A0A087XY28_POEFO Loading...

DNA-directed RNA polymerase subunit

Core component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs using the four ribonucleoside triphosphates as substrates. Can mediate Pol I proofreading of the nascent RNA transcript. Anchors into the Pol III active site to constantly monitor transcription fidelity, cleaves mis-incorporated 5'-ribonucleotides and restarts the transcription process. Once Pol III reaches the poly(dT) termination signal, can induce Pol III clamp opening and transcription termination. Pol III plays an important role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as a nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

AlphaFold DB , UniProt , Accession A0A087XY28, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 108 aa.

						>A0A087XY28_POEFO|A0A087XY28
MLLFCPTCGNVLIVEEGQRCLRFACNTCPYVHNITRKVNNRKYPKLKEVDDVLGGAAAWENVDSTAETCPKCEHPRAYFMQIQTRSADEPMTTFYKCCNAQCGHRWRD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	73.1	Confident	86.5	Confident	142 Å²	142	81.5 Å²	81.5	70%	0.7	47%	0.468	S	S	*	.				0	125.1	0	-173.4	170.8	75.7	0	0	106.2	L3 V38 N40	M1-L3 HydrophobicContact CE-CD2 4.11Å; M1-L3 HydrophobicContact CE-CG 4.35Å; M1-V38 HydrophobicContact CE-CG1 4.19Å; M1-N40 PolarHBondContact N-ND2 3.28Å
2	L	82.3	Confident	86.9	Confident	122 Å²	122	76.3 Å²	76.3	64%	0.639	44%	0.438	S	S	*	.			trans	-94.9	132.6	174.7	-65.7	171.6	0	0	0	107.7	F4 V11	L2-F4 HydrophobicContact CB-CE2 4.14Å; L2-F4 HydrophobicContact CB-CZ 4.02Å; L2-F4 HydrophobicContact CD1-CZ 4.49Å; L2-V11 HydrophobicContact CD2-CG1 4.23Å
3	L	85.6	Confident	87.2	Confident	62 Å²	62	75.2 Å²	75.2	33%	0.325	43%	0.428	S	S	.	.			trans	-107.5	135.3	175.1	-70.6	166.6	0	0	0	108	M1 L12 F23	M1-L3 HydrophobicContact CE-CD2 4.11Å; M1-L3 HydrophobicContact CE-CG 4.35Å; L3-L12 HydrophobicContact CB-CB 4.38Å; L3-L12 HydrophobicContact CB-CD1 4.18Å; L3-L12 PolarHBondContact O-N 3.32Å; L3-F23 HydrophobicContact CD1-CD1 4.05Å; L3-F23 HydrophobicContact CD1-CD2 4.13Å; L3-F23 HydrophobicContact CD1-CE1 3.61Å; L3-F23 HydrophobicContact CD1-CE2 3.68Å; L3-F23 HydrophobicContact CD1-CG 4.3Å; L3-F23 HydrophobicContact CD1-CZ 3.42Å; L3-F23 VanDerWaalsContact CD1-CZ 3.42Å
4	F	90.9	Very high	87.5	Confident	122 Å²	122	76 Å²	76	54%	0.535	44%	0.435	S	S	.	.	B	Isolated β-bridge	trans	-112.3	147.2	-176.6	-61.6	-79.1	0	0	0	110.8	L2 G9 N10 V11	L2-F4 HydrophobicContact CB-CE2 4.14Å; L2-F4 HydrophobicContact CB-CZ 4.02Å; L2-F4 HydrophobicContact CD1-CZ 4.49Å; F4-G9 WeakPolarHBondContact CD1-O 3.29Å; F4-N10 WeakPolarHBondContact CA-O 3.39Å; F4-V11 HydrophobicContact CD1-CG2 3.99Å; F4-V11 HydrophobicContact CE1-CG2 3.62Å
5	C	90.6	Very high	87.6	Confident	3 Å²	3	76.3 Å²	76.3	2%	0.02	43%	0.431	C	S	.	.			trans	-73.2	130.3	176	-172.6	0	0	0	0	110.3	T7 C8 G9 N10 L12 C25 C28 Y30	C5-T7 PolarHBondContact O-N 3.43Å; C5-T7 PolarHBondContact SG-OG1 3.42Å; C5-C8 VanDerWaalsContact CB-SG 3.59Å; C5-C8 VanDerWaalsContact SG-SG 3.66Å; C5-G9 VanDerWaalsContact O-CA 3.29Å; C5-G9 WeakPolarHBondContact O-CA 3.36Å; C5-G9 PolarHBondContact O-N 2.94Å; C5-N10 WeakPolarHBondContact CB-O 3.45Å; C5-N10 PolarHBondContact N-O 3.44Å; C5-L12 HydrophobicContact CB-CD2 3.84Å; C5-L12 HydrophobicContact CB-CG 4.38Å; C5-C25 HydrophobicContact CB-CB 4.33Å; C5-C28 PolarHBondContact SG-SG 2.89Å; C5-Y30 VanDerWaalsContact SG-CB 3.55Å
6	P	88.4	Confident	87.6	Confident	96 Å²	96	82 Å²	82	62%	0.623	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.2	-18.4	-178.8	26.9	-34.3	0	0	0	114	Y30	P6-Y30 HydrophobicContact CG-CD2 4.08Å; P6-Y30 HydrophobicContact CG-CE1 4.46Å; P6-Y30 HydrophobicContact CG-CE2 3.6Å
7	T	87.1	Confident	87.3	Confident	105 Å²	105	78.5 Å²	78.5	64%	0.644	44%	0.441	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95	-41.4	-176.9	50.5	0	0	0	0	113.3	C5 C28	C5-T7 PolarHBondContact O-N 3.43Å; C5-T7 PolarHBondContact SG-OG1 3.42Å; T7-C28 PolarHBondContact OG1-SG 2.84Å
8	C	89	Confident	87	Confident	52 Å²	52	85.6 Å²	85.6	35%	0.351	47%	0.469	S	S	.	.	T	Hydrogen-bonded Turn	trans	-117.6	-2.6	-175.5	62.6	0	0	0	0	114.5	C5 N10 C25 T27	C5-C8 VanDerWaalsContact CB-SG 3.59Å; C5-C8 VanDerWaalsContact SG-SG 3.66Å; C8-N10 PolarHBondContact O-N 3.13Å; C8-C25 PolarHBondContact SG-SG 2.92Å; C8-T27 PolarHBondContact SG-OG1 3.04Å
9	G	85.1	Confident	86.6	Confident	48 Å²	48	93.6 Å²	93.6	50%	0.495	49%	0.492	S	S	.	.			trans	68.5	-0.3	179.6	0	0	0	0	0	115.3	F4 C5	F4-G9 WeakPolarHBondContact CD1-O 3.29Å; C5-G9 VanDerWaalsContact O-CA 3.29Å; C5-G9 WeakPolarHBondContact O-CA 3.36Å; C5-G9 PolarHBondContact O-N 2.94Å
10	N	88.4	Confident	86.5	Confident	75 Å²	75	92.3 Å²	92.3	40%	0.401	49%	0.49	S	S	.	.	P	Polyproline II helix	trans	-73.7	155.2	178.1	-80.8	-37.2	0	0	0	112.4	F4 C5 C8 L12 T27	F4-N10 WeakPolarHBondContact CA-O 3.39Å; C5-N10 WeakPolarHBondContact CB-O 3.45Å; C5-N10 PolarHBondContact N-O 3.44Å; C8-N10 PolarHBondContact O-N 3.13Å; N10-L12 PolarHBondContact O-N 3.33Å; N10-T27 WeakPolarHBondContact ND2-CG2 3.46Å; N10-T27 PolarHBondContact ND2-OG1 2.82Å
11	V	91.3	Very high	86.6	Confident	69 Å²	69	92 Å²	92	42%	0.418	49%	0.488	S	S	.	.	B	Isolated β-bridge	trans	-66.6	132.6	177.2	179.3	0	0	0	0	109.9	L2 F4	L2-V11 HydrophobicContact CD2-CG1 4.23Å; F4-V11 HydrophobicContact CD1-CG2 3.99Å; F4-V11 HydrophobicContact CE1-CG2 3.62Å
12	L	91.4	Very high	87.4	Confident	20 Å²	20	89.2 Å²	89.2	11%	0.105	47%	0.47	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.9	135.9	174.3	-63.4	172.2	0	0	0	110.4	L3 C5 N10 F23 C25 Y30	L3-L12 HydrophobicContact CB-CB 4.38Å; L3-L12 HydrophobicContact CB-CD1 4.18Å; L3-L12 PolarHBondContact O-N 3.32Å; C5-L12 HydrophobicContact CB-CD2 3.84Å; C5-L12 HydrophobicContact CB-CG 4.38Å; N10-L12 PolarHBondContact O-N 3.33Å; L12-F23 HydrophobicContact CB-CB 4.11Å; L12-F23 HydrophobicContact CD1-CB 4.15Å; L12-C25 HydrophobicContact CD2-CB 3.78Å; L12-Y30 HydrophobicContact CD1-CD1 4.43Å; L12-Y30 HydrophobicContact CD1-CE1 3.89Å; L12-Y30 HydrophobicContact CD2-CD1 3.71Å; L12-Y30 HydrophobicContact CD2-CE1 4.02Å
13	I	91	Very high	87.8	Confident	61 Å²	61	84.9 Å²	84.9	31%	0.313	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	155.6	174.2	60.6	158.3	0	0	0	110.3	E15 F23 A24 N26	I13-E15 HydrophobicContact CD1-CG 3.83Å; I13-E15 HydrophobicContact CG1-CG 4.22Å; I13-F23 CarbonylContact O-C 3.51Å; I13-F23 VanDerWaalsContact O-CA 3.24Å; I13-F23 WeakPolarHBondContact O-CA 3.33Å; I13-A24 VanDerWaalsContact CG1-O 3.3Å; I13-A24 WeakPolarHBondContact CG1-O 3.3Å; I13-A24 PolarHBondContact N-O 2.87Å; I13-A24 PolarHBondContact O-N 3.18Å; I13-N26 WeakPolarHBondContact CD1-OD1 3.34Å; I13-N26 WeakPolarHBondContact CG1-OD1 3.43Å
14	V	90.9	Very high	88	Confident	87 Å²	87	82.1 Å²	82.1	53%	0.527	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	124.7	174.7	-176.2	0	0	0	0	108.6	L21 F23	V14-L21 HydrophobicContact CG1-CD2 3.81Å; V14-F23 HydrophobicContact CG2-CD1 3.79Å; V14-F23 HydrophobicContact CG2-CE1 3.48Å; V14-F23 VanDerWaalsContact CG2-CE1 3.48Å; V14-F23 HydrophobicContact CG2-CZ 4.49Å
15	E	88.8	Confident	88	Confident	80 Å²	80	76.9 Å²	76.9	37%	0.374	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	152.5	174.9	-67.8	-172.3	156.6	0	0	111	I13 R22 A24	I13-E15 HydrophobicContact CD1-CG 3.83Å; I13-E15 HydrophobicContact CG1-CG 4.22Å; E15-R22 HydrophobicContact CB-CG 4.26Å; E15-R22 PolarHBondContact N-O 2.83Å; E15-R22 WeakPolarHBondContact O-CG 3.24Å; E15-R22 PolarHBondContact O-N 3.14Å; E15-A24 HydrophobicContact CB-CB 4.44Å; E15-A24 HydrophobicContact CG-CB 4.04Å; E15-A24 VanDerWaalsContact OE2-CB 3.25Å; E15-A24 WeakPolarHBondContact OE2-CB 3.42Å
16	E	87.9	Confident	87.9	Confident	168 Å²	168	82.6 Å²	82.6	79%	0.785	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.5	122.6	171.9	-65.6	-176.4	172.4	0	0	110	L21 R22	E16-L21 HydrophobicContact CG-CD2 3.87Å; E16-R22 PolarHBondContact O-NH2 3.31Å
17	G	82.6	Confident	87.9	Confident	23 Å²	23	82.4 Å²	82.4	24%	0.237	44%	0.438	C	S	.	.			trans	-96.4	171.1	168	0	0	0	0	0	111.5	R19 C20	G17-R19 PolarHBondContact O-N 2.82Å; G17-C20 VanDerWaalsContact CA-O 3.3Å; G17-C20 WeakPolarHBondContact CA-O 3.49Å; G17-C20 PolarHBondContact N-O 3.49Å
18	Q	81.1	Confident	87.9	Confident	205 Å²	205	78.8 Å²	78.8	96%	0.958	42%	0.417	S	S	*	.	S	Bend	trans	-59	-22	179.8	-71.8	178	-19.7	0	0	114.6
19	R	80.1	Confident	87.9	Confident	239 Å²	239	82.4 Å²	82.4	90%	0.902	44%	0.44	S	S	*	.	S	Bend	trans	-130.4	-26.3	-176.6	-68.3	-174.8	178	-178.4	-1	114.4	G17	G17-R19 PolarHBondContact O-N 2.82Å
20	C	83.5	Confident	88.2	Confident	66 Å²	66	83.5 Å²	83.5	45%	0.446	43%	0.429	S	S	.	.	S	Bend	trans	-150.1	158.2	-176.1	-59.2	0	0	0	0	110.5	G17	G17-C20 VanDerWaalsContact CA-O 3.3Å; G17-C20 WeakPolarHBondContact CA-O 3.49Å; G17-C20 PolarHBondContact N-O 3.49Å
21	L	89.1	Confident	88.2	Confident	87 Å²	87	83.7 Å²	83.7	46%	0.455	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.7	139	163.2	-73.4	154.3	0	0	0	109.4	V14 E16 I34	V14-L21 HydrophobicContact CG1-CD2 3.81Å; E16-L21 HydrophobicContact CG-CD2 3.87Å; L21-I34 HydrophobicContact CB-CB 4.47Å; L21-I34 HydrophobicContact CB-CD1 3.96Å; L21-I34 HydrophobicContact CB-CG1 4.45Å; L21-I34 WeakPolarHBondContact O-CB 3.41Å; L21-I34 WeakPolarHBondContact O-CG1 3.36Å; L21-I34 PolarHBondContact O-N 3.03Å
22	R	90	Very high	88	Confident	84 Å²	84	84.9 Å²	84.9	32%	0.317	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	145.2	-178.8	55.8	-177.8	165.4	-174.3	-3	110.6	E15 E16 H32 N33	E15-R22 HydrophobicContact CB-CG 4.26Å; E15-R22 PolarHBondContact N-O 2.83Å; E15-R22 WeakPolarHBondContact O-CG 3.24Å; E15-R22 PolarHBondContact O-N 3.14Å; E16-R22 PolarHBondContact O-NH2 3.31Å; R22-H32 CarbonylContact C-O 3.53Å; R22-H32 WeakPolarHBondContact CA-O 2.99Å; R22-N33 WeakPolarHBondContact CB-OD1 3.28Å
23	F	90.3	Very high	87.9	Confident	30 Å²	30	88.2 Å²	88.2	13%	0.132	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	115.5	166.2	-67.1	-68.6	0	0	0	108.5	L3 L12 I13 V14 V31 H32 I34	L3-F23 HydrophobicContact CD1-CD1 4.05Å; L3-F23 HydrophobicContact CD1-CD2 4.13Å; L3-F23 HydrophobicContact CD1-CE1 3.61Å; L3-F23 HydrophobicContact CD1-CE2 3.68Å; L3-F23 HydrophobicContact CD1-CG 4.3Å; L3-F23 HydrophobicContact CD1-CZ 3.42Å; L3-F23 VanDerWaalsContact CD1-CZ 3.42Å; L12-F23 HydrophobicContact CB-CB 4.11Å; L12-F23 HydrophobicContact CD1-CB 4.15Å; I13-F23 CarbonylContact O-C 3.51Å; I13-F23 VanDerWaalsContact O-CA 3.24Å; I13-F23 WeakPolarHBondContact O-CA 3.33Å; V14-F23 HydrophobicContact CG2-CD1 3.79Å; V14-F23 HydrophobicContact CG2-CE1 3.48Å; V14-F23 VanDerWaalsContact CG2-CE1 3.48Å; V14-F23 HydrophobicContact CG2-CZ 4.49Å; F23-V31 CarbonylContact O-C 3.5Å; F23-V31 WeakPolarHBondContact O-CA 3.25Å; F23-H32 HydrophobicContact CB-CB 4.3Å; F23-H32 PolarHBondContact N-O 3.37Å; F23-H32 PolarHBondContact O-N 3.06Å; F23-I34 HydrophobicContact CD2-CD1 3.93Å; F23-I34 HydrophobicContact CD2-CG1 3.68Å; F23-I34 HydrophobicContact CE1-CD1 4.14Å; F23-I34 HydrophobicContact CE2-CD1 3.46Å; F23-I34 VanDerWaalsContact CE2-CD1 3.46Å; F23-I34 HydrophobicContact CE2-CG1 3.46Å; F23-I34 VanDerWaalsContact CE2-CG1 3.46Å; F23-I34 HydrophobicContact CG-CD1 4.45Å; F23-I34 HydrophobicContact CZ-CD1 3.57Å; F23-I34 HydrophobicContact CZ-CG1 4.12Å
24	A	90.6	Very high	87.8	Confident	4 Å²	4	87.3 Å²	87.3	3%	0.033	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	148.7	179.5	0	0	0	0	0	110.5	I13 E15 V31	I13-A24 VanDerWaalsContact CG1-O 3.3Å; I13-A24 WeakPolarHBondContact CG1-O 3.3Å; I13-A24 PolarHBondContact N-O 2.87Å; I13-A24 PolarHBondContact O-N 3.18Å; E15-A24 HydrophobicContact CB-CB 4.44Å; E15-A24 HydrophobicContact CG-CB 4.04Å; E15-A24 VanDerWaalsContact OE2-CB 3.25Å; E15-A24 WeakPolarHBondContact OE2-CB 3.42Å; A24-V31 HydrophobicContact CB-CG1 4.35Å
25	C	91.2	Very high	87.5	Confident	13 Å²	13	89.3 Å²	89.3	9%	0.088	46%	0.459	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	136.6	171.6	-169.5	0	0	0	0	110.5	C5 C8 L12 T27 C28 Y30	C5-C25 HydrophobicContact CB-CB 4.33Å; C8-C25 PolarHBondContact SG-SG 2.92Å; L12-C25 HydrophobicContact CD2-CB 3.78Å; C25-T27 VanDerWaalsContact C-N 3.27Å; C25-T27 PolarHBondContact O-N 2.84Å; C25-T27 PolarHBondContact SG-OG1 2.86Å; C25-C28 VanDerWaalsContact CB-SG 3.51Å; C25-C28 VanDerWaalsContact SG-SG 3.6Å; C25-Y30 PolarHBondContact N-O 2.77Å; C25-Y30 VanDerWaalsContact N-O 3.14Å
26	N	87.6	Confident	87.3	Confident	123 Å²	123	94.8 Å²	94.8	66%	0.658	48%	0.477	S	S	*	.	S	Bend	trans	-72.8	-19.6	178.9	-72.4	10.4	0	0	0	114.1	I13	I13-N26 WeakPolarHBondContact CD1-OD1 3.34Å; I13-N26 WeakPolarHBondContact CG1-OD1 3.43Å
27	T	88.1	Confident	87.2	Confident	92 Å²	92	96.4 Å²	96.4	56%	0.564	48%	0.481	S	S	*	.	S	Bend	trans	-109.6	-14.9	-171.7	45.8	0	0	0	0	113.3	C8 N10 C25	C8-T27 PolarHBondContact SG-OG1 3.04Å; N10-T27 WeakPolarHBondContact ND2-CG2 3.46Å; N10-T27 PolarHBondContact ND2-OG1 2.82Å; C25-T27 VanDerWaalsContact C-N 3.27Å; C25-T27 PolarHBondContact O-N 2.84Å; C25-T27 PolarHBondContact SG-OG1 2.86Å
28	C	88.9	Confident	87.3	Confident	28 Å²	28	99 Å²	99	19%	0.189	49%	0.492	C	S	.	.	S	Bend	trans	-142.6	160.7	179.9	72	0	0	0	0	111.3	C5 T7 C25 Y30	C5-C28 PolarHBondContact SG-SG 2.89Å; T7-C28 PolarHBondContact OG1-SG 2.84Å; C25-C28 VanDerWaalsContact CB-SG 3.51Å; C25-C28 VanDerWaalsContact SG-SG 3.6Å; C28-Y30 PolarHBondContact O-N 3.38Å; C28-Y30 VanDerWaalsContact SG-CB 3.53Å
29	P	89	Confident	87.5	Confident	129 Å²	129	94.5 Å²	94.5	84%	0.838	48%	0.475	S	S	*	.	S	Bend	trans	-71.1	11.4	-178.4	-15.8	30.9	0	0	0	114.8	V31	P29-V31 PolarHBondContact O-N 3.21Å
30	Y	89.6	Confident	87.7	Confident	71 Å²	71	88.4 Å²	88.4	28%	0.278	46%	0.46	S	S	.	.			trans	-68.9	123.4	-178.8	179.6	-94.2	0	0	0	110.3	C5 P6 L12 C25 C28 H32	C5-Y30 VanDerWaalsContact SG-CB 3.55Å; P6-Y30 HydrophobicContact CG-CD2 4.08Å; P6-Y30 HydrophobicContact CG-CE1 4.46Å; P6-Y30 HydrophobicContact CG-CE2 3.6Å; L12-Y30 HydrophobicContact CD1-CD1 4.43Å; L12-Y30 HydrophobicContact CD1-CE1 3.89Å; L12-Y30 HydrophobicContact CD2-CD1 3.71Å; L12-Y30 HydrophobicContact CD2-CE1 4.02Å; C25-Y30 PolarHBondContact N-O 2.77Å; C25-Y30 VanDerWaalsContact N-O 3.14Å; C28-Y30 PolarHBondContact O-N 3.38Å; C28-Y30 VanDerWaalsContact SG-CB 3.53Å; Y30-H32 HydrophobicContact CE1-CB 4.06Å
31	V	89.2	Confident	87.8	Confident	78 Å²	78	93.6 Å²	93.6	47%	0.473	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	139	176.6	-63.3	0	0	0	0	110	F23 A24 P29	F23-V31 CarbonylContact O-C 3.5Å; F23-V31 WeakPolarHBondContact O-CA 3.25Å; A24-V31 HydrophobicContact CB-CG1 4.35Å; P29-V31 PolarHBondContact O-N 3.21Å
32	H	87.3	Confident	87.6	Confident	95 Å²	95	98.5 Å²	98.5	44%	0.44	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.2	115.2	177.7	-171.9	79.5	0	0	0	111	R22 F23 Y30	R22-H32 CarbonylContact C-O 3.53Å; R22-H32 WeakPolarHBondContact CA-O 2.99Å; F23-H32 HydrophobicContact CB-CB 4.3Å; F23-H32 PolarHBondContact N-O 3.37Å; F23-H32 PolarHBondContact O-N 3.06Å; Y30-H32 HydrophobicContact CE1-CB 4.06Å
33	N	89.3	Confident	87.1	Confident	89 Å²	89	103 Å²	103	48%	0.476	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	133.6	-176.2	-63.6	-28.3	0	0	0	111.6	R22 T35	R22-N33 WeakPolarHBondContact CB-OD1 3.28Å; N33-T35 PolarHBondContact O-N 2.87Å
34	I	88.8	Confident	86.7	Confident	43 Å²	43	106.3 Å²	106.3	22%	0.221	53%	0.531	C	S	.	.			trans	-82.1	96.7	178.5	-53.3	-179.6	0	0	0	108.8	L21 F23 R36	L21-I34 HydrophobicContact CB-CB 4.47Å; L21-I34 HydrophobicContact CB-CD1 3.96Å; L21-I34 HydrophobicContact CB-CG1 4.45Å; L21-I34 WeakPolarHBondContact O-CB 3.41Å; L21-I34 WeakPolarHBondContact O-CG1 3.36Å; L21-I34 PolarHBondContact O-N 3.03Å; F23-I34 HydrophobicContact CD2-CD1 3.93Å; F23-I34 HydrophobicContact CD2-CG1 3.68Å; F23-I34 HydrophobicContact CE1-CD1 4.14Å; F23-I34 HydrophobicContact CE2-CD1 3.46Å; F23-I34 VanDerWaalsContact CE2-CD1 3.46Å; F23-I34 HydrophobicContact CE2-CG1 3.46Å; F23-I34 VanDerWaalsContact CE2-CG1 3.46Å; F23-I34 HydrophobicContact CG-CD1 4.45Å; F23-I34 HydrophobicContact CZ-CD1 3.57Å; F23-I34 HydrophobicContact CZ-CG1 4.12Å; I34-R36 VanDerWaalsContact CG2-O 3.28Å; I34-R36 WeakPolarHBondContact CG2-O 3.3Å
35	T	85.5	Confident	86.1	Confident	128 Å²	128	116.1 Å²	116.1	79%	0.785	57%	0.572	S	S	*	*			trans	-89	-21.5	179.3	55	0	0	0	0	113.7	N33	N33-T35 PolarHBondContact O-N 2.87Å
36	R	84.6	Confident	85.2	Confident	196 Å²	196	123 Å²	123	74%	0.74	61%	0.608	S	S	*	*	S	Bend	trans	-127	152.2	-176.4	61.5	-177	176.8	-144	-0.5	111.1	I34 V38	I34-R36 VanDerWaalsContact CG2-O 3.28Å; I34-R36 WeakPolarHBondContact CG2-O 3.3Å; R36-V38 PolarHBondContact O-N 2.95Å
37	K	84.9	Confident	84.2	Confident	201 Å²	201	125.6 Å²	125.6	87%	0.874	61%	0.613	S	S	*	*			trans	-65.2	117.2	177.2	-171.3	173.8	-176.2	172.8	0	110.1
38	V	84.1	Confident	82.9	Confident	78 Å²	78	129.4 Å²	129.4	47%	0.473	63%	0.625	S	S	.	*			trans	-105	127.1	173.2	-175.9	0	0	0	0	108.2	M1 R36	M1-V38 HydrophobicContact CE-CG1 4.19Å; R36-V38 PolarHBondContact O-N 2.95Å
39	N	86.2	Confident	81.5	Confident	111 Å²	111	134 Å²	134	59%	0.594	65%	0.651	S	S	*	*			trans	-123.3	150.4	174.4	64.9	5.9	0	0	0	110.4
40	N	84.4	Confident	79.6	Confident	110 Å²	110	133.8 Å²	133.8	59%	0.588	64%	0.643	S	S	*	*			trans	-137.2	113.6	170.7	178.4	30.1	0	0	0	107.7	M1	M1-N40 PolarHBondContact N-ND2 3.28Å
41	R	84.7	Confident	78	Confident	175 Å²	175	134.5 Å²	134.5	66%	0.66	65%	0.652	S	S	*	*			trans	-105.4	119.5	179.4	-68.8	-180	176.7	174.2	-2.6	108.6	Y43	R41-Y43 HydrophobicContact CB-CE2 4.13Å
42	K	84.5	Confident	76.3	Confident	191 Å²	191	136.7 Å²	136.7	83%	0.83	67%	0.665	S	S	*	*			trans	-94.3	125.4	163.6	-168.2	169.2	-175.4	179.1	0	106.9	P44	K42-P44 WeakPolarHBondContact O-CD 3.1Å
43	Y	80.4	Confident	74.8	Confident	179 Å²	179	133.2 Å²	133.2	70%	0.702	65%	0.65	S	S	*	*			trans	-90	100.4	173.1	-65.5	-85.7	0	0	0	107.5	R41	R41-Y43 HydrophobicContact CB-CE2 4.13Å
44	P	82.6	Confident	73.1	Confident	99 Å²	99	131 Å²	131	64%	0.643	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-63.4	141.1	171.8	28.6	-33.5	0	0	0	108.4	K42 L46	K42-P44 WeakPolarHBondContact O-CD 3.1Å; P44-L46 PolarHBondContact O-N 3.35Å
45	K	76.6	Confident	71.8	Confident	209 Å²	209	130.9 Å²	130.9	91%	0.909	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-66.1	123	163.1	-67.8	-172.9	178.5	-174.6	0	106.6
46	L	72.4	Confident	70.5	Confident	158 Å²	158	128.9 Å²	128.9	83%	0.827	65%	0.653	S	S	*	*	P	Polyproline II helix	trans	-63.2	137.8	170.9	-76.8	82.4	0	0	0	107.4	P44 E48	P44-L46 PolarHBondContact O-N 3.35Å; L46-E48 PolarHBondContact O-N 3.29Å
47	K	66.8	Low	69.3	Low	178 Å²	178	122.8 Å²	122.8	77%	0.774	65%	0.645	S	S	*	*	P	Polyproline II helix	trans	-59.6	132.4	168.8	-166.7	179.7	176.6	-172.8	0	106.8	V49	K47-V49 PolarHBondContact O-N 2.84Å; K47-V49 VanDerWaalsContact O-N 3.17Å
48	E	61.2	Low	68.2	Low	172 Å²	172	115 Å²	115	80%	0.804	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-56.1	124.6	170.3	-54.2	-173.7	154.9	0	0	106.1	L46 D50	L46-E48 PolarHBondContact O-N 3.29Å; E48-D50 PolarHBondContact O-N 3.17Å
49	V	58.9	Low	67.3	Low	123 Å²	123	111.6 Å²	111.6	75%	0.745	60%	0.597	S	S	*	*			trans	-65.6	98.6	172.9	178.8	0	0	0	0	103.9	K47 D51	K47-V49 PolarHBondContact O-N 2.84Å; K47-V49 VanDerWaalsContact O-N 3.17Å; V49-D51 PolarHBondContact O-N 3.08Å
50	D	49.5	Very low	66.2	Low	125 Å²	125	113.7 Å²	113.7	67%	0.668	60%	0.604	S	S	*	*			trans	-50.1	118.8	163.5	-89.7	-51.9	0	0	0	104.9	E48 V52	E48-D50 PolarHBondContact O-N 3.17Å; D50-V52 PolarHBondContact O-N 3.02Å; D50-V52 VanDerWaalsContact O-N 3.08Å
51	D	55.4	Low	65.1	Low	86 Å²	86	115.7 Å²	115.7	46%	0.46	61%	0.614	S	S	.	*			trans	-40.8	126	174.4	-77.4	-38.4	0	0	0	106.8	V49 L53 G54 R105	V49-D51 PolarHBondContact O-N 3.08Å; D51-L53 HydrophobicContact CB-CB 4.43Å; D51-L53 PolarHBondContact O-N 3.02Å; D51-G54 PolarHBondContact O-N 2.88Å; D51-R105 IonicContact OD2-CZ 3.83Å; D51-R105 IonicContact OD2-NH1 2.71Å; D51-R105 PolarHBondContact OD2-NH1 3.43Å
52	V	54.4	Low	64.6	Low	124 Å²	124	108.6 Å²	108.6	75%	0.752	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.9	-4.5	177.1	178.2	0	0	0	0	112.3	D50	D50-V52 PolarHBondContact O-N 3.02Å; D50-V52 VanDerWaalsContact O-N 3.08Å
53	L	54.8	Low	64.2	Low	23 Å²	23	105.3 Å²	105.3	12%	0.12	58%	0.582	C	S	.	*	T	Hydrogen-bonded Turn	trans	-106.8	18.3	-177.8	-57.3	167.5	0	0	0	113.7	D51 A58 W59 M80 I82 F94	D51-L53 HydrophobicContact CB-CB 4.43Å; D51-L53 PolarHBondContact O-N 3.02Å; L53-A58 VanDerWaalsContact O-CB 3.24Å; L53-A58 WeakPolarHBondContact O-CB 2.96Å; L53-W59 HydrophobicContact CB-CZ2 4.32Å; L53-W59 HydrophobicContact CD1-CZ2 4.25Å; L53-W59 HydrophobicContact CD2-CZ2 4.4Å; L53-M80 HydrophobicContact CB-CE 4.3Å; L53-M80 HydrophobicContact CD2-CE 3.27Å; L53-M80 HydrophobicContact CG-CE 4.41Å; L53-I82 HydrophobicContact CD2-CD1 3.1Å; L53-I82 HydrophobicContact CG-CD1 4.41Å; L53-F94 HydrophobicContact CD1-CD1 4.21Å; L53-F94 HydrophobicContact CD1-CG 4.46Å; L53-F94 HydrophobicContact CD2-CB 4.46Å; L53-F94 HydrophobicContact CD2-CD2 4.34Å; L53-F94 HydrophobicContact CD2-CG 4.27Å
54	G	55	Low	64.2	Low	43 Å²	43	99.7 Å²	99.7	44%	0.443	57%	0.569	S	S	.	*			trans	56.9	59.8	161.4	0	0	0	0	0	116.6	D51 A58	D51-G54 PolarHBondContact O-N 2.88Å; G54-A58 WeakPolarHBondContact O-CB 3.24Å; G54-A58 PolarHBondContact O-N 2.97Å
55	G	61.1	Low	64.3	Low	40 Å²	40	97.7 Å²	97.7	41%	0.412	55%	0.554	S	S	.	*	T	Hydrogen-bonded Turn	trans	53.8	-155.4	166.8	0	0	0	0	0	115.8
56	A	57.8	Low	64.5	Low	85 Å²	85	92.2 Å²	92.2	70%	0.702	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77	-30.7	178.5	0	0	0	0	0	112.9	W59	A56-W59 PolarHBondContact O-N 3.13Å
57	A	59.1	Low	64.9	Low	68 Å²	68	86 Å²	86	56%	0.562	52%	0.515	S	S	*	.	G	3₁₀ helix	trans	-75.4	-27.3	-174.2	0	0	0	0	0	114	W59 E60	A57-W59 PolarHBondContact O-N 3.01Å; A57-W59 VanDerWaalsContact O-N 3.17Å; A57-E60 WeakPolarHBondContact O-CB 3.37Å; A57-E60 PolarHBondContact O-N 2.71Å
58	A	62.5	Low	65.8	Low	39 Å²	39	81.8 Å²	81.8	32%	0.322	50%	0.504	S	S	.	.	G	3₁₀ helix	trans	-67.4	-15.2	177.1	0	0	0	0	0	113.4	L53 G54 V62	L53-A58 VanDerWaalsContact O-CB 3.24Å; L53-A58 WeakPolarHBondContact O-CB 2.96Å; G54-A58 WeakPolarHBondContact O-CB 3.24Å; G54-A58 PolarHBondContact O-N 2.97Å; A58-V62 WeakPolarHBondContact O-CG2 3.19Å
59	W	64.2	Low	66.9	Low	5 Å²	5	73.6 Å²	73.6	2%	0.019	47%	0.466	C	S	.	.	G	3₁₀ helix	trans	-96.2	-1.3	179.4	-65	88	0	0	0	113.7	L53 A56 A57 V62 M80 F94 K96	L53-W59 HydrophobicContact CB-CZ2 4.32Å; L53-W59 HydrophobicContact CD1-CZ2 4.25Å; L53-W59 HydrophobicContact CD2-CZ2 4.4Å; A56-W59 PolarHBondContact O-N 3.13Å; A57-W59 PolarHBondContact O-N 3.01Å; A57-W59 VanDerWaalsContact O-N 3.17Å; W59-V62 HydrophobicContact CE3-CB 4.5Å; W59-V62 HydrophobicContact CE3-CG2 4.3Å; W59-M80 HydrophobicContact CH2-CB 4.38Å; W59-M80 HydrophobicContact CZ3-CB 4.37Å; W59-F94 HydrophobicContact CH2-CB 4.41Å; W59-K96 HydrophobicContact CB-CD 4.04Å; W59-K96 VanDerWaalsContact CB-NZ 3.34Å; W59-K96 HydrophobicContact CD2-CB 4.01Å; W59-K96 HydrophobicContact CD2-CD 3.3Å; W59-K96 HydrophobicContact CD2-CG 4.3Å; W59-K96 HydrophobicContact CE3-CB 3.63Å; W59-K96 HydrophobicContact CE3-CD 3.72Å; W59-K96 HydrophobicContact CE3-CG 4.33Å; W59-K96 HydrophobicContact CG-CD 3.43Å; W59-K96 VanDerWaalsContact CG-CD 3.43Å; W59-K96 HydrophobicContact CH2-CB 3.67Å; W59-K96 HydrophobicContact CZ2-CB 4.05Å; W59-K96 HydrophobicContact CZ2-CD 4.29Å; W59-K96 HydrophobicContact CZ3-CB 3.45Å; W59-K96 VanDerWaalsContact CZ3-CB 3.45Å; W59-K96 HydrophobicContact CZ3-CD 4.35Å
60	E	63.4	Low	68.1	Low	156 Å²	156	72.1 Å²	72.1	73%	0.729	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.7	-25.3	-174.2	-159.9	174.4	-172.1	0	0	112.7	A57	A57-E60 WeakPolarHBondContact O-CB 3.37Å; A57-E60 PolarHBondContact O-N 2.71Å
61	N	62.2	Low	69.8	Low	151 Å²	151	73.2 Å²	73.2	81%	0.807	46%	0.458	S	S	*	.	T	Hydrogen-bonded Turn	trans	-116.9	21	-178.4	-66.5	-74.2	0	0	0	113.3
62	V	72.9	Confident	71.1	Confident	26 Å²	26	71.3 Å²	71.3	16%	0.158	45%	0.451	C	S	.	.			trans	-95.9	138.2	-175.7	-164.8	0	0	0	0	109.3	A58 W59 Y78 F79 M80	A58-V62 WeakPolarHBondContact O-CG2 3.19Å; W59-V62 HydrophobicContact CE3-CB 4.5Å; W59-V62 HydrophobicContact CE3-CG2 4.3Å; V62-Y78 WeakPolarHBondContact O-CD1 3.05Å; V62-F79 WeakPolarHBondContact CG1-O 3.29Å; V62-M80 HydrophobicContact CG1-CB 4.09Å
63	D	77.1	Confident	72.5	Confident	122 Å²	122	73.1 Å²	73.1	65%	0.652	45%	0.451	S	S	*	.			trans	-61.8	147.3	177.7	-74.2	-43.3	0	0	0	111.7	Y78 F79	D63-Y78 WeakPolarHBondContact O-CA 3.12Å; D63-F79 HydrophobicContact CB-CD1 4.32Å; D63-F79 HydrophobicContact CB-CE1 3.51Å; D63-F79 HydrophobicContact CB-CZ 4.03Å; D63-F79 VanDerWaalsContact O-CD1 3.26Å; D63-F79 WeakPolarHBondContact O-CD1 3.48Å; D63-F79 PolarHBondContact O-N 3.35Å; D63-F79 VanDerWaalsContact O-N 3.1Å
64	S	80.8	Confident	73.9	Confident	62 Å²	62	75.3 Å²	75.3	43%	0.434	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	131.8	178.4	66.4	0	0	0	0	111.3	A77	S64-A77 CarbonylContact C-O 3.6Å; S64-A77 VanDerWaalsContact CA-O 3.3Å; S64-A77 WeakPolarHBondContact CA-O 2.78Å
65	T	83.3	Confident	75.3	Confident	56 Å²	56	77 Å²	77	34%	0.344	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	153.7	176.3	-65.8	0	0	0	0	110.9	E67 R76 A77 F79	T65-E67 PolarHBondContact O-N 2.67Å; T65-R76 WeakPolarHBondContact O-CA 3.11Å; T65-A77 PolarHBondContact N-O 3.32Å; T65-A77 PolarHBondContact O-N 3.38Å; T65-A77 VanDerWaalsContact O-N 3.1Å; T65-F79 WeakPolarHBondContact OG1-CD1 3.47Å; T65-F79 WeakPolarHBondContact OG1-CE1 3.42Å
66	A	82.5	Confident	76.4	Confident	94 Å²	94	82.4 Å²	82.4	78%	0.777	47%	0.472	S	S	*	.			trans	-78.9	54.1	177.4	0	0	0	0	0	112.2	P75	A66-P75 CarbonylContact C-O 3.52Å; A66-P75 WeakPolarHBondContact CA-O 3.37Å
67	E	80.8	Confident	77.7	Confident	29 Å²	29	78.4 Å²	78.4	14%	0.136	44%	0.438	C	S	.	.			trans	-106.1	143.4	176.8	58.8	175.4	-136.8	0	0	111.1	T65 P75 R76 A77 Y95 W106	T65-E67 PolarHBondContact O-N 2.67Å; E67-P75 CarbonylContact O-C 3.53Å; E67-P75 VanDerWaalsContact O-C 3.27Å; E67-R76 PolarHBondContact O-N 2.93Å; E67-A77 HydrophobicContact CG-CB 3.5Å; E67-A77 VanDerWaalsContact CG-CB 3.5Å; E67-A77 WeakPolarHBondContact OE1-CB 3.49Å; E67-Y95 VanDerWaalsContact CD-CE1 3.41Å; E67-Y95 WeakPolarHBondContact OE1-CB 2.94Å; E67-Y95 WeakPolarHBondContact OE1-CD1 3.31Å; E67-Y95 WeakPolarHBondContact OE1-CE1 3.35Å; E67-Y95 WeakPolarHBondContact OE2-CD1 2.9Å; E67-Y95 WeakPolarHBondContact OE2-CE1 3.3Å; E67-W106 VanDerWaalsContact OE1-CZ2 3.24Å; E67-W106 WeakPolarHBondContact OE1-CZ2 2.9Å
68	T	84.9	Confident	79	Confident	89 Å²	89	78.8 Å²	78.8	55%	0.546	43%	0.426	S	S	.	.			trans	-88.8	123	-173.1	-54.7	0	0	0	0	110	E73 H74	T68-E73 HydrophobicContact CG2-CB 4.35Å; T68-H74 WeakPolarHBondContact CA-O 3.43Å
69	C	84.7	Confident	80.1	Confident	0 Å²	0	79.5 Å²	79.5	0%	0	42%	0.422	C	S	.	.			trans	-65	126.9	177.8	179.7	0	0	0	0	110.5	K71 C72 E73 H74 C97 W106	C69-K71 PolarHBondContact O-N 3.49Å; C69-C72 VanDerWaalsContact SG-SG 3.63Å; C69-E73 VanDerWaalsContact O-CA 3.31Å; C69-E73 WeakPolarHBondContact O-CA 3.24Å; C69-E73 PolarHBondContact O-N 2.94Å; C69-H74 PolarHBondContact N-O 3.36Å; C69-C97 HydrophobicContact CB-CB 4.18Å; C69-W106 HydrophobicContact CB-CH2 3.77Å; C69-W106 HydrophobicContact CB-CZ3 4.11Å; C69-W106 VanDerWaalsContact SG-CZ3 3.55Å
70	P	84.8	Confident	81	Confident	92 Å²	92	81.3 Å²	81.3	60%	0.597	43%	0.431	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.7	-12.7	-176.4	26.5	-35.6	0	0	0	114	W106	P70-W106 HydrophobicContact CG-CD2 4.19Å; P70-W106 HydrophobicContact CG-CE3 4.4Å; P70-W106 HydrophobicContact CG-CG 4.44Å
71	K	83.6	Confident	81.9	Confident	148 Å²	148	79 Å²	79	64%	0.643	42%	0.42	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.6	-34.9	-175.5	-168.2	177.1	-178.2	-174.4	0	114.2	C69 H104	C69-K71 PolarHBondContact O-N 3.49Å; K71-H104 HydrophobicContact CB-CB 4.42Å; K71-H104 HydrophobicContact CD-CB 4.21Å
72	C	83.8	Confident	82.8	Confident	46 Å²	46	73.5 Å²	73.5	31%	0.311	39%	0.39	S	S	.	.	T	Hydrogen-bonded Turn	trans	-128.2	5.1	-173.5	67.5	0	0	0	0	113.4	C69 H74 C97 C102	C69-C72 VanDerWaalsContact SG-SG 3.63Å; C72-H74 PolarHBondContact O-N 3.05Å; C72-C97 PolarHBondContact SG-SG 3.03Å; C72-C102 HydrophobicContact CB-CB 4.19Å
73	E	83.4	Confident	82.9	Confident	162 Å²	162	76.9 Å²	76.9	76%	0.757	40%	0.404	S	S	*	.			trans	55.4	19.4	176.8	-60.7	176.8	163.7	0	0	114.2	T68 C69	T68-E73 HydrophobicContact CG2-CB 4.35Å; C69-E73 VanDerWaalsContact O-CA 3.31Å; C69-E73 WeakPolarHBondContact O-CA 3.24Å; C69-E73 PolarHBondContact O-N 2.94Å
74	H	83.5	Confident	82.7	Confident	68 Å²	68	74.3 Å²	74.3	32%	0.315	39%	0.393	S	S	.	.			trans	-69.7	133	177.1	-165.7	69.1	0	0	0	109.7	T68 C69 C72 R76	T68-H74 WeakPolarHBondContact CA-O 3.43Å; C69-H74 PolarHBondContact N-O 3.36Å; C72-H74 PolarHBondContact O-N 3.05Å; H74-R76 PolarHBondContact CD2-O 3.27Å; H74-R76 PolarHBondContact O-N 2.98Å; H74-R76 VanDerWaalsContact O-N 3.17Å
75	P	84.9	Confident	82.6	Confident	79 Å²	79	79.4 Å²	79.4	51%	0.513	40%	0.403	S	S	.	.	S	Bend	trans	-79.4	5.5	-170.9	32.5	-38.3	0	0	0	114.4	A66 E67	A66-P75 CarbonylContact C-O 3.52Å; A66-P75 WeakPolarHBondContact CA-O 3.37Å; E67-P75 CarbonylContact O-C 3.53Å; E67-P75 VanDerWaalsContact O-C 3.27Å
76	R	84	Confident	82.3	Confident	154 Å²	154	81 Å²	81	58%	0.581	42%	0.417	S	S	*	.			trans	-132.2	137.9	-179.5	-69.6	-171.5	176.3	-177.1	-1.5	111.6	T65 E67 H74 C98	T65-R76 WeakPolarHBondContact O-CA 3.11Å; E67-R76 PolarHBondContact O-N 2.93Å; H74-R76 PolarHBondContact CD2-O 3.27Å; H74-R76 PolarHBondContact O-N 2.98Å; H74-R76 VanDerWaalsContact O-N 3.17Å; R76-C98 HydrophobicContact CB-CB 4.27Å; R76-C98 PolarHBondContact O-N 2.8Å
77	A	86.1	Confident	81.8	Confident	0 Å²	0	80.4 Å²	80.4	0%	0	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.6	151.6	169.6	0	0	0	0	0	110.6	S64 T65 E67 K96 C98 W106	S64-A77 CarbonylContact C-O 3.6Å; S64-A77 VanDerWaalsContact CA-O 3.3Å; S64-A77 WeakPolarHBondContact CA-O 2.78Å; T65-A77 PolarHBondContact N-O 3.32Å; T65-A77 PolarHBondContact O-N 3.38Å; T65-A77 VanDerWaalsContact O-N 3.1Å; E67-A77 HydrophobicContact CG-CB 3.5Å; E67-A77 VanDerWaalsContact CG-CB 3.5Å; E67-A77 WeakPolarHBondContact OE1-CB 3.49Å; A77-K96 CarbonylContact C-O 3.52Å; A77-K96 WeakPolarHBondContact CA-O 3.48Å; A77-K96 WeakPolarHBondContact CB-O 3.35Å; A77-C98 VanDerWaalsContact C-SG 3.51Å; A77-C98 WeakPolarHBondContact CA-SG 3.46Å; A77-W106 HydrophobicContact CB-CH2 3.67Å; A77-W106 HydrophobicContact CB-CZ2 3.99Å
78	Y	85.6	Confident	81.8	Confident	77 Å²	77	86.6 Å²	86.6	30%	0.302	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.6	137.3	168.9	-60.5	-69	0	0	0	109.2	V62 D63 Y95 K96 C98	V62-Y78 WeakPolarHBondContact O-CD1 3.05Å; D63-Y78 WeakPolarHBondContact O-CA 3.12Å; Y78-Y95 CarbonylContact O-C 3.42Å; Y78-Y95 WeakPolarHBondContact O-CA 3.3Å; Y78-K96 PolarHBondContact N-O 2.83Å; Y78-K96 PolarHBondContact O-N 2.82Å; Y78-C98 HydrophobicContact CD2-CB 4.33Å; Y78-C98 VanDerWaalsContact CD2-SG 3.54Å; Y78-C98 HydrophobicContact CE2-CB 3.89Å; Y78-C98 WeakPolarHBondContact CE2-SG 3.34Å
79	F	85.4	Confident	81.2	Confident	54 Å²	54	86.5 Å²	86.5	24%	0.237	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	137.8	178.3	77.8	-76.8	0	0	0	111.4	V62 D63 T65 T93 F94 Y95	V62-F79 WeakPolarHBondContact CG1-O 3.29Å; D63-F79 HydrophobicContact CB-CD1 4.32Å; D63-F79 HydrophobicContact CB-CE1 3.51Å; D63-F79 HydrophobicContact CB-CZ 4.03Å; D63-F79 VanDerWaalsContact O-CD1 3.26Å; D63-F79 WeakPolarHBondContact O-CD1 3.48Å; D63-F79 PolarHBondContact O-N 3.35Å; D63-F79 VanDerWaalsContact O-N 3.1Å; T65-F79 WeakPolarHBondContact OG1-CD1 3.47Å; T65-F79 WeakPolarHBondContact OG1-CE1 3.42Å; F79-T93 HydrophobicContact CB-CG2 4.22Å; F79-T93 HydrophobicContact CD2-CG2 4.24Å; F79-F94 CarbonylContact C-O 3.56Å; F79-F94 VanDerWaalsContact CA-O 3.29Å; F79-F94 WeakPolarHBondContact CA-O 3.34Å; F79-Y95 HydrophobicContact CB-CD1 3.37Å; F79-Y95 HydrophobicContact CB-CE1 3.37Å; F79-Y95 HydrophobicContact CG-CE1 4.38Å
80	M	83	Confident	80.8	Confident	43 Å²	43	92 Å²	92	21%	0.212	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	128.8	176.2	-170.8	160	67.6	0	0	109.9	L53 W59 V62 I82 F94	L53-M80 HydrophobicContact CB-CE 4.3Å; L53-M80 HydrophobicContact CD2-CE 3.27Å; L53-M80 HydrophobicContact CG-CE 4.41Å; W59-M80 HydrophobicContact CH2-CB 4.38Å; W59-M80 HydrophobicContact CZ3-CB 4.37Å; V62-M80 HydrophobicContact CG1-CB 4.09Å; M80-I82 HydrophobicContact CE-CD1 3.5Å; M80-I82 HydrophobicContact CE-CG1 4.25Å; M80-I82 HydrophobicContact CG-CD1 4.25Å; M80-I82 HydrophobicContact CG-CG1 4Å; M80-I82 HydrophobicContact SD-CD1 4.45Å; M80-F94 PolarHBondContact N-O 2.78Å; M80-F94 PolarHBondContact O-N 3.35Å
81	Q	82.2	Confident	80.6	Confident	107 Å²	107	92.4 Å²	92.4	50%	0.5	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	125.5	175.9	-68.8	-175.2	-30.8	0	0	110	M91 T92 T93	Q81-M91 HydrophobicContact CB-CB 4.22Å; Q81-M91 HydrophobicContact CB-SD 4.27Å; Q81-T92 WeakPolarHBondContact CA-O 3.28Å; Q81-T93 HydrophobicContact CG-CG2 3.99Å; Q81-T93 PolarHBondContact NE2-OG1 3.1Å
82	I	80.8	Confident	80.6	Confident	36 Å²	36	86.9 Å²	86.9	19%	0.185	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	134.3	-178.3	-57.8	171.1	0	0	0	108.7	L53 M80 T84 T92 F94	L53-I82 HydrophobicContact CD2-CD1 3.1Å; L53-I82 HydrophobicContact CG-CD1 4.41Å; M80-I82 HydrophobicContact CE-CD1 3.5Å; M80-I82 HydrophobicContact CE-CG1 4.25Å; M80-I82 HydrophobicContact CG-CD1 4.25Å; M80-I82 HydrophobicContact CG-CG1 4Å; M80-I82 HydrophobicContact SD-CD1 4.45Å; I82-T84 HydrophobicContact CG2-CG2 4.42Å; I82-T84 PolarHBondContact O-N 3.39Å; I82-T92 PolarHBondContact N-O 3.17Å; I82-T92 PolarHBondContact O-N 2.91Å; I82-T92 PolarHBondContact O-OG1 3.19Å; I82-F94 HydrophobicContact CB-CD2 4.27Å; I82-F94 HydrophobicContact CB-CE2 4.08Å; I82-F94 HydrophobicContact CD1-CD2 3.99Å; I82-F94 HydrophobicContact CD1-CE2 4.22Å; I82-F94 HydrophobicContact CG1-CD2 4.3Å
83	Q	75.9	Confident	80.7	Confident	96 Å²	96	85.5 Å²	85.5	45%	0.449	44%	0.438	S	S	.	.			trans	-78.8	104.3	165.8	-67.4	-174.2	32.6	0	0	108.6	R85 M91	Q83-R85 VanDerWaalsContact C-N 3.32Å; Q83-M91 HydrophobicContact CG-CE 4.48Å; Q83-M91 HydrophobicContact CG-CG 3.74Å
84	T	73.5	Confident	80.8	Confident	68 Å²	68	79 Å²	79	42%	0.417	41%	0.408	S	S	.	.			trans	-82.6	-11.1	176.8	55.1	0	0	0	0	113.3	I82 T92 F94	I82-T84 HydrophobicContact CG2-CG2 4.42Å; I82-T84 PolarHBondContact O-N 3.39Å; T84-T92 WeakPolarHBondContact CG2-OG1 3.39Å; T84-F94 HydrophobicContact CG2-CE2 4.07Å; T84-F94 HydrophobicContact CG2-CZ 4.06Å
85	R	78.3	Confident	80.9	Confident	170 Å²	170	77.5 Å²	77.5	64%	0.642	40%	0.4	S	S	*	.	S	Bend	trans	-139.6	-174	-176.8	-65.8	-164.6	-171.1	160	-2.8	110.9	Q83 E89	Q83-R85 VanDerWaalsContact C-N 3.32Å; R85-E89 WeakPolarHBondContact CD-OE1 3.45Å; R85-E89 VanDerWaalsContact CD-OE2 3.28Å; R85-E89 WeakPolarHBondContact CD-OE2 3.47Å; R85-E89 IonicContact CZ-OE1 3.99Å; R85-E89 IonicContact NE-OE2 3.57Å; R85-E89 IonicContact NH1-OE1 2.91Å; R85-E89 PolarHBondContact NH1-OE1 3.17Å; R85-E89 IonicContact NH1-OE2 3.9Å
86	S	76.1	Confident	80.9	Confident	90 Å²	90	75.4 Å²	75.4	63%	0.629	38%	0.382	S	S	*	.			trans	-49	152.2	176.1	-57.5	0	0	0	0	112.2	D88 E89	S86-D88 PolarHBondContact O-N 2.88Å; S86-E89 PolarHBondContact O-N 3.24Å; S86-E89 VanDerWaalsContact O-N 3.13Å
87	A	72.5	Confident	80.9	Confident	81 Å²	81	68.2 Å²	68.2	67%	0.669	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.7	-5.6	-175.4	0	0	0	0	0	115.4
88	D	81.4	Confident	80.7	Confident	159 Å²	159	69.7 Å²	69.7	85%	0.85	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.5	-12.5	177.5	-57	-46.5	0	0	0	113.2	S86	S86-D88 PolarHBondContact O-N 2.88Å
89	E	72.6	Confident	80.4	Confident	87 Å²	87	68.5 Å²	68.5	41%	0.407	36%	0.364	S	S	.	.	S	Bend	trans	-98	146.1	174.6	-72.2	-171.4	-169.5	0	0	111.9	R85 S86	R85-E89 WeakPolarHBondContact CD-OE1 3.45Å; R85-E89 VanDerWaalsContact CD-OE2 3.28Å; R85-E89 WeakPolarHBondContact CD-OE2 3.47Å; R85-E89 IonicContact CZ-OE1 3.99Å; R85-E89 IonicContact NE-OE2 3.57Å; R85-E89 IonicContact NH1-OE1 2.91Å; R85-E89 PolarHBondContact NH1-OE1 3.17Å; R85-E89 IonicContact NH1-OE2 3.9Å; S86-E89 PolarHBondContact O-N 3.24Å; S86-E89 VanDerWaalsContact O-N 3.13Å
90	P	75.9	Confident	79.7	Confident	116 Å²	116	70.9 Å²	70.9	75%	0.753	39%	0.394	S	S	*	.	P	Polyproline II helix	trans	-61.8	149.5	175.7	27.1	-34.2	0	0	0	111.4	T92	P90-T92 PolarHBondContact O-N 2.94Å
91	M	80.4	Confident	79.4	Confident	100 Å²	100	77.7 Å²	77.7	49%	0.493	43%	0.426	S	S	.	.	P	Polyproline II helix	trans	-62.9	133.2	178.5	-59	-178.1	-178.8	0	0	110.5	Q81 Q83	Q81-M91 HydrophobicContact CB-CB 4.22Å; Q81-M91 HydrophobicContact CB-SD 4.27Å; Q83-M91 HydrophobicContact CG-CE 4.48Å; Q83-M91 HydrophobicContact CG-CG 3.74Å
92	T	83.2	Confident	79.2	Confident	31 Å²	31	74 Å²	74	19%	0.19	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	135.6	172.9	50.4	0	0	0	0	110.3	Q81 I82 T84 P90 F94	Q81-T92 WeakPolarHBondContact CA-O 3.28Å; I82-T92 PolarHBondContact N-O 3.17Å; I82-T92 PolarHBondContact O-N 2.91Å; I82-T92 PolarHBondContact O-OG1 3.19Å; T84-T92 WeakPolarHBondContact CG2-OG1 3.39Å; P90-T92 PolarHBondContact O-N 2.94Å; T92-F94 WeakPolarHBondContact OG1-CE2 3.45Å
93	T	85	Confident	79	Confident	17 Å²	17	73.9 Å²	73.9	10%	0.104	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.8	126.6	-179.2	-48.6	0	0	0	0	109.9	F79 Q81 Y95 D108	F79-T93 HydrophobicContact CB-CG2 4.22Å; F79-T93 HydrophobicContact CD2-CG2 4.24Å; Q81-T93 HydrophobicContact CG-CG2 3.99Å; Q81-T93 PolarHBondContact NE2-OG1 3.1Å; T93-Y95 HydrophobicContact CG2-CD1 4.07Å; T93-Y95 HydrophobicContact CG2-CE1 3.36Å; T93-Y95 HydrophobicContact CG2-CE2 4.14Å; T93-Y95 VanDerWaalsContact CG2-CZ 3.44Å; T93-D108 PolarHBondContact O-N 2.9Å
94	F	85.8	Confident	79.3	Confident	27 Å²	27	72.4 Å²	72.4	12%	0.118	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	135.2	175.8	-67.5	-88.2	0	0	0	109.8	L53 W59 F79 M80 I82 T84 T92 R107	L53-F94 HydrophobicContact CD1-CD1 4.21Å; L53-F94 HydrophobicContact CD1-CG 4.46Å; L53-F94 HydrophobicContact CD2-CB 4.46Å; L53-F94 HydrophobicContact CD2-CD2 4.34Å; L53-F94 HydrophobicContact CD2-CG 4.27Å; W59-F94 HydrophobicContact CH2-CB 4.41Å; F79-F94 CarbonylContact C-O 3.56Å; F79-F94 VanDerWaalsContact CA-O 3.29Å; F79-F94 WeakPolarHBondContact CA-O 3.34Å; M80-F94 PolarHBondContact N-O 2.78Å; M80-F94 PolarHBondContact O-N 3.35Å; I82-F94 HydrophobicContact CB-CD2 4.27Å; I82-F94 HydrophobicContact CB-CE2 4.08Å; I82-F94 HydrophobicContact CD1-CD2 3.99Å; I82-F94 HydrophobicContact CD1-CE2 4.22Å; I82-F94 HydrophobicContact CG1-CD2 4.3Å; T84-F94 HydrophobicContact CG2-CE2 4.07Å; T84-F94 HydrophobicContact CG2-CZ 4.06Å; T92-F94 WeakPolarHBondContact OG1-CE2 3.45Å; F94-R107 HydrophobicContact CD1-CB 4.33Å; F94-R107 HydrophobicContact CE1-CB 4.43Å; F94-R107 HydrophobicContact CE1-CG 4.45Å; F94-R107 VanDerWaalsContact CE1-NE 3.34Å; F94-R107 VanDerWaalsContact CZ-NH2 3.33Å
95	Y	85.6	Confident	79.8	Confident	36 Å²	36	73.5 Å²	73.5	14%	0.141	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	144.7	-176.8	-62.1	-57.6	0	0	0	111	E67 Y78 F79 T93 R105 W106 D108	E67-Y95 VanDerWaalsContact CD-CE1 3.41Å; E67-Y95 WeakPolarHBondContact OE1-CB 2.94Å; E67-Y95 WeakPolarHBondContact OE1-CD1 3.31Å; E67-Y95 WeakPolarHBondContact OE1-CE1 3.35Å; E67-Y95 WeakPolarHBondContact OE2-CD1 2.9Å; E67-Y95 WeakPolarHBondContact OE2-CE1 3.3Å; Y78-Y95 CarbonylContact O-C 3.42Å; Y78-Y95 WeakPolarHBondContact O-CA 3.3Å; F79-Y95 HydrophobicContact CB-CD1 3.37Å; F79-Y95 HydrophobicContact CB-CE1 3.37Å; F79-Y95 HydrophobicContact CG-CE1 4.38Å; T93-Y95 HydrophobicContact CG2-CD1 4.07Å; T93-Y95 HydrophobicContact CG2-CE1 3.36Å; T93-Y95 HydrophobicContact CG2-CE2 4.14Å; T93-Y95 VanDerWaalsContact CG2-CZ 3.44Å; Y95-R105 CarbonylContact O-C 3.27Å; Y95-R105 WeakPolarHBondContact O-CA 2.99Å; Y95-W106 AromaticContact CD2-CD1 3.68Å; Y95-W106 AromaticContact CD2-NE1 3.34Å; Y95-W106 VanDerWaalsContact CD2-NE1 3.34Å; Y95-W106 HydrophobicContact CG-CZ2 4.38Å; Y95-W106 AromaticContact CG-NE1 3.72Å; Y95-W106 PolarHBondContact N-O 3.13Å; Y95-W106 PolarHBondContact O-N 3.05Å; Y95-D108 HydrophobicContact CD2-CB 4.23Å; Y95-D108 HydrophobicContact CE2-CB 3.52Å
96	K	85.3	Confident	80.1	Confident	35 Å²	35	67.9 Å²	67.9	15%	0.152	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	126.5	175.2	-178.3	-173.3	174.2	-160.8	0	110	W59 A77 Y78 C98 H104 R105	W59-K96 HydrophobicContact CB-CD 4.04Å; W59-K96 VanDerWaalsContact CB-NZ 3.34Å; W59-K96 HydrophobicContact CD2-CB 4.01Å; W59-K96 HydrophobicContact CD2-CD 3.3Å; W59-K96 HydrophobicContact CD2-CG 4.3Å; W59-K96 HydrophobicContact CE3-CB 3.63Å; W59-K96 HydrophobicContact CE3-CD 3.72Å; W59-K96 HydrophobicContact CE3-CG 4.33Å; W59-K96 HydrophobicContact CG-CD 3.43Å; W59-K96 VanDerWaalsContact CG-CD 3.43Å; W59-K96 HydrophobicContact CH2-CB 3.67Å; W59-K96 HydrophobicContact CZ2-CB 4.05Å; W59-K96 HydrophobicContact CZ2-CD 4.29Å; W59-K96 HydrophobicContact CZ3-CB 3.45Å; W59-K96 VanDerWaalsContact CZ3-CB 3.45Å; W59-K96 HydrophobicContact CZ3-CD 4.35Å; A77-K96 CarbonylContact C-O 3.52Å; A77-K96 WeakPolarHBondContact CA-O 3.48Å; A77-K96 WeakPolarHBondContact CB-O 3.35Å; Y78-K96 PolarHBondContact N-O 2.83Å; Y78-K96 PolarHBondContact O-N 2.82Å; K96-C98 PolarHBondContact O-N 2.8Å; K96-H104 CarbonylContact C-O 3.49Å; K96-H104 WeakPolarHBondContact CA-O 2.73Å; K96-R105 HydrophobicContact CB-CG 4.15Å; K96-R105 HydrophobicContact CG-CG 3.95Å
97	C	85.3	Confident	80.4	Confident	3 Å²	3	70.6 Å²	70.6	2%	0.02	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-58.1	133.5	178.8	-172.5	0	0	0	0	112.1	C69 C72 N99 C102 H104 W106	C69-C97 HydrophobicContact CB-CB 4.18Å; C72-C97 PolarHBondContact SG-SG 3.03Å; C97-N99 PolarHBondContact O-N 2.93Å; C97-N99 VanDerWaalsContact SG-CB 3.59Å; C97-N99 PolarHBondContact SG-N 2.85Å; C97-N99 VanDerWaalsContact SG-N 3.38Å; C97-C102 HydrophobicContact CB-CB 4.37Å; C97-H104 PolarHBondContact N-O 3.36Å; C97-W106 HydrophobicContact CB-CH2 4.43Å; C97-W106 HydrophobicContact CB-CZ3 4.05Å
98	C	81	Confident	80.4	Confident	31 Å²	31	74.4 Å²	74.4	21%	0.209	39%	0.393	C	S	.	.	S	Bend	trans	-71.2	-12.6	175.1	-63.8	0	0	0	0	113.6	R76 A77 Y78 K96 A100	R76-C98 HydrophobicContact CB-CB 4.27Å; R76-C98 PolarHBondContact O-N 2.8Å; A77-C98 VanDerWaalsContact C-SG 3.51Å; A77-C98 WeakPolarHBondContact CA-SG 3.46Å; Y78-C98 HydrophobicContact CD2-CB 4.33Å; Y78-C98 VanDerWaalsContact CD2-SG 3.54Å; Y78-C98 HydrophobicContact CE2-CB 3.89Å; Y78-C98 WeakPolarHBondContact CE2-SG 3.34Å; K96-C98 PolarHBondContact O-N 2.8Å; C98-A100 PolarHBondContact O-N 2.91Å
99	N	79.8	Confident	80.3	Confident	51 Å²	51	70.2 Å²	70.2	27%	0.273	37%	0.37	S	S	.	.			trans	-74.5	114.9	177.1	-174.1	-8.8	0	0	0	110.2	C97 Q101 C102 G103	C97-N99 PolarHBondContact O-N 2.93Å; C97-N99 VanDerWaalsContact SG-CB 3.59Å; C97-N99 PolarHBondContact SG-N 2.85Å; C97-N99 VanDerWaalsContact SG-N 3.38Å; N99-Q101 PolarHBondContact O-N 3.1Å; N99-Q101 VanDerWaalsContact O-N 3.13Å; N99-Q101 PolarHBondContact OD1-N 2.81Å; N99-C102 HydrophobicContact CB-CB 4.03Å; N99-C102 PolarHBondContact O-N 3.31Å; N99-G103 PolarHBondContact O-N 2.97Å
100	A	71.1	Confident	80.7	Confident	105 Å²	105	69.3 Å²	69.3	87%	0.868	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.7	-26.2	178.7	0	0	0	0	0	113.6	C98	C98-A100 PolarHBondContact O-N 2.91Å
101	Q	76.5	Confident	81	Confident	186 Å²	186	66.7 Å²	66.7	87%	0.869	35%	0.346	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.9	-23.2	177.2	-61.9	-178.4	-2.5	0	0	113.3	N99	N99-Q101 PolarHBondContact O-N 3.1Å; N99-Q101 VanDerWaalsContact O-N 3.13Å; N99-Q101 PolarHBondContact OD1-N 2.81Å
102	C	78.3	Confident	81	Confident	30 Å²	30	64.7 Å²	64.7	20%	0.203	34%	0.338	C	S	.	.	T	Hydrogen-bonded Turn	trans	-94.4	-53.9	-176.9	-175.5	0	0	0	0	111.3	C72 C97 N99 H104	C72-C102 HydrophobicContact CB-CB 4.19Å; C97-C102 HydrophobicContact CB-CB 4.37Å; N99-C102 HydrophobicContact CB-CB 4.03Å; N99-C102 PolarHBondContact O-N 3.31Å; C102-H104 PolarHBondContact O-N 3.4Å; C102-H104 VanDerWaalsContact SG-CB 3.54Å
103	G	75.5	Confident	80.9	Confident	33 Å²	33	66.8 Å²	66.8	34%	0.34	35%	0.347	S	S	.	.			trans	53.5	15.2	-179.6	0	0	0	0	0	115.3	N99	N99-G103 PolarHBondContact O-N 2.97Å
104	H	82.9	Confident	80.6	Confident	65 Å²	65	70.1 Å²	70.1	30%	0.301	36%	0.363	S	S	.	.			trans	-65.3	136.7	-174.7	-174.7	56.2	0	0	0	110.3	K71 K96 C97 C102 W106	K71-H104 HydrophobicContact CB-CB 4.42Å; K71-H104 HydrophobicContact CD-CB 4.21Å; K96-H104 CarbonylContact C-O 3.49Å; K96-H104 WeakPolarHBondContact CA-O 2.73Å; C97-H104 PolarHBondContact N-O 3.36Å; C102-H104 PolarHBondContact O-N 3.4Å; C102-H104 VanDerWaalsContact SG-CB 3.54Å; H104-W106 AromaticContact CD2-CE3 3.57Å; H104-W106 VanDerWaalsContact O-CZ3 3.3Å; H104-W106 WeakPolarHBondContact O-CZ3 3.26Å
105	R	84	Confident	80.2	Confident	91 Å²	91	73.2 Å²	73.2	34%	0.343	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	135.3	178.4	-61.6	174	-175.4	162	-4	109.3	D51 Y95 K96	D51-R105 IonicContact OD2-CZ 3.83Å; D51-R105 IonicContact OD2-NH1 2.71Å; D51-R105 PolarHBondContact OD2-NH1 3.43Å; Y95-R105 CarbonylContact O-C 3.27Å; Y95-R105 WeakPolarHBondContact O-CA 2.99Å; K96-R105 HydrophobicContact CB-CG 4.15Å; K96-R105 HydrophobicContact CG-CG 3.95Å
106	W	84.2	Confident	79.8	Confident	52 Å²	52	76.1 Å²	76.1	20%	0.197	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.3	167.3	175.3	64.8	98.3	0	0	0	110.3	E67 C69 P70 A77 Y95 C97 H104	E67-W106 VanDerWaalsContact OE1-CZ2 3.24Å; E67-W106 WeakPolarHBondContact OE1-CZ2 2.9Å; C69-W106 HydrophobicContact CB-CH2 3.77Å; C69-W106 HydrophobicContact CB-CZ3 4.11Å; C69-W106 VanDerWaalsContact SG-CZ3 3.55Å; P70-W106 HydrophobicContact CG-CD2 4.19Å; P70-W106 HydrophobicContact CG-CE3 4.4Å; P70-W106 HydrophobicContact CG-CG 4.44Å; A77-W106 HydrophobicContact CB-CH2 3.67Å; A77-W106 HydrophobicContact CB-CZ2 3.99Å; Y95-W106 AromaticContact CD2-CD1 3.68Å; Y95-W106 AromaticContact CD2-NE1 3.34Å; Y95-W106 VanDerWaalsContact CD2-NE1 3.34Å; Y95-W106 HydrophobicContact CG-CZ2 4.38Å; Y95-W106 AromaticContact CG-NE1 3.72Å; Y95-W106 PolarHBondContact N-O 3.13Å; Y95-W106 PolarHBondContact O-N 3.05Å; C97-W106 HydrophobicContact CB-CH2 4.43Å; C97-W106 HydrophobicContact CB-CZ3 4.05Å; H104-W106 AromaticContact CD2-CE3 3.57Å; H104-W106 VanDerWaalsContact O-CZ3 3.3Å; H104-W106 WeakPolarHBondContact O-CZ3 3.26Å
107	R	82.1	Confident	79.4	Confident	146 Å²	146	79.5 Å²	79.5	55%	0.551	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121	146.1	178.6	176	-170.7	-66.6	-175.9	0.9	108.2	F94	F94-R107 HydrophobicContact CD1-CB 4.33Å; F94-R107 HydrophobicContact CE1-CB 4.43Å; F94-R107 HydrophobicContact CE1-CG 4.45Å; F94-R107 VanDerWaalsContact CE1-NE 3.34Å; F94-R107 VanDerWaalsContact CZ-NH2 3.33Å
108	D	71.9	Confident	78.8	Confident	161 Å²	161	86.5 Å²	86.5	86%	0.861	46%	0.456	S	S	*	.			trans	-112	0	161	-166.6	57.1	0	0	0	110.3	T93 Y95	T93-D108 PolarHBondContact O-N 2.9Å; Y95-D108 HydrophobicContact CD2-CB 4.23Å; Y95-D108 HydrophobicContact CE2-CB 3.52Å

Retrieved 108 of 108 residues in 336.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).