A0A087XWK0_POEFO Loading...

Alpha-synuclein-like

AlphaFold DB , UniProt , Accession A0A087XWK0, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 127 aa.

						>A0A087XWK0_POEFO|A0A087XWK0
MDALMKGFSKAKDGVVAAAEKTKQGVTGAAEMTKDGVMYVGTKTKDGVSTVAEKTVSGVSHVGGAVVTGVTAVAQKTVEGAGNIAAATGLVKKDPAKQGEDVSAVPDAVESPVDTDSTEPTEEDSDD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.7	Low	74	Confident	216 Å²	216	124.6 Å²	124.6	100%	1.064	68%	0.675	S	S	*	*				0	-33.2	0	-116.2	166.7	-155.5	0	112.6	A3 M5	M1-A3 PolarHBondContact O-N 2.91Å; M1-M5 PolarHBondContact O-N 2.86Å
2	D	73.7	Confident	74.2	Confident	135 Å²	135	125.4 Å²	125.4	72%	0.722	67%	0.667	S	S	*	*	H	α-helix	trans	-59.3	-43.7	-178.3	-94.2	-80.1	0	0	117.3	L4 M5 K6	D2-L4 VanDerWaalsContact C-N 3.25Å; D2-L4 PolarHBondContact O-N 3.3Å; D2-M5 PolarHBondContact O-N 2.76Å; D2-K6 WeakPolarHBondContact O-CB 3.39Å; D2-K6 PolarHBondContact O-N 3.49Å
3	A	72.4	Confident	74.6	Confident	87 Å²	87	124.1 Å²	124.1	72%	0.719	66%	0.66	S	S	*	*	H	α-helix	trans	-64	-31.8	-175.2	0	0	0	0	112.9	M1 G7	M1-A3 PolarHBondContact O-N 2.91Å; A3-G7 PolarHBondContact O-N 3.34Å
4	L	69.3	Low	74.8	Confident	144 Å²	144	118.3 Å²	118.3	75%	0.754	65%	0.645	S	S	*	*	H	α-helix	trans	-74.6	-43.3	178	-172.7	68	0	0	111.4	D2 K6 G7 F8	D2-L4 VanDerWaalsContact C-N 3.25Å; D2-L4 PolarHBondContact O-N 3.3Å; L4-K6 VanDerWaalsContact C-N 3.35Å; L4-G7 PolarHBondContact O-N 2.85Å; L4-F8 WeakPolarHBondContact O-CB 3.3Å; L4-F8 PolarHBondContact O-N 3.16Å
5	M	74.8	Confident	75.1	Confident	145 Å²	145	117.2 Å²	117.2	71%	0.714	64%	0.643	S	S	*	*	H	α-helix	trans	-64.3	-40.4	174.2	-83.5	-161.7	169.1	0	111.8	M1 D2 F8 S9	M1-M5 PolarHBondContact O-N 2.86Å; D2-M5 PolarHBondContact O-N 2.76Å; M5-F8 PolarHBondContact O-N 2.72Å; M5-S9 PolarHBondContact O-N 3.39Å; M5-S9 PolarHBondContact O-OG 3.19Å; M5-S9 VanDerWaalsContact O-OG 3.13Å
6	K	77.2	Confident	75.1	Confident	166 Å²	166	114.4 Å²	114.4	72%	0.722	63%	0.63	S	S	*	*	H	α-helix	trans	-67.4	-37.6	176.9	-151.9	169.8	-170.4	167.9	112	D2 L4 K10	D2-K6 WeakPolarHBondContact O-CB 3.39Å; D2-K6 PolarHBondContact O-N 3.49Å; L4-K6 VanDerWaalsContact C-N 3.35Å; K6-K10 WeakPolarHBondContact O-CB 3.32Å; K6-K10 PolarHBondContact O-N 3.34Å; K6-K10 VanDerWaalsContact O-N 3.12Å
7	G	77.7	Confident	75.2	Confident	41 Å²	41	110.9 Å²	110.9	42%	0.423	62%	0.62	S	S	.	*	H	α-helix	trans	-65.3	-42.2	172.6	0	0	0	0	112.8	A3 L4 K10 A11	A3-G7 PolarHBondContact O-N 3.34Å; L4-G7 PolarHBondContact O-N 2.85Å; G7-K10 PolarHBondContact O-N 3.32Å; G7-A11 WeakPolarHBondContact O-CB 3.42Å; G7-A11 PolarHBondContact O-N 2.86Å
8	F	74.5	Confident	75.1	Confident	149 Å²	149	107.7 Å²	107.7	65%	0.654	61%	0.61	S	S	*	*	H	α-helix	trans	-66.5	-43.2	177.4	-173.2	-96.9	0	0	112.4	L4 M5 K10 A11 K12	L4-F8 WeakPolarHBondContact O-CB 3.3Å; L4-F8 PolarHBondContact O-N 3.16Å; M5-F8 PolarHBondContact O-N 2.72Å; F8-K10 VanDerWaalsContact C-N 3.31Å; F8-K10 PolarHBondContact O-N 3.27Å; F8-A11 PolarHBondContact O-N 3.42Å; F8-K12 WeakPolarHBondContact O-CB 3.14Å; F8-K12 PolarHBondContact O-N 3.4Å
9	S	76.5	Confident	75	Confident	64 Å²	64	104.7 Å²	104.7	45%	0.448	60%	0.6	S	S	.	*	H	α-helix	trans	-61.1	-41.2	174.4	-62.6	0	0	0	111.7	M5 K12 D13	M5-S9 PolarHBondContact O-N 3.39Å; M5-S9 PolarHBondContact O-OG 3.19Å; M5-S9 VanDerWaalsContact O-OG 3.13Å; S9-K12 PolarHBondContact O-N 2.93Å; S9-D13 PolarHBondContact O-N 3.05Å
10	K	74.1	Confident	74.8	Confident	166 Å²	166	105.8 Å²	105.8	72%	0.722	60%	0.599	S	S	*	*	H	α-helix	trans	-68.9	-35	178	-153.6	170.3	-170.4	171.1	112.8	K6 G7 F8 G14	K6-K10 WeakPolarHBondContact O-CB 3.32Å; K6-K10 PolarHBondContact O-N 3.34Å; K6-K10 VanDerWaalsContact O-N 3.12Å; G7-K10 PolarHBondContact O-N 3.32Å; F8-K10 VanDerWaalsContact C-N 3.31Å; F8-K10 PolarHBondContact O-N 3.27Å; K10-G14 PolarHBondContact O-N 3.49Å
11	A	75.8	Confident	74.9	Confident	58 Å²	58	108.5 Å²	108.5	48%	0.479	61%	0.605	S	S	.	*	H	α-helix	trans	-67.7	-40.5	172.4	0	0	0	0	111.6	G7 F8 G14 V15	G7-A11 WeakPolarHBondContact O-CB 3.42Å; G7-A11 PolarHBondContact O-N 2.86Å; F8-A11 PolarHBondContact O-N 3.42Å; A11-G14 PolarHBondContact O-N 2.82Å; A11-V15 WeakPolarHBondContact O-CG2 3.37Å; A11-V15 PolarHBondContact O-N 2.83Å
12	K	77.1	Confident	75	Confident	134 Å²	134	102.7 Å²	102.7	58%	0.583	58%	0.581	S	S	*	*	H	α-helix	trans	-63.1	-46.4	176.1	-169.7	-176.4	176	-172.5	111.4	F8 S9 G14 V15 V16	F8-K12 WeakPolarHBondContact O-CB 3.14Å; F8-K12 PolarHBondContact O-N 3.4Å; S9-K12 PolarHBondContact O-N 2.93Å; K12-G14 VanDerWaalsContact C-N 3.31Å; K12-G14 PolarHBondContact O-N 3.38Å; K12-V15 PolarHBondContact O-N 3.49Å; K12-V16 WeakPolarHBondContact O-CG2 3.25Å; K12-V16 PolarHBondContact O-N 3.37Å
13	D	79.2	Confident	74.8	Confident	108 Å²	108	103.8 Å²	103.8	58%	0.578	58%	0.579	S	S	*	*	H	α-helix	trans	-63.4	-38.1	176.4	-68.6	-21.3	0	0	111.7	S9 V16 A17	S9-D13 PolarHBondContact O-N 3.05Å; D13-V16 PolarHBondContact O-N 3.35Å; D13-A17 WeakPolarHBondContact O-CB 3.41Å; D13-A17 PolarHBondContact O-N 3.5Å
14	G	77.1	Confident	74.8	Confident	43 Å²	43	106.7 Å²	106.7	44%	0.443	58%	0.578	S	S	.	*	H	α-helix	trans	-63	-39.9	174.4	0	0	0	0	113.4	K10 A11 K12 A18	K10-G14 PolarHBondContact O-N 3.49Å; A11-G14 PolarHBondContact O-N 2.82Å; K12-G14 VanDerWaalsContact C-N 3.31Å; K12-G14 PolarHBondContact O-N 3.38Å; G14-A18 WeakPolarHBondContact O-CB 3.39Å; G14-A18 PolarHBondContact O-N 2.87Å
15	V	79	Confident	74.8	Confident	102 Å²	102	102.1 Å²	102.1	62%	0.618	57%	0.566	S	S	*	*	H	α-helix	trans	-68.3	-41.1	175.5	167.4	0	0	0	111.5	A11 K12 A18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.37Å; A11-V15 PolarHBondContact O-N 2.83Å; K12-V15 PolarHBondContact O-N 3.49Å; V15-A18 PolarHBondContact O-N 2.86Å; V15-A19 WeakPolarHBondContact O-CB 3.18Å; V15-A19 PolarHBondContact O-N 2.89Å
16	V	76.5	Confident	74.5	Confident	72 Å²	72	99.9 Å²	99.9	44%	0.436	56%	0.56	S	S	.	*	H	α-helix	trans	-63.3	-44.6	176.6	173.7	0	0	0	110.6	K12 D13 A18 A19 E20	K12-V16 WeakPolarHBondContact O-CG2 3.25Å; K12-V16 PolarHBondContact O-N 3.37Å; D13-V16 PolarHBondContact O-N 3.35Å; V16-A18 PolarHBondContact O-N 3.09Å; V16-A19 PolarHBondContact O-N 3.23Å; V16-E20 PolarHBondContact O-N 3.46Å
17	A	75.3	Confident	73.9	Confident	55 Å²	55	95.7 Å²	95.7	46%	0.455	55%	0.548	S	S	.	.	H	α-helix	trans	-63.3	-40.6	176.7	0	0	0	0	112.5	D13 K21	D13-A17 WeakPolarHBondContact O-CB 3.41Å; D13-A17 PolarHBondContact O-N 3.5Å; A17-K21 VanDerWaalsContact O-CB 3.3Å; A17-K21 WeakPolarHBondContact O-CB 3.32Å; A17-K21 PolarHBondContact O-N 3.5Å
18	A	73.3	Confident	73.5	Confident	54 Å²	54	95.1 Å²	95.1	45%	0.446	54%	0.542	S	S	.	.	H	α-helix	trans	-65.7	-39.7	175.4	0	0	0	0	112	G14 V15 V16 T22	G14-A18 WeakPolarHBondContact O-CB 3.39Å; G14-A18 PolarHBondContact O-N 2.87Å; V15-A18 PolarHBondContact O-N 2.86Å; V16-A18 PolarHBondContact O-N 3.09Å; A18-T22 WeakPolarHBondContact O-CB 3.45Å; A18-T22 PolarHBondContact O-N 2.68Å; A18-T22 PolarHBondContact O-OG1 2.81Å
19	A	74.4	Confident	73	Confident	51 Å²	51	90.7 Å²	90.7	42%	0.421	53%	0.533	S	S	.	.	H	α-helix	trans	-67	-42.6	176.9	0	0	0	0	112.2	V15 V16 T22 K23	V15-A19 WeakPolarHBondContact O-CB 3.18Å; V15-A19 PolarHBondContact O-N 2.89Å; V16-A19 PolarHBondContact O-N 3.23Å; A19-T22 PolarHBondContact O-N 2.86Å; A19-K23 PolarHBondContact O-N 3.48Å
20	E	70.9	Confident	72.2	Confident	126 Å²	126	90.5 Å²	90.5	59%	0.589	54%	0.536	S	S	*	.	H	α-helix	trans	-64.8	-43.9	174.6	-81.5	-172.5	143.8	0	112.2	V16 T22 K23 Q24	V16-E20 PolarHBondContact O-N 3.46Å; E20-T22 VanDerWaalsContact C-N 3.25Å; E20-T22 PolarHBondContact O-N 3.2Å; E20-K23 PolarHBondContact O-N 2.72Å; E20-Q24 PolarHBondContact O-N 3.31Å
21	K	75.5	Confident	71.7	Confident	163 Å²	163	88.5 Å²	88.5	71%	0.709	53%	0.529	S	S	*	.	H	α-helix	trans	-62.4	-35.4	176.7	-160	-176.8	-174.2	82.7	111.7	A17 G25	A17-K21 VanDerWaalsContact O-CB 3.3Å; A17-K21 WeakPolarHBondContact O-CB 3.32Å; A17-K21 PolarHBondContact O-N 3.5Å; K21-G25 PolarHBondContact O-N 2.91Å
22	T	70.8	Confident	71.4	Confident	93 Å²	93	93 Å²	93	57%	0.571	54%	0.542	S	S	*	.	H	α-helix	trans	-69.7	-42.3	174.8	-57.7	0	0	0	111.5	A18 A19 E20 Q24 G25 V26	A18-T22 WeakPolarHBondContact O-CB 3.45Å; A18-T22 PolarHBondContact O-N 2.68Å; A18-T22 PolarHBondContact O-OG1 2.81Å; A19-T22 PolarHBondContact O-N 2.86Å; E20-T22 VanDerWaalsContact C-N 3.25Å; E20-T22 PolarHBondContact O-N 3.2Å; T22-Q24 PolarHBondContact O-N 2.95Å; T22-G25 PolarHBondContact O-N 2.94Å; T22-V26 HydrophobicContact CG2-CG2 4.43Å; T22-V26 VanDerWaalsContact O-CG2 3.32Å; T22-V26 WeakPolarHBondContact O-CG2 3.25Å; T22-V26 PolarHBondContact O-N 3.47Å
23	K	70.2	Confident	70.7	Confident	158 Å²	158	90.9 Å²	90.9	69%	0.687	54%	0.54	S	S	*	.	H	α-helix	trans	-59.8	-47.7	174.7	-79.8	-175.3	178.1	-178.2	111.7	A19 E20 G25 V26 T27	A19-K23 PolarHBondContact O-N 3.48Å; E20-K23 PolarHBondContact O-N 2.72Å; K23-G25 VanDerWaalsContact C-N 3.35Å; K23-G25 PolarHBondContact O-N 3.31Å; K23-V26 PolarHBondContact O-N 3.26Å; K23-T27 PolarHBondContact O-N 2.88Å; K23-T27 PolarHBondContact O-OG1 3.39Å
24	Q	72.3	Confident	70.3	Confident	149 Å²	149	92.9 Å²	92.9	70%	0.696	54%	0.544	S	S	*	.	H	α-helix	trans	-62.3	-40.8	177.7	-74.9	-177.6	-18.8	0	112.4	E20 T22 T27 G28	E20-Q24 PolarHBondContact O-N 3.31Å; T22-Q24 PolarHBondContact O-N 2.95Å; Q24-T27 PolarHBondContact O-N 2.87Å; Q24-G28 PolarHBondContact O-N 3.45Å
25	G	69.5	Low	70	Confident	47 Å²	47	96.1 Å²	96.1	49%	0.485	55%	0.551	S	S	.	*	H	α-helix	trans	-63.2	-41.3	177	0	0	0	0	113.2	K21 T22 K23 A29	K21-G25 PolarHBondContact O-N 2.91Å; T22-G25 PolarHBondContact O-N 2.94Å; K23-G25 VanDerWaalsContact C-N 3.35Å; K23-G25 PolarHBondContact O-N 3.31Å; G25-A29 WeakPolarHBondContact O-CB 3.23Å; G25-A29 PolarHBondContact O-N 2.91Å; G25-A29 VanDerWaalsContact O-N 3.14Å
26	V	66.8	Low	69.6	Low	98 Å²	98	92.9 Å²	92.9	59%	0.594	54%	0.538	S	S	*	.	H	α-helix	trans	-70.4	-41.9	177.9	174.3	0	0	0	111.4	T22 K23 A29 A30	T22-V26 HydrophobicContact CG2-CG2 4.43Å; T22-V26 VanDerWaalsContact O-CG2 3.32Å; T22-V26 WeakPolarHBondContact O-CG2 3.25Å; T22-V26 PolarHBondContact O-N 3.47Å; K23-V26 PolarHBondContact O-N 3.26Å; V26-A29 PolarHBondContact O-N 3.49Å; V26-A30 PolarHBondContact O-N 2.89Å; V26-A30 VanDerWaalsContact O-N 3.11Å
27	T	66.4	Low	69.1	Low	78 Å²	78	94.3 Å²	94.3	48%	0.479	55%	0.547	S	S	.	.	H	α-helix	trans	-64.9	-44.8	177.6	-55.3	0	0	0	111.7	K23 Q24 A29 A30 E31	K23-T27 PolarHBondContact O-N 2.88Å; K23-T27 PolarHBondContact O-OG1 3.39Å; Q24-T27 PolarHBondContact O-N 2.87Å; T27-A29 PolarHBondContact O-N 3.32Å; T27-A30 PolarHBondContact O-N 2.91Å; T27-E31 PolarHBondContact O-N 2.74Å
28	G	68.3	Low	69	Low	29 Å²	29	97.6 Å²	97.6	30%	0.299	55%	0.554	S	S	.	*	H	α-helix	trans	-64.9	-37	178.7	0	0	0	0	113.4	Q24 E31 M32	Q24-G28 PolarHBondContact O-N 3.45Å; G28-E31 PolarHBondContact O-N 3.3Å; G28-M32 WeakPolarHBondContact O-CB 3.34Å; G28-M32 WeakPolarHBondContact O-CG 3.36Å; G28-M32 PolarHBondContact O-N 2.86Å
29	A	63.4	Low	69.1	Low	56 Å²	56	102 Å²	102	46%	0.463	56%	0.56	S	S	.	*	H	α-helix	trans	-66.7	-37	174.8	0	0	0	0	112.4	G25 V26 T27 T33	G25-A29 WeakPolarHBondContact O-CB 3.23Å; G25-A29 PolarHBondContact O-N 2.91Å; G25-A29 VanDerWaalsContact O-N 3.14Å; V26-A29 PolarHBondContact O-N 3.49Å; T27-A29 PolarHBondContact O-N 3.32Å; A29-T33 WeakPolarHBondContact O-CB 3.48Å; A29-T33 PolarHBondContact O-N 3.47Å; A29-T33 PolarHBondContact O-OG1 3.46Å
30	A	60.8	Low	69.1	Low	60 Å²	60	103.6 Å²	103.6	50%	0.496	57%	0.565	S	S	.	*	H	α-helix	trans	-67.7	-40.9	176.3	0	0	0	0	112	V26 T27 T33 K34	V26-A30 PolarHBondContact O-N 2.89Å; V26-A30 VanDerWaalsContact O-N 3.11Å; T27-A30 PolarHBondContact O-N 2.91Å; A30-T33 PolarHBondContact O-N 3.37Å; A30-K34 WeakPolarHBondContact O-CB 3.31Å; A30-K34 PolarHBondContact O-N 3.21Å
31	E	63.4	Low	69.1	Low	124 Å²	124	99.6 Å²	99.6	58%	0.579	56%	0.558	S	S	*	*	H	α-helix	trans	-64.4	-48.6	175.2	-73.8	177.8	167.9	0	111.5	T27 G28 T33 K34 D35	T27-E31 PolarHBondContact O-N 2.74Å; G28-E31 PolarHBondContact O-N 3.3Å; E31-T33 VanDerWaalsContact C-N 3.26Å; E31-T33 PolarHBondContact O-N 3.5Å; E31-K34 PolarHBondContact O-N 3.33Å; E31-K34 VanDerWaalsContact O-N 3.15Å; E31-D35 PolarHBondContact O-N 2.87Å
32	M	68.4	Low	68.8	Low	152 Å²	152	95.2 Å²	95.2	75%	0.749	55%	0.545	S	S	*	.	H	α-helix	trans	-58.8	-36.8	176	-70	-100.8	177.5	0	112.4	G28 G36	G28-M32 WeakPolarHBondContact O-CB 3.34Å; G28-M32 WeakPolarHBondContact O-CG 3.36Å; G28-M32 PolarHBondContact O-N 2.86Å; M32-G36 PolarHBondContact O-N 3.05Å
33	T	64.3	Low	68.7	Low	91 Å²	91	96.8 Å²	96.8	56%	0.558	54%	0.544	S	S	*	.	H	α-helix	trans	-71.1	-41.1	177.3	-58.1	0	0	0	111.6	A29 A30 E31 G36 V37	A29-T33 WeakPolarHBondContact O-CB 3.48Å; A29-T33 PolarHBondContact O-N 3.47Å; A29-T33 PolarHBondContact O-OG1 3.46Å; A30-T33 PolarHBondContact O-N 3.37Å; E31-T33 VanDerWaalsContact C-N 3.26Å; E31-T33 PolarHBondContact O-N 3.5Å; T33-G36 PolarHBondContact O-N 3.03Å; T33-V37 VanDerWaalsContact O-CG2 3.29Å; T33-V37 WeakPolarHBondContact O-CG2 3.44Å; T33-V37 PolarHBondContact O-N 3.44Å
34	K	69.6	Low	68.6	Low	149 Å²	149	93 Å²	93	65%	0.648	53%	0.534	S	S	*	.	H	α-helix	trans	-64.3	-43.4	177.8	-173.7	-178.9	177.1	-176.3	111.6	A30 E31 V37 M38	A30-K34 WeakPolarHBondContact O-CB 3.31Å; A30-K34 PolarHBondContact O-N 3.21Å; E31-K34 PolarHBondContact O-N 3.33Å; E31-K34 VanDerWaalsContact O-N 3.15Å; K34-V37 PolarHBondContact O-N 3.48Å; K34-M38 WeakPolarHBondContact O-CB 3.39Å; K34-M38 PolarHBondContact O-N 3.02Å
35	D	71.1	Confident	68.5	Low	112 Å²	112	93.6 Å²	93.6	60%	0.599	53%	0.534	S	S	*	.	H	α-helix	trans	-68.7	-38.7	177.9	-78	-6.9	0	0	111.7	E31 M38 Y39	E31-D35 PolarHBondContact O-N 2.87Å; D35-M38 PolarHBondContact O-N 2.99Å; D35-Y39 WeakPolarHBondContact O-CB 3.47Å; D35-Y39 PolarHBondContact O-N 2.99Å
36	G	69.7	Low	68.4	Low	34 Å²	34	96.1 Å²	96.1	35%	0.351	54%	0.536	S	S	.	.	H	α-helix	trans	-61.2	-46.1	174.4	0	0	0	0	112.9	M32 T33 Y39 V40	M32-G36 PolarHBondContact O-N 3.05Å; T33-G36 PolarHBondContact O-N 3.03Å; G36-Y39 PolarHBondContact O-N 2.92Å; G36-V40 WeakPolarHBondContact O-CG2 3.32Å; G36-V40 PolarHBondContact O-N 3.32Å
37	V	67.5	Low	68.5	Low	102 Å²	102	93 Å²	93	62%	0.618	52%	0.524	S	S	*	.	H	α-helix	trans	-66.4	-41.2	178.2	175.6	0	0	0	111.2	T33 K34 G41	T33-V37 VanDerWaalsContact O-CG2 3.29Å; T33-V37 WeakPolarHBondContact O-CG2 3.44Å; T33-V37 PolarHBondContact O-N 3.44Å; K34-V37 PolarHBondContact O-N 3.48Å; V37-G41 PolarHBondContact O-N 3.29Å
38	M	71.7	Confident	68.7	Low	123 Å²	123	93.9 Å²	93.9	61%	0.606	53%	0.529	S	S	*	.	H	α-helix	trans	-68.2	-38.2	176	-83.6	-56.3	-163.2	0	113	K34 D35 G41 T42	K34-M38 WeakPolarHBondContact O-CB 3.39Å; K34-M38 PolarHBondContact O-N 3.02Å; D35-M38 PolarHBondContact O-N 2.99Å; M38-G41 PolarHBondContact O-N 2.76Å; M38-T42 WeakPolarHBondContact O-CB 3.45Å; M38-T42 WeakPolarHBondContact O-CG2 3.47Å; M38-T42 PolarHBondContact O-N 3.49Å; M38-T42 PolarHBondContact O-OG1 3.41Å
39	Y	75.9	Confident	68.7	Low	146 Å²	146	95.4 Å²	95.4	57%	0.573	54%	0.535	S	S	*	.	H	α-helix	trans	-63.2	-46	176.3	178	-100.4	0	0	111.5	D35 G36 T42 K43	D35-Y39 WeakPolarHBondContact O-CB 3.47Å; D35-Y39 PolarHBondContact O-N 2.99Å; G36-Y39 PolarHBondContact O-N 2.92Å; Y39-T42 WeakPolarHBondContact CA-OG1 3.3Å; Y39-T42 PolarHBondContact O-OG1 2.87Å; Y39-K43 HydrophobicContact CE1-CG 4.07Å; Y39-K43 HydrophobicContact CE2-CG 4.13Å; Y39-K43 VanDerWaalsContact O-CB 3.26Å; Y39-K43 WeakPolarHBondContact O-CB 3.3Å; Y39-K43 PolarHBondContact O-N 2.97Å; Y39-K43 VanDerWaalsContact OH-CE 3.3Å; Y39-K43 WeakPolarHBondContact OH-CE 3.33Å
40	V	75.3	Confident	69.1	Low	86 Å²	86	96 Å²	96	52%	0.521	53%	0.533	S	S	.	.	H	α-helix	trans	-66.2	-41.2	176.4	174.6	0	0	0	111	G36 T44	G36-V40 WeakPolarHBondContact O-CG2 3.32Å; G36-V40 PolarHBondContact O-N 3.32Å; V40-T44 VanDerWaalsContact O-CB 3.25Å; V40-T44 WeakPolarHBondContact O-CB 3.48Å; V40-T44 PolarHBondContact O-N 3.36Å; V40-T44 PolarHBondContact O-OG1 3.48Å
41	G	71.5	Confident	69.6	Low	42 Å²	42	97.5 Å²	97.5	43%	0.433	54%	0.536	S	S	.	.	H	α-helix	trans	-61.6	-45.1	177.5	0	0	0	0	113	V37 M38 K45	V37-G41 PolarHBondContact O-N 3.29Å; M38-G41 PolarHBondContact O-N 2.76Å; G41-K45 WeakPolarHBondContact O-CB 3.34Å; G41-K45 PolarHBondContact O-N 2.88Å
42	T	68.9	Low	69.7	Low	71 Å²	71	94 Å²	94	44%	0.436	53%	0.529	S	S	.	.	H	α-helix	trans	-67.1	-49.2	176.6	49.1	0	0	0	111.7	M38 Y39 T44 K45 D46	M38-T42 WeakPolarHBondContact O-CB 3.45Å; M38-T42 WeakPolarHBondContact O-CG2 3.47Å; M38-T42 PolarHBondContact O-N 3.49Å; M38-T42 PolarHBondContact O-OG1 3.41Å; Y39-T42 WeakPolarHBondContact CA-OG1 3.3Å; Y39-T42 PolarHBondContact O-OG1 2.87Å; T42-T44 VanDerWaalsContact C-N 3.28Å; T42-T44 PolarHBondContact O-N 2.87Å; T42-K45 PolarHBondContact O-N 2.94Å; T42-D46 WeakPolarHBondContact O-CB 3.49Å; T42-D46 PolarHBondContact O-N 2.73Å
43	K	68.5	Low	69.5	Low	126 Å²	126	93.2 Å²	93.2	55%	0.548	52%	0.523	S	S	.	.	H	α-helix	trans	-56.2	-40.1	174.3	-90.8	-84.3	-174.4	174.4	113.2	Y39 G47	Y39-K43 HydrophobicContact CE1-CG 4.07Å; Y39-K43 HydrophobicContact CE2-CG 4.13Å; Y39-K43 VanDerWaalsContact O-CB 3.26Å; Y39-K43 WeakPolarHBondContact O-CB 3.3Å; Y39-K43 PolarHBondContact O-N 2.97Å; Y39-K43 VanDerWaalsContact OH-CE 3.3Å; Y39-K43 WeakPolarHBondContact OH-CE 3.33Å; K43-G47 WeakPolarHBondContact O-CA 3.29Å; K43-G47 PolarHBondContact O-N 3.5Å
44	T	68.3	Low	69.9	Low	79 Å²	79	96.4 Å²	96.4	49%	0.485	53%	0.529	S	S	.	.	H	α-helix	trans	-69.4	-44.4	179.4	-57.4	0	0	0	110.5	V40 T42 G47 V48	V40-T44 VanDerWaalsContact O-CB 3.25Å; V40-T44 WeakPolarHBondContact O-CB 3.48Å; V40-T44 PolarHBondContact O-N 3.36Å; V40-T44 PolarHBondContact O-OG1 3.48Å; T42-T44 VanDerWaalsContact C-N 3.28Å; T42-T44 PolarHBondContact O-N 2.87Å; T44-G47 PolarHBondContact O-N 2.98Å; T44-V48 HydrophobicContact CG2-CG2 4.41Å; T44-V48 WeakPolarHBondContact O-CB 3.45Å; T44-V48 VanDerWaalsContact O-CG2 3.24Å; T44-V48 WeakPolarHBondContact O-CG2 3.47Å; T44-V48 PolarHBondContact O-N 3.39Å
45	K	68.8	Low	69.9	Low	160 Å²	160	93.2 Å²	93.2	70%	0.696	52%	0.522	S	S	*	.	H	α-helix	trans	-61.3	-47.8	176.7	-177.6	174.9	177.4	168.6	112	G41 T42 G47 V48 S49	G41-K45 WeakPolarHBondContact O-CB 3.34Å; G41-K45 PolarHBondContact O-N 2.88Å; T42-K45 PolarHBondContact O-N 2.94Å; K45-G47 VanDerWaalsContact C-N 3.35Å; K45-V48 PolarHBondContact O-N 2.92Å; K45-S49 WeakPolarHBondContact O-CB 3.35Å; K45-S49 PolarHBondContact O-N 3.19Å
46	D	68.3	Low	69.9	Low	100 Å²	100	92.4 Å²	92.4	54%	0.535	52%	0.521	S	S	.	.	H	α-helix	trans	-67.6	-38.2	179.6	-66.3	-16.8	0	0	111.3	T42 S49 T50	T42-D46 WeakPolarHBondContact O-CB 3.49Å; T42-D46 PolarHBondContact O-N 2.73Å; D46-S49 PolarHBondContact O-N 3.48Å; D46-T50 WeakPolarHBondContact O-CB 3.35Å; D46-T50 PolarHBondContact O-N 3.32Å; D46-T50 PolarHBondContact O-OG1 2.75Å
47	G	69.6	Low	69.8	Low	33 Å²	33	94.5 Å²	94.5	34%	0.34	53%	0.531	S	S	.	.	H	α-helix	trans	-61.9	-47.6	174.9	0	0	0	0	112.4	K43 T44 K45 T50 V51	K43-G47 WeakPolarHBondContact O-CA 3.29Å; K43-G47 PolarHBondContact O-N 3.5Å; T44-G47 PolarHBondContact O-N 2.98Å; K45-G47 VanDerWaalsContact C-N 3.35Å; G47-T50 PolarHBondContact O-N 3.14Å; G47-V51 VanDerWaalsContact O-CG2 3.29Å; G47-V51 WeakPolarHBondContact O-CG2 3.47Å; G47-V51 PolarHBondContact O-N 3.4Å
48	V	70.3	Confident	69.9	Low	97 Å²	97	91.3 Å²	91.3	59%	0.588	52%	0.518	S	S	*	.	H	α-helix	trans	-64	-43.1	177.5	172.4	0	0	0	111.2	T44 K45 T50 V51 A52	T44-V48 HydrophobicContact CG2-CG2 4.41Å; T44-V48 WeakPolarHBondContact O-CB 3.45Å; T44-V48 VanDerWaalsContact O-CG2 3.24Å; T44-V48 WeakPolarHBondContact O-CG2 3.47Å; T44-V48 PolarHBondContact O-N 3.39Å; K45-V48 PolarHBondContact O-N 2.92Å; V48-T50 PolarHBondContact O-N 3.25Å; V48-V51 PolarHBondContact O-N 2.87Å; V48-A52 WeakPolarHBondContact O-CB 3.44Å; V48-A52 PolarHBondContact O-N 3.41Å
49	S	68.5	Low	69.8	Low	60 Å²	60	90 Å²	90	42%	0.42	52%	0.517	S	S	.	.	H	α-helix	trans	-60.5	-44.6	176.2	-164.6	0	0	0	111.8	K45 D46 V51 A52 E53	K45-S49 WeakPolarHBondContact O-CB 3.35Å; K45-S49 PolarHBondContact O-N 3.19Å; D46-S49 PolarHBondContact O-N 3.48Å; S49-V51 PolarHBondContact O-N 2.94Å; S49-A52 PolarHBondContact O-N 3.46Å; S49-E53 PolarHBondContact O-N 2.92Å
50	T	70.4	Confident	69.6	Low	69 Å²	69	87 Å²	87	42%	0.423	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-41.3	179.3	-56.8	0	0	0	111.9	D46 G47 V48 E53 K54	D46-T50 WeakPolarHBondContact O-CB 3.35Å; D46-T50 PolarHBondContact O-N 3.32Å; D46-T50 PolarHBondContact O-OG1 2.75Å; G47-T50 PolarHBondContact O-N 3.14Å; V48-T50 PolarHBondContact O-N 3.25Å; T50-E53 PolarHBondContact O-N 2.91Å; T50-K54 WeakPolarHBondContact O-CB 3.3Å; T50-K54 WeakPolarHBondContact O-CG 3.5Å; T50-K54 PolarHBondContact O-N 3.46Å
51	V	71.9	Confident	69.6	Low	92 Å²	92	90.3 Å²	90.3	56%	0.558	53%	0.527	S	S	*	.	H	α-helix	trans	-67.1	-40.1	177.4	171.9	0	0	0	110.8	G47 V48 S49 K54 T55	G47-V51 VanDerWaalsContact O-CG2 3.29Å; G47-V51 WeakPolarHBondContact O-CG2 3.47Å; G47-V51 PolarHBondContact O-N 3.4Å; V48-V51 PolarHBondContact O-N 2.87Å; S49-V51 PolarHBondContact O-N 2.94Å; V51-K54 PolarHBondContact O-N 3.47Å; V51-T55 WeakPolarHBondContact O-CB 3.37Å; V51-T55 PolarHBondContact O-N 3.49Å; V51-T55 PolarHBondContact O-OG1 2.99Å
52	A	64.4	Low	69.7	Low	51 Å²	51	92.7 Å²	92.7	42%	0.421	53%	0.533	S	S	.	.	H	α-helix	trans	-61.8	-48.2	175	0	0	0	0	111.5	V48 S49 K54 T55 V56	V48-A52 WeakPolarHBondContact O-CB 3.44Å; V48-A52 PolarHBondContact O-N 3.41Å; S49-A52 PolarHBondContact O-N 3.46Å; A52-K54 PolarHBondContact O-N 2.98Å; A52-T55 PolarHBondContact O-N 3.46Å; A52-V56 WeakPolarHBondContact O-CG2 3.29Å; A52-V56 PolarHBondContact O-N 2.94Å
53	E	65.3	Low	70.2	Confident	134 Å²	134	90.9 Å²	90.9	63%	0.626	53%	0.528	S	S	*	.	H	α-helix	trans	-60	-45.4	176.6	-79.8	-178.9	173.2	0	112.5	S49 T50 T55 V56 S57	S49-E53 PolarHBondContact O-N 2.92Å; T50-E53 PolarHBondContact O-N 2.91Å; E53-T55 VanDerWaalsContact C-N 3.3Å; E53-T55 PolarHBondContact O-N 3.35Å; E53-V56 PolarHBondContact O-N 3.29Å; E53-S57 WeakPolarHBondContact O-CB 3.39Å; E53-S57 PolarHBondContact O-N 3.36Å
54	K	72.3	Confident	70.8	Confident	158 Å²	158	86.7 Å²	86.7	69%	0.687	52%	0.521	S	S	*	.	H	α-helix	trans	-62.5	-37.3	175.8	-78.9	-171.1	176	-170.3	112.4	T50 V51 A52 G58	T50-K54 WeakPolarHBondContact O-CB 3.3Å; T50-K54 WeakPolarHBondContact O-CG 3.5Å; T50-K54 PolarHBondContact O-N 3.46Å; V51-K54 PolarHBondContact O-N 3.47Å; A52-K54 PolarHBondContact O-N 2.98Å; K54-G58 PolarHBondContact O-N 2.7Å
55	T	70.4	Confident	71.3	Confident	82 Å²	82	85.7 Å²	85.7	50%	0.503	52%	0.52	S	S	.	.	H	α-helix	trans	-67.7	-46.6	178	-57.8	0	0	0	110.9	V51 A52 E53 S57 G58 V59	V51-T55 WeakPolarHBondContact O-CB 3.37Å; V51-T55 PolarHBondContact O-N 3.49Å; V51-T55 PolarHBondContact O-OG1 2.99Å; A52-T55 PolarHBondContact O-N 3.46Å; E53-T55 VanDerWaalsContact C-N 3.3Å; E53-T55 PolarHBondContact O-N 3.35Å; T55-S57 PolarHBondContact O-N 2.94Å; T55-G58 PolarHBondContact O-N 3.32Å; T55-V59 HydrophobicContact CG2-CG2 4.43Å; T55-V59 WeakPolarHBondContact O-CB 3.38Å; T55-V59 VanDerWaalsContact O-CG2 3.29Å; T55-V59 WeakPolarHBondContact O-CG2 3.25Å; T55-V59 PolarHBondContact O-N 2.92Å
56	V	70.3	Confident	72	Confident	95 Å²	95	82.1 Å²	82.1	58%	0.576	51%	0.512	S	S	*	.	H	α-helix	trans	-61	-46.3	176.6	173.4	0	0	0	110.6	A52 E53 G58 V59 S60	A52-V56 WeakPolarHBondContact O-CG2 3.29Å; A52-V56 PolarHBondContact O-N 2.94Å; E53-V56 PolarHBondContact O-N 3.29Å; V56-G58 PolarHBondContact O-N 2.86Å; V56-V59 PolarHBondContact O-N 2.97Å; V56-S60 PolarHBondContact O-N 2.9Å; V56-S60 PolarHBondContact O-OG 3.2Å
57	S	68.3	Low	72.5	Confident	79 Å²	79	81.9 Å²	81.9	55%	0.552	51%	0.514	S	S	*	.	H	α-helix	trans	-61.7	-43.9	177.3	-175.9	0	0	0	112.3	E53 T55 S60 H61	E53-S57 WeakPolarHBondContact O-CB 3.39Å; E53-S57 PolarHBondContact O-N 3.36Å; T55-S57 PolarHBondContact O-N 2.94Å; S57-S60 PolarHBondContact O-N 2.9Å; S57-H61 WeakPolarHBondContact O-CB 3.24Å; S57-H61 PolarHBondContact O-N 3.02Å
58	G	70.1	Confident	73.1	Confident	35 Å²	35	84.6 Å²	84.6	36%	0.361	52%	0.524	S	S	.	.	H	α-helix	trans	-61.5	-44.6	175.5	0	0	0	0	112.6	K54 T55 V56 H61 V62	K54-G58 PolarHBondContact O-N 2.7Å; T55-G58 PolarHBondContact O-N 3.32Å; V56-G58 PolarHBondContact O-N 2.86Å; G58-H61 PolarHBondContact O-N 3.29Å; G58-V62 WeakPolarHBondContact O-CB 3.19Å; G58-V62 VanDerWaalsContact O-CG2 3.3Å; G58-V62 WeakPolarHBondContact O-CG2 3.26Å; G58-V62 PolarHBondContact O-N 3.38Å
59	V	68.4	Low	73.7	Confident	96 Å²	96	81.5 Å²	81.5	58%	0.582	51%	0.512	S	S	*	.	H	α-helix	trans	-65.3	-40.2	176.7	170.4	0	0	0	111.5	T55 V56 H61 G63	T55-V59 HydrophobicContact CG2-CG2 4.43Å; T55-V59 WeakPolarHBondContact O-CB 3.38Å; T55-V59 VanDerWaalsContact O-CG2 3.29Å; T55-V59 WeakPolarHBondContact O-CG2 3.25Å; T55-V59 PolarHBondContact O-N 2.92Å; V56-V59 PolarHBondContact O-N 2.97Å; V59-H61 VanDerWaalsContact C-N 3.34Å; V59-H61 PolarHBondContact O-N 3.44Å; V59-G63 WeakPolarHBondContact O-CA 3.49Å; V59-G63 PolarHBondContact O-N 3.01Å
60	S	72.7	Confident	74.4	Confident	82 Å²	82	83.1 Å²	83.1	57%	0.573	52%	0.519	S	S	*	.	H	α-helix	trans	-63.9	-39.2	174.7	-64.6	0	0	0	112.3	V56 S57 G64	V56-S60 PolarHBondContact O-N 2.9Å; V56-S60 PolarHBondContact O-OG 3.2Å; S57-S60 PolarHBondContact O-N 2.9Å; S60-G64 PolarHBondContact O-N 3.41Å
61	H	73.9	Confident	74.9	Confident	155 Å²	155	83 Å²	83	72%	0.718	52%	0.518	S	S	*	.	H	α-helix	trans	-68.6	-46.3	178.6	-151.8	76.7	0	0	111.8	S57 G58 V59 G64 A65	S57-H61 WeakPolarHBondContact O-CB 3.24Å; S57-H61 PolarHBondContact O-N 3.02Å; G58-H61 PolarHBondContact O-N 3.29Å; V59-H61 VanDerWaalsContact C-N 3.34Å; V59-H61 PolarHBondContact O-N 3.44Å; H61-G64 PolarHBondContact O-N 3.31Å; H61-A65 WeakPolarHBondContact O-CB 3.47Å; H61-A65 PolarHBondContact O-N 2.81Å
62	V	75	Confident	75.4	Confident	93 Å²	93	81.1 Å²	81.1	56%	0.564	51%	0.512	S	S	*	.	H	α-helix	trans	-64.1	-42.4	174.9	174.2	0	0	0	110.7	G58 G64 A65 V66	G58-V62 WeakPolarHBondContact O-CB 3.19Å; G58-V62 VanDerWaalsContact O-CG2 3.3Å; G58-V62 WeakPolarHBondContact O-CG2 3.26Å; G58-V62 PolarHBondContact O-N 3.38Å; V62-G64 PolarHBondContact O-N 3Å; V62-A65 PolarHBondContact O-N 3.42Å; V62-V66 HydrophobicContact CG1-CG2 4.26Å; V62-V66 VanDerWaalsContact O-CG2 3.3Å; V62-V66 WeakPolarHBondContact O-CG2 3.16Å; V62-V66 PolarHBondContact O-N 2.99Å
63	G	78.1	Confident	76.3	Confident	33 Å²	33	83.3 Å²	83.3	34%	0.34	52%	0.52	S	S	.	.	H	α-helix	trans	-59.5	-45.4	176.5	0	0	0	0	112.3	V59 V66 V67	V59-G63 WeakPolarHBondContact O-CA 3.49Å; V59-G63 PolarHBondContact O-N 3.01Å; G63-V66 PolarHBondContact O-N 3.5Å; G63-V67 WeakPolarHBondContact O-CG2 3.42Å; G63-V67 PolarHBondContact O-N 3.38Å
64	G	82.6	Confident	76.9	Confident	38 Å²	38	79.4 Å²	79.4	39%	0.392	51%	0.511	S	S	.	.	H	α-helix	trans	-61.4	-43.6	173.6	0	0	0	0	112.9	S60 H61 V62 V66 V67 T68	S60-G64 PolarHBondContact O-N 3.41Å; H61-G64 PolarHBondContact O-N 3.31Å; V62-G64 PolarHBondContact O-N 3Å; G64-V66 PolarHBondContact O-N 3.02Å; G64-V67 PolarHBondContact O-N 2.92Å; G64-T68 WeakPolarHBondContact O-CB 3.46Å; G64-T68 WeakPolarHBondContact O-CG2 3.33Å; G64-T68 PolarHBondContact O-N 3.5Å; G64-T68 PolarHBondContact O-OG1 2.98Å
65	A	76.9	Confident	77.4	Confident	57 Å²	57	77.4 Å²	77.4	47%	0.471	50%	0.504	S	S	.	.	H	α-helix	trans	-63.3	-38.9	176.9	0	0	0	0	112.8	H61 V62 T68 G69	H61-A65 WeakPolarHBondContact O-CB 3.47Å; H61-A65 PolarHBondContact O-N 2.81Å; V62-A65 PolarHBondContact O-N 3.42Å; A65-T68 WeakPolarHBondContact CA-OG1 3.45Å; A65-T68 PolarHBondContact O-OG1 3.42Å; A65-G69 PolarHBondContact O-N 3Å
66	V	83.4	Confident	78	Confident	85 Å²	85	81.1 Å²	81.1	52%	0.515	51%	0.513	S	S	.	.	H	α-helix	trans	-67.6	-47	176.7	172	0	0	0	110.8	V62 G63 G64 T68 G69 V70	V62-V66 HydrophobicContact CG1-CG2 4.26Å; V62-V66 VanDerWaalsContact O-CG2 3.3Å; V62-V66 WeakPolarHBondContact O-CG2 3.16Å; V62-V66 PolarHBondContact O-N 2.99Å; G63-V66 PolarHBondContact O-N 3.5Å; G64-V66 PolarHBondContact O-N 3.02Å; V66-T68 PolarHBondContact O-N 2.88Å; V66-G69 PolarHBondContact O-N 3.5Å; V66-V70 HydrophobicContact CG1-CG2 4.39Å; V66-V70 WeakPolarHBondContact O-CG2 3.38Å; V66-V70 PolarHBondContact O-N 2.96Å
67	V	79.4	Confident	78.4	Confident	95 Å²	95	80.8 Å²	80.8	58%	0.576	51%	0.512	S	S	*	.	H	α-helix	trans	-60.5	-48.2	179	171.5	0	0	0	110.7	G63 G64 G69 V70 T71	G63-V67 WeakPolarHBondContact O-CG2 3.42Å; G63-V67 PolarHBondContact O-N 3.38Å; G64-V67 PolarHBondContact O-N 2.92Å; V67-G69 PolarHBondContact O-N 3.44Å; V67-V70 PolarHBondContact O-N 2.97Å; V67-T71 PolarHBondContact O-N 3.15Å; V67-T71 PolarHBondContact O-OG1 2.76Å; V67-T71 VanDerWaalsContact O-OG1 3.05Å
68	T	82.4	Confident	79	Confident	90 Å²	90	82.2 Å²	82.2	55%	0.552	52%	0.516	S	S	*	.	H	α-helix	trans	-62.7	-40.5	176.6	46.7	0	0	0	112.5	G64 A65 V66 T71 A72	G64-T68 WeakPolarHBondContact O-CB 3.46Å; G64-T68 WeakPolarHBondContact O-CG2 3.33Å; G64-T68 PolarHBondContact O-N 3.5Å; G64-T68 PolarHBondContact O-OG1 2.98Å; A65-T68 WeakPolarHBondContact CA-OG1 3.45Å; A65-T68 PolarHBondContact O-OG1 3.42Å; V66-T68 PolarHBondContact O-N 2.88Å; T68-T71 PolarHBondContact O-N 3.18Å; T68-A72 WeakPolarHBondContact O-CB 3.35Å; T68-A72 PolarHBondContact O-N 2.74Å
69	G	82.8	Confident	79.4	Confident	33 Å²	33	86.6 Å²	86.6	34%	0.34	53%	0.528	S	S	.	.	H	α-helix	trans	-60.3	-46.6	174.6	0	0	0	0	112.6	A65 V66 V67 A72 V73	A65-G69 PolarHBondContact O-N 3Å; V66-G69 PolarHBondContact O-N 3.5Å; V67-G69 PolarHBondContact O-N 3.44Å; G69-A72 PolarHBondContact O-N 3.14Å; G69-V73 VanDerWaalsContact O-CG2 3.31Å; G69-V73 WeakPolarHBondContact O-CG2 3.41Å; G69-V73 PolarHBondContact O-N 3.46Å
70	V	82.7	Confident	79.9	Confident	93 Å²	93	83.4 Å²	83.4	56%	0.564	52%	0.515	S	S	*	.	H	α-helix	trans	-64.3	-43.4	177	173.4	0	0	0	111.1	V66 V67 A72 V73 A74	V66-V70 HydrophobicContact CG1-CG2 4.39Å; V66-V70 WeakPolarHBondContact O-CG2 3.38Å; V66-V70 PolarHBondContact O-N 2.96Å; V67-V70 PolarHBondContact O-N 2.97Å; V70-A72 VanDerWaalsContact C-N 3.35Å; V70-A72 PolarHBondContact O-N 3.28Å; V70-V73 PolarHBondContact O-N 2.96Å; V70-A74 WeakPolarHBondContact O-CB 3.41Å; V70-A74 PolarHBondContact O-N 2.99Å
71	T	80.7	Confident	80	Confident	67 Å²	67	82.2 Å²	82.2	41%	0.411	51%	0.51	S	S	.	.	H	α-helix	trans	-60.6	-43.7	174.9	-58.9	0	0	0	111.7	V67 T68 V73 A74 Q75	V67-T71 PolarHBondContact O-N 3.15Å; V67-T71 PolarHBondContact O-OG1 2.76Å; V67-T71 VanDerWaalsContact O-OG1 3.05Å; T68-T71 PolarHBondContact O-N 3.18Å; T71-V73 PolarHBondContact O-N 3.48Å; T71-A74 PolarHBondContact O-N 3.34Å; T71-Q75 HydrophobicContact CG2-CG 4.42Å; T71-Q75 WeakPolarHBondContact O-CB 3.45Å; T71-Q75 WeakPolarHBondContact O-CG 3.41Å; T71-Q75 PolarHBondContact O-N 3.41Å
72	A	82.4	Confident	79.9	Confident	52 Å²	52	76.6 Å²	76.6	43%	0.43	49%	0.493	S	S	.	.	H	α-helix	trans	-63.9	-40.7	177.7	0	0	0	0	112.1	T68 G69 V70 Q75 K76	T68-A72 WeakPolarHBondContact O-CB 3.35Å; T68-A72 PolarHBondContact O-N 2.74Å; G69-A72 PolarHBondContact O-N 3.14Å; V70-A72 VanDerWaalsContact C-N 3.35Å; V70-A72 PolarHBondContact O-N 3.28Å; A72-Q75 PolarHBondContact O-N 3.02Å; A72-K76 VanDerWaalsContact O-CB 3.23Å; A72-K76 WeakPolarHBondContact O-CB 3.46Å; A72-K76 PolarHBondContact O-N 3.02Å
73	V	83.6	Confident	80.1	Confident	97 Å²	97	77.7 Å²	77.7	59%	0.588	50%	0.496	S	S	*	.	H	α-helix	trans	-64	-43.4	174.9	170.8	0	0	0	111	G69 V70 T71 K76 T77	G69-V73 VanDerWaalsContact O-CG2 3.31Å; G69-V73 WeakPolarHBondContact O-CG2 3.41Å; G69-V73 PolarHBondContact O-N 3.46Å; V70-V73 PolarHBondContact O-N 2.96Å; T71-V73 PolarHBondContact O-N 3.48Å; V73-K76 PolarHBondContact O-N 2.95Å; V73-T77 WeakPolarHBondContact O-CB 3.3Å; V73-T77 PolarHBondContact O-N 3.45Å; V73-T77 PolarHBondContact O-OG1 3.11Å
74	A	79.5	Confident	79.8	Confident	53 Å²	53	81.4 Å²	81.4	44%	0.438	51%	0.507	S	S	.	.	H	α-helix	trans	-62.4	-48.1	177.1	0	0	0	0	111.6	V70 T71 K76 T77 V78	V70-A74 WeakPolarHBondContact O-CB 3.41Å; V70-A74 PolarHBondContact O-N 2.99Å; T71-A74 PolarHBondContact O-N 3.34Å; A74-K76 PolarHBondContact O-N 3.33Å; A74-T77 PolarHBondContact O-N 2.95Å; A74-V78 WeakPolarHBondContact O-CG2 3.29Å; A74-V78 PolarHBondContact O-N 3.23Å
75	Q	81.2	Confident	79.2	Confident	115 Å²	115	82 Å²	82	54%	0.537	51%	0.508	S	S	.	.	H	α-helix	trans	-59.2	-48.4	176.7	-74.6	177.8	-9.8	0	111.4	T71 A72 T77 V78 E79	T71-Q75 HydrophobicContact CG2-CG 4.42Å; T71-Q75 WeakPolarHBondContact O-CB 3.45Å; T71-Q75 WeakPolarHBondContact O-CG 3.41Å; T71-Q75 PolarHBondContact O-N 3.41Å; A72-Q75 PolarHBondContact O-N 3.02Å; Q75-T77 VanDerWaalsContact C-N 3.26Å; Q75-T77 PolarHBondContact O-N 3.5Å; Q75-V78 PolarHBondContact O-N 2.95Å; Q75-E79 WeakPolarHBondContact O-CB 3.32Å; Q75-E79 WeakPolarHBondContact O-CG 3.4Å; Q75-E79 PolarHBondContact O-N 2.98Å
76	K	83	Confident	78.8	Confident	161 Å²	161	83 Å²	83	70%	0.7	52%	0.516	S	S	*	.	H	α-helix	trans	-65	-30.5	179.4	-162.3	173.2	-174.7	177.1	112.7	A72 V73 A74 G80	A72-K76 VanDerWaalsContact O-CB 3.23Å; A72-K76 WeakPolarHBondContact O-CB 3.46Å; A72-K76 PolarHBondContact O-N 3.02Å; V73-K76 PolarHBondContact O-N 2.95Å; A74-K76 PolarHBondContact O-N 3.33Å; K76-G80 PolarHBondContact O-N 3Å
77	T	80.1	Confident	78	Confident	88 Å²	88	83.2 Å²	83.2	54%	0.54	53%	0.527	S	S	.	.	H	α-helix	trans	-72	-42.9	174.6	-58.2	0	0	0	111.4	V73 A74 Q75 G80 A81	V73-T77 WeakPolarHBondContact O-CB 3.3Å; V73-T77 PolarHBondContact O-N 3.45Å; V73-T77 PolarHBondContact O-OG1 3.11Å; A74-T77 PolarHBondContact O-N 2.95Å; Q75-T77 VanDerWaalsContact C-N 3.26Å; Q75-T77 PolarHBondContact O-N 3.5Å; T77-G80 PolarHBondContact O-N 3.33Å; T77-A81 VanDerWaalsContact O-CB 3.25Å; T77-A81 WeakPolarHBondContact O-CB 3.38Å; T77-A81 PolarHBondContact O-N 3.03Å
78	V	79.9	Confident	77.4	Confident	108 Å²	108	82.8 Å²	82.8	66%	0.655	53%	0.525	S	S	*	.	H	α-helix	trans	-65.8	-43.9	176.3	173.3	0	0	0	111	A74 Q75 A81 G82	A74-V78 WeakPolarHBondContact O-CG2 3.29Å; A74-V78 PolarHBondContact O-N 3.23Å; Q75-V78 PolarHBondContact O-N 2.95Å; V78-A81 PolarHBondContact O-N 2.89Å; V78-G82 PolarHBondContact O-N 2.77Å
79	E	79.1	Confident	76.4	Confident	127 Å²	127	80.5 Å²	80.5	59%	0.593	52%	0.519	S	S	*	.	H	α-helix	trans	-64.5	-42	174.7	-73.5	176.2	-175.9	0	111.8	Q75 G82 N83	Q75-E79 WeakPolarHBondContact O-CB 3.32Å; Q75-E79 WeakPolarHBondContact O-CG 3.4Å; Q75-E79 PolarHBondContact O-N 2.98Å; E79-G82 PolarHBondContact O-N 2.96Å; E79-N83 WeakPolarHBondContact O-CB 3.42Å; E79-N83 PolarHBondContact O-N 3.46Å
80	G	78.5	Confident	75.3	Confident	30 Å²	30	86 Å²	86	31%	0.309	54%	0.54	S	S	.	.	H	α-helix	trans	-61.8	-48.4	175.5	0	0	0	0	112.1	K76 T77 G82 N83 I84	K76-G80 PolarHBondContact O-N 3Å; T77-G80 PolarHBondContact O-N 3.33Å; G80-G82 VanDerWaalsContact C-N 3.35Å; G80-G82 PolarHBondContact O-N 3.37Å; G80-N83 PolarHBondContact O-N 3.44Å; G80-I84 WeakPolarHBondContact O-CD1 3.43Å; G80-I84 WeakPolarHBondContact O-CG1 3.4Å; G80-I84 PolarHBondContact O-N 3.19Å
81	A	74.9	Confident	73.9	Confident	57 Å²	57	87.7 Å²	87.7	47%	0.471	55%	0.55	S	S	.	*	H	α-helix	trans	-63.5	-39.8	176.1	0	0	0	0	112	T77 V78 I84 A85	T77-A81 VanDerWaalsContact O-CB 3.25Å; T77-A81 WeakPolarHBondContact O-CB 3.38Å; T77-A81 PolarHBondContact O-N 3.03Å; V78-A81 PolarHBondContact O-N 2.89Å; A81-I84 PolarHBondContact O-N 3.36Å; A81-A85 WeakPolarHBondContact O-CB 3.41Å; A81-A85 PolarHBondContact O-N 3.25Å
82	G	72	Confident	72.8	Confident	36 Å²	36	93.9 Å²	93.9	37%	0.371	57%	0.572	S	S	.	*	H	α-helix	trans	-63.9	-44.4	175.2	0	0	0	0	112.5	V78 E79 G80 I84 A85 A86	V78-G82 PolarHBondContact O-N 2.77Å; E79-G82 PolarHBondContact O-N 2.96Å; G80-G82 VanDerWaalsContact C-N 3.35Å; G80-G82 PolarHBondContact O-N 3.37Å; G82-I84 VanDerWaalsContact C-N 3.34Å; G82-I84 PolarHBondContact O-N 3.35Å; G82-A85 PolarHBondContact O-N 2.94Å; G82-A86 VanDerWaalsContact O-CB 3.25Å; G82-A86 WeakPolarHBondContact O-CB 3.32Å; G82-A86 PolarHBondContact O-N 2.94Å
83	N	78.1	Confident	71.4	Confident	117 Å²	117	100.5 Å²	100.5	63%	0.626	59%	0.591	S	S	*	*	H	α-helix	trans	-64.8	-39.1	175.8	-81.3	7.7	0	0	111.8	E79 G80 A87	E79-N83 WeakPolarHBondContact O-CB 3.42Å; E79-N83 PolarHBondContact O-N 3.46Å; G80-N83 PolarHBondContact O-N 3.44Å; N83-A87 WeakPolarHBondContact O-CB 3.34Å; N83-A87 PolarHBondContact O-N 2.93Å
84	I	72.3	Confident	69.6	Low	110 Å²	110	102 Å²	102	56%	0.564	60%	0.595	S	S	*	*	H	α-helix	trans	-65	-49.6	174.8	-65.5	161.1	0	0	109.5	G80 A81 G82 A86 A87 T88	G80-I84 WeakPolarHBondContact O-CD1 3.43Å; G80-I84 WeakPolarHBondContact O-CG1 3.4Å; G80-I84 PolarHBondContact O-N 3.19Å; A81-I84 PolarHBondContact O-N 3.36Å; G82-I84 VanDerWaalsContact C-N 3.34Å; G82-I84 PolarHBondContact O-N 3.35Å; I84-A86 VanDerWaalsContact C-N 3.31Å; I84-A86 PolarHBondContact O-N 2.92Å; I84-A87 PolarHBondContact O-N 3.37Å; I84-T88 HydrophobicContact CG2-CG2 3.97Å; I84-T88 WeakPolarHBondContact O-CB 3.35Å; I84-T88 VanDerWaalsContact O-CG2 3.3Å; I84-T88 WeakPolarHBondContact O-CG2 3.38Å; I84-T88 PolarHBondContact O-N 3.25Å; I84-T88 PolarHBondContact O-OG1 3.27Å
85	A	70	Confident	68.2	Low	50 Å²	50	105.6 Å²	105.6	41%	0.413	61%	0.614	S	S	.	*	H	α-helix	trans	-60.9	-38.1	179.1	0	0	0	0	113.1	A81 G82 T88 G89 L90	A81-A85 WeakPolarHBondContact O-CB 3.41Å; A81-A85 PolarHBondContact O-N 3.25Å; G82-A85 PolarHBondContact O-N 2.94Å; A85-T88 PolarHBondContact O-OG1 2.98Å; A85-G89 PolarHBondContact O-N 2.88Å; A85-G89 VanDerWaalsContact O-N 3.16Å; A85-L90 PolarHBondContact O-N 3.37Å
86	A	68.3	Low	66.3	Low	78 Å²	78	103.9 Å²	103.9	65%	0.645	62%	0.62	S	S	*	*	H	α-helix	trans	-68.7	-43	175.1	0	0	0	0	111.9	G82 I84 G89	G82-A86 VanDerWaalsContact O-CB 3.25Å; G82-A86 WeakPolarHBondContact O-CB 3.32Å; G82-A86 PolarHBondContact O-N 2.94Å; I84-A86 VanDerWaalsContact C-N 3.31Å; I84-A86 PolarHBondContact O-N 2.92Å; A86-G89 PolarHBondContact O-N 3.28Å
87	A	67.1	Low	64.6	Low	90 Å²	90	106 Å²	106	74%	0.744	63%	0.629	S	S	*	*	H	α-helix	trans	-72.6	-37	179.3	0	0	0	0	112.9	N83 I84 G89	N83-A87 WeakPolarHBondContact O-CB 3.34Å; N83-A87 PolarHBondContact O-N 2.93Å; I84-A87 PolarHBondContact O-N 3.37Å; A87-G89 PolarHBondContact O-N 2.99Å
88	T	67.3	Low	62.6	Low	86 Å²	86	110.9 Å²	110.9	53%	0.528	65%	0.646	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.1	-5.4	175.1	62.9	0	0	0	112.3	I84 A85 L90	I84-T88 HydrophobicContact CG2-CG2 3.97Å; I84-T88 WeakPolarHBondContact O-CB 3.35Å; I84-T88 VanDerWaalsContact O-CG2 3.3Å; I84-T88 WeakPolarHBondContact O-CG2 3.38Å; I84-T88 PolarHBondContact O-N 3.25Å; I84-T88 PolarHBondContact O-OG1 3.27Å; A85-T88 PolarHBondContact O-OG1 2.98Å; T88-L90 VanDerWaalsContact C-N 3.33Å; T88-L90 PolarHBondContact O-N 2.86Å
89	G	60.8	Low	60.5	Low	42 Å²	42	109.4 Å²	109.4	43%	0.433	65%	0.652	S	S	.	*	T	Hydrogen-bonded Turn	trans	53.7	48.4	174.6	0	0	0	0	112.2	A85 A86 A87 V91	A85-G89 PolarHBondContact O-N 2.88Å; A85-G89 VanDerWaalsContact O-N 3.16Å; A86-G89 PolarHBondContact O-N 3.28Å; A87-G89 PolarHBondContact O-N 2.99Å; G89-V91 WeakPolarHBondContact O-CG2 3.4Å; G89-V91 PolarHBondContact O-N 3.37Å
90	L	60.3	Low	58.7	Low	150 Å²	150	112.2 Å²	112.2	79%	0.785	67%	0.665	S	S	*	*			trans	-71.6	67.2	-180	-137.3	103.2	0	0	109.9	A85 T88 K92	A85-L90 PolarHBondContact O-N 3.37Å; T88-L90 VanDerWaalsContact C-N 3.33Å; T88-L90 PolarHBondContact O-N 2.86Å; L90-K92 PolarHBondContact O-N 3.12Å
91	V	53.6	Low	56.7	Low	128 Å²	128	118 Å²	118	78%	0.776	69%	0.689	S	S	*	*			trans	-66.1	127	165.8	-88.6	0	0	0	107.4	G89 K93	G89-V91 WeakPolarHBondContact O-CG2 3.4Å; G89-V91 PolarHBondContact O-N 3.37Å; V91-K93 PolarHBondContact O-N 2.91Å
92	K	57.7	Low	54.8	Low	197 Å²	197	121.4 Å²	121.4	86%	0.857	70%	0.704	S	S	*	*			trans	-48.8	106.8	171.6	-70.3	173.2	-179.4	172.4	108	L90 D94	L90-K92 PolarHBondContact O-N 3.12Å; K92-D94 VanDerWaalsContact C-N 3.31Å; K92-D94 PolarHBondContact O-N 3.27Å; K92-D94 VanDerWaalsContact O-N 3.09Å
93	K	52.5	Low	53.1	Low	191 Å²	191	124.9 Å²	124.9	83%	0.83	72%	0.722	S	S	*	*			trans	-74.6	97.4	163.9	-170.3	162.5	179.9	159.9	104.9	V91	V91-K93 PolarHBondContact O-N 2.91Å
94	D	46.5	Very low	51.4	Low	127 Å²	127	123.2 Å²	123.2	68%	0.679	73%	0.725	S	S	*	*			trans	-44.7	137.2	162	-73.2	-56.5	0	0	107.8	K92 A96	K92-D94 VanDerWaalsContact C-N 3.31Å; K92-D94 PolarHBondContact O-N 3.27Å; K92-D94 VanDerWaalsContact O-N 3.09Å; D94-A96 PolarHBondContact O-N 3.5Å
95	P	48.4	Very low	49.8	Very low	130 Å²	130	123.7 Å²	123.7	84%	0.844	73%	0.733	S	S	*	*			trans	-70.5	76.9	178.9	29.1	-33.1	0	0	109.2	K97	P95-K97 VanDerWaalsContact C-N 3.34Å; P95-K97 PolarHBondContact O-N 3.35Å
96	A	41.7	Very low	48.6	Very low	79 Å²	79	126.9 Å²	126.9	65%	0.653	75%	0.749	S	S	*	*			trans	-73.3	94.3	165.4	0	0	0	0	107.4	D94 Q98	D94-A96 PolarHBondContact O-N 3.5Å; A96-Q98 PolarHBondContact O-N 2.87Å
97	K	47.8	Very low	47	Very low	205 Å²	205	129.7 Å²	129.7	89%	0.891	75%	0.753	S	S	*	*			trans	8.7	98.8	149.5	-61.9	177.3	-178.3	166.9	114.6	P95	P95-K97 VanDerWaalsContact C-N 3.34Å; P95-K97 PolarHBondContact O-N 3.35Å
98	Q	38.6	Very low	46.2	Very low	191 Å²	191	130 Å²	130	89%	0.893	76%	0.756	S	S	*	*			trans	-131.5	101.3	148	-70.8	-177.7	-1.9	0	102.8	A96	A96-Q98 PolarHBondContact O-N 2.87Å
99	G	35.5	Very low	45	Very low	76 Å²	76	131.3 Å²	131.3	78%	0.784	76%	0.763	S	S	*	*				114.1	116.1	74.4	0	0	0	0	104.5
100	E	41.4	Very low	44	Very low	186 Å²	186	138.3 Å²	138.3	87%	0.869	79%	0.785	S	S	*	*			trans	-61.3	162.3	-172.2	-70.4	165.3	104.7	0	113.8
101	D	37	Very low	43.4	Very low	151 Å²	151	136.2 Å²	136.2	81%	0.807	78%	0.783	S	S	*	*			trans	79.1	119.2	170	-85.9	-69.5	0	0	116.5
102	V	34.9	Very low	43.4	Very low	130 Å²	130	135.7 Å²	135.7	79%	0.788	78%	0.782	S	S	*	*			cis	-157.7	131.5	48.4	169.9	0	0	0	112.1
103	S	35	Very low	42.9	Very low	108 Å²	108	132.2 Å²	132.2	76%	0.755	78%	0.777	S	S	*	*			trans	70.5	121	146	-152.4	0	0	0	122.9
104	A	42.5	Very low	42.6	Very low	82 Å²	82	130.6 Å²	130.6	68%	0.678	78%	0.777	S	S	*	*			trans	-45.4	155.4	157.5	0	0	0	0	112.8
105	V	38.5	Very low	42.7	Very low	121 Å²	121	130 Å²	130	73%	0.733	78%	0.778	S	S	*	*				-158.8	145.2	62.9	-178.8	0	0	0	110.5
106	P	45.4	Very low	42.4	Very low	117 Å²	117	129.6 Å²	129.6	76%	0.76	77%	0.769	S	S	*	*			trans	-88.8	126.8	169.5	33.9	-26.3	0	0	110.3
107	D	35.4	Very low	42.6	Very low	137 Å²	137	131.9 Å²	131.9	73%	0.733	78%	0.78	S	S	*	*			trans	-110.6	96.2	166.8	-111.5	-66.4	0	0	109.4
108	A	49.5	Very low	42.4	Very low	96 Å²	96	127.5 Å²	127.5	79%	0.793	77%	0.771	S	S	*	*			trans	-78.2	110.1	156.3	0	0	0	0	107.4
109	V	41.1	Very low	42.7	Very low	114 Å²	114	126.3 Å²	126.3	69%	0.691	77%	0.765	S	S	*	*			trans	-127	94	160.7	-66.5	0	0	0	106.3
110	E	39.8	Very low	43.6	Very low	189 Å²	189	128.2 Å²	128.2	88%	0.883	76%	0.764	S	S	*	*				53.7	104.7	114	-90.3	-169.5	109.9	0	113.8
111	S	47.9	Very low	43.8	Very low	106 Å²	106	125 Å²	125	74%	0.741	76%	0.757	S	S	*	*			trans	-54	156.5	159.1	-42.8	0	0	0	111.1
112	P	53.6	Low	44.6	Very low	116 Å²	116	126.4 Å²	126.4	75%	0.753	76%	0.759	S	S	*	*				-120	133.8	123.8	18.9	-3.7	0	0	110.8	D114	P112-D114 PolarHBondContact O-N 3.49Å
113	V	47.7	Very low	45.4	Very low	124 Å²	124	128.9 Å²	128.9	75%	0.752	76%	0.762	S	S	*	*			trans	-69.4	103.6	167.7	178.5	0	0	0	106.5	T115	V113-T115 PolarHBondContact O-N 3.31Å
114	D	47.2	Very low	46.3	Very low	158 Å²	158	131.9 Å²	131.9	85%	0.845	77%	0.769	S	S	*	*			trans	-79.9	106	166.1	-91.5	-52.2	0	0	108.9	P112	P112-D114 PolarHBondContact O-N 3.49Å
115	T	47.4	Very low	47.2	Very low	113 Å²	113	132.5 Å²	132.5	69%	0.693	77%	0.769	S	S	*	*			trans	-64.8	151.3	167.9	46.4	0	0	0	111.5	V113	V113-T115 PolarHBondContact O-N 3.31Å
116	D	43.4	Very low	48.3	Very low	122 Å²	122	134.6 Å²	134.6	65%	0.652	78%	0.776	S	S	*	*			trans	86.6	96.6	154.7	-139.3	110.2	0	0	117.5	T118	D116-T118 PolarHBondContact OD2-N 3.43Å; D116-T118 PolarHBondContact OD2-OG1 2.9Å
117	S	44.2	Very low	48.8	Very low	128 Å²	128	140.7 Å²	140.7	90%	0.895	80%	0.802	S	S	*	*			trans	-139.5	69.8	145.3	-72.7	0	0	0	107
118	T	44.9	Very low	49.5	Very low	112 Å²	112	140.9 Å²	140.9	69%	0.687	81%	0.805	S	S	*	*			trans	-97.9	100.6	159.6	40.4	0	0	0	108.5	D116	D116-T118 PolarHBondContact OD2-N 3.43Å; D116-T118 PolarHBondContact OD2-OG1 2.9Å
119	E	44.9	Very low	49.5	Very low	167 Å²	167	143.2 Å²	143.2	78%	0.78	81%	0.806	S	S	*	*			trans	-137.3	101.3	160.9	-154.2	171.8	-179.3	0	108.4	T121	E119-T121 HydrophobicContact CG-CG2 4.33Å
120	P	54.4	Low	49.9	Very low	116 Å²	116	144.8 Å²	144.8	75%	0.753	81%	0.812	S	S	*	*			trans	-84.9	101.1	162.4	31.9	-23.5	0	0	107.1	E122	P120-E122 PolarHBondContact O-N 3.13Å
121	T	45.6	Very low	50.5	Low	119 Å²	119	142.2 Å²	142.2	73%	0.73	81%	0.808	S	S	*	*			trans	-78.5	97.4	163.1	49	0	0	0	107.8	E119 E123	E119-T121 HydrophobicContact CG-CG2 4.33Å; T121-E123 PolarHBondContact O-N 2.93Å
122	E	54.2	Low	50.7	Low	180 Å²	180	144.5 Å²	144.5	84%	0.841	81%	0.812	S	S	*	*			trans	-63.5	118.9	152.1	-61.9	-162.6	150.2	0	108	P120	P120-E122 PolarHBondContact O-N 3.13Å
123	E	50.6	Low	50.5	Low	181 Å²	181	146.4 Å²	146.4	85%	0.846	82%	0.816	S	S	*	*			trans	174.4	103.1	146.4	-105	-177.7	151.5	0	107.8	T121	T121-E123 PolarHBondContact O-N 2.93Å
124	D	54.3	Low	50.7	Low	171 Å²	171	148 Å²	148	91%	0.914	82%	0.821	S	S	*	*			trans	-156.8	93.8	134.5	-108.8	-28.4	0	0	108.1
125	S	60.8	Low	51	Low	95 Å²	95	147.2 Å²	147.2	66%	0.664	82%	0.819	S	S	*	*			trans	-88.4	119.6	158.4	-33	0	0	0	104.9
126	D	62	Low	51.3	Low	166 Å²	166	150.1 Å²	150.1	89%	0.888	83%	0.83	S	S	*	*			trans	168.2	142.9	132.6	-85.8	-25	0	0	113.3
127	D	56	Low	52	Low	244 Å²	244	152.6 Å²	152.6	100%	1.305	85%	0.846	S	S	*	*			trans	79.1	0	176.7	-96.5	-35.3	0	0	120.3

Retrieved 127 of 127 residues in 193 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).