0	113.4	D92	D92-D96 WeakPolarHBondContact O-CB 3.16Å; D92-D96 PolarHBondContact O-N 3.17Å
97	S	53.7	Low	60.8	Low	67 Å²	67	112.9 Å²	112.9	47%	0.469	64%	0.637	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.4	17.9	-179.9	46.6	0	0	0	0	114.6	F93 F94 L95 P99	F93-S97 WeakPolarHBondContact O-CB 3.45Å; F93-S97 PolarHBondContact O-N 3.23Å; F93-S97 PolarHBondContact O-OG 3.34Å; F94-S97 WeakPolarHBondContact CA-OG 3.09Å; F94-S97 PolarHBondContact O-OG 3.22Å; L95-S97 VanDerWaalsContact C-N 3.31Å; S97-P99 WeakPolarHBondContact O-CD 3.47Å
98	K	49.3	Very low	58.8	Low	144 Å²	144	116.5 Å²	116.5	63%	0.626	65%	0.648	S	S	*	*			trans	-60.7	125.1	167.7	-79.6	-163.4	-178.5	71.1	0	109.1	D100	K98-D100 PolarHBondContact O-N 3.06Å
99	P	53	Low	57.2	Low	119 Å²	119	122 Å²	122	77%	0.773	67%	0.665	S	S	*	*			trans	-63	126.2	170.2	26.7	-30.3	0	0	0	107.1	S97 D101	S97-P99 WeakPolarHBondContact O-CD 3.47Å; P99-D101 PolarHBondContact O-N 3.23Å
100	D	53.6	Low	55.7	Low	148 Å²	148	127.4 Å²	127.4	79%	0.791	68%	0.677	S	S	*	*			trans	-45.3	119.4	172.7	-70	-52.3	0	0	0	109.6	K98 K102	K98-D100 PolarHBondContact O-N 3.06Å; D100-K102 PolarHBondContact O-N 2.82Å
101	D	54.8	Low	54.7	Low	157 Å²	157	136.9 Å²	136.9	84%	0.84	73%	0.726	S	S	*	*			trans	-61.4	90.7	161.3	-176.9	29.7	0	0	0	106.8	P99 G103	P99-D101 PolarHBondContact O-N 3.23Å; D101-G103 PolarHBondContact O-N 2.83Å
102	K	51.9	Low	53.4	Low	195 Å²	195	139.8 Å²	139.8	85%	0.848	74%	0.741	S	S	*	*			trans	-70.1	81.2	163.8	-79.3	-168	179.4	178.2	0	107.4	D100 K104	D100-K102 PolarHBondContact O-N 2.82Å; K102-K104 PolarHBondContact O-N 3.47Å
103	G	44.9	Very low	52.4	Low	54 Å²	54	142.8 Å²	142.8	56%	0.557	76%	0.758	S	S	*	*			trans	-46.1	130.9	161.8	0	0	0	0	0	110.1	D101 D105	D101-G103 PolarHBondContact O-N 2.83Å; G103-D105 PolarHBondContact O-N 3.4Å
104	K	54.1	Low	51.9	Low	197 Å²	197	143 Å²	143	86%	0.857	77%	0.766	S	S	*	*			trans	-52.5	129.2	159.9	-71.7	171	174.3	172.6	0	109.1	K102	K102-K104 PolarHBondContact O-N 3.47Å
105	D	48.3	Very low	51.6	Low	171 Å²	171	142.9 Å²	142.9	91%	0.914	77%	0.773	S	S	*	*			trans	174.8	135.7	142.7	-81.6	-24.4	0	0	0	105.9	G103	G103-D105 PolarHBondContact O-N 3.4Å
106	G	43.6	Very low	51.2	Low	73 Å²	73	146.4 Å²	146.4	75%	0.753	79%	0.793	S	S	*	*			cis	-159.8	170.8	8.8	0	0	0	0	0	109.5
107	A	51.6	Low	50.8	Low	105 Å²	105	146.5 Å²	146.5	87%	0.868	79%	0.794	S	S	*	*			trans	-67.5	144.7	179.9	0	0	0	0	0	113
108	E	45.1	Very low	50.6	Low	168 Å²	168	152.1 Å²	152.1	79%	0.785	82%	0.817	S	S	*	*			trans	-145.3	113.8	142.7	-149.3	172.5	133.2	0	0	110.1
109	K	52.5	Low	50.7	Low	199 Å²	199	152.8 Å²	152.8	87%	0.865	83%	0.832	S	S	*	*			trans	-57.4	141.3	161.8	-79.4	173.5	169.8	176.9	0	108.7
110	K	49.6	Very low	50.5	Low	171 Å²	171	155.6 Å²	155.6	74%	0.743	84%	0.837	S	S	*	*			trans	-145.5	109.8	147.6	-108.9	171.4	-173.2	167.9	0	110
111	D	56.7	Low	50.3	Low	229 Å²	229	156.3 Å²	156.3	100%	1.225	84%	0.841	S	S	*	*			trans	48.9	0	150.2	-49.4	-40.7	0	0	0	120.3

Retrieved 111 of 111 residues in 98.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).