A0A087XY37_POEFO Loading...

Small ribosomal subunit protein uS17m

AlphaFold DB , UniProt , Accession A0A087XY37, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 146 aa.

						>A0A087XY37_POEFO|A0A087XY37
MSGRKIMVHATWAIGKVIGTKMQKTAKVRVTRLVLDPNLLKYYNKRKTYFVHDALEQCTVGDIVLIKALSVTRSKHVKHELSEIVYKVGRVVDPLTGKSVAGTEFVEPLSDLVLEENISLSDKLKELNISAASSAADSPSVQTPTS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.8	Very low	72	Confident	244 Å²	244	127.4 Å²	127.4	100%	1.202	66%	0.657	S	S	*	*				0	95.2	0	-68.2	-60.9	-155.3	0	0	109.4	G3	M1-G3 PolarHBondContact O-N 3.22Å; M1-G3 VanDerWaalsContact O-N 3.16Å
2	S	57.2	Low	74.1	Confident	129 Å²	129	127.6 Å²	127.6	90%	0.902	64%	0.643	S	S	*	*			trans	-77.3	97.9	179	-179.8	0	0	0	0	109.5
3	G	60.5	Low	75.8	Confident	62 Å²	62	118.8 Å²	118.8	64%	0.639	60%	0.602	S	S	*	*			trans	-61.8	147.9	178.1	0	0	0	0	0	112.3	M1 K5	M1-G3 PolarHBondContact O-N 3.22Å; M1-G3 VanDerWaalsContact O-N 3.16Å; G3-K5 PolarHBondContact O-N 3.46Å
4	R	63.4	Low	77.4	Confident	242 Å²	242	117.4 Å²	117.4	91%	0.913	60%	0.595	S	S	*	*			trans	-56.3	112.2	174.7	-80.1	-179.3	178.9	174.1	0.2	109.6
5	K	65.7	Low	78.8	Confident	185 Å²	185	110 Å²	110	80%	0.804	56%	0.56	S	S	*	*			trans	-79	127.3	175.6	-160.6	176.3	-173.6	178.9	0	108.8	G3 M7	G3-K5 PolarHBondContact O-N 3.46Å; K5-M7 PolarHBondContact O-N 3.2Å
6	I	72.3	Confident	80	Confident	56 Å²	56	110.8 Å²	110.8	29%	0.287	56%	0.559	S	S	.	*			trans	-72	133.2	175.3	-65.4	161.6	0	0	0	109.9	V8 S70 V71 T72	I6-V8 HydrophobicContact CB-CG2 4.4Å; I6-V8 HydrophobicContact CG2-CG2 3.48Å; I6-V8 VanDerWaalsContact CG2-CG2 3.48Å; I6-V8 PolarHBondContact O-N 3.48Å; I6-S70 WeakPolarHBondContact CD1-O 3.34Å; I6-S70 VanDerWaalsContact CG1-O 3.28Å; I6-S70 WeakPolarHBondContact CG1-O 3.33Å; I6-S70 PolarHBondContact N-O 3.33Å; I6-S70 VanDerWaalsContact N-O 3.16Å; I6-V71 VanDerWaalsContact CD1-C 3.41Å; I6-V71 VanDerWaalsContact CD1-CA 3.42Å; I6-T72 HydrophobicContact CD1-CG2 3.38Å
7	M	77	Confident	81.1	Confident	189 Å²	189	104.4 Å²	104.4	93%	0.931	53%	0.527	S	S	*	.			trans	-87.3	94.2	170.5	-165.2	163.1	66.9	0	0	109.3	K5	K5-M7 PolarHBondContact O-N 3.2Å
8	V	86.4	Confident	82	Confident	28 Å²	28	101.7 Å²	101.7	17%	0.17	51%	0.513	C	S	.	.			trans	-103.6	130.9	168.6	-164.9	0	0	0	0	108	I6 A10 A68	I6-V8 HydrophobicContact CB-CG2 4.4Å; I6-V8 HydrophobicContact CG2-CG2 3.48Å; I6-V8 VanDerWaalsContact CG2-CG2 3.48Å; I6-V8 PolarHBondContact O-N 3.48Å; V8-A10 PolarHBondContact O-N 2.82Å; V8-A68 HydrophobicContact CB-CB 4.27Å; V8-A68 HydrophobicContact CG2-CB 4.31Å
9	H	83.2	Confident	82.9	Confident	174 Å²	174	97.3 Å²	97.3	81%	0.806	50%	0.496	S	S	*	.	S	Bend	trans	-61.4	-27.5	177.4	-172	-57.2	0	0	0	112.7
10	A	87.2	Confident	83.6	Confident	3 Å²	3	95.4 Å²	95.4	3%	0.025	49%	0.489	C	S	.	.			trans	-101.5	94	176.2	0	0	0	0	0	109	V8 H79	V8-A10 PolarHBondContact O-N 2.82Å; A10-H79 PolarHBondContact O-CE1 3.17Å; A10-H79 VanDerWaalsContact O-CE1 3.24Å
11	T	93.6	Very high	84.2	Confident	89 Å²	89	100.8 Å²	100.8	55%	0.546	51%	0.509	S	S	.	.	S	Bend	trans	-75.4	-44.9	175.1	47.9	0	0	0	0	111.3	K67 A68	T11-K67 CarbonylContact O-C 3.44Å; T11-K67 WeakPolarHBondContact O-CA 3.38Å; T11-A68 PolarHBondContact O-N 3.19Å
12	W	96.5	Very high	86.6	Confident	130 Å²	130	93.7 Å²	93.7	49%	0.492	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.6	141.3	173.4	-66.7	96.4	0	0	0	109.5	L65 I66 K67 S82	W12-L65 HydrophobicContact CE3-CD1 3.97Å; W12-L65 HydrophobicContact CE3-CD2 3.96Å; W12-L65 HydrophobicContact CE3-CG 3.87Å; W12-L65 HydrophobicContact CZ3-CD2 3.7Å; W12-L65 HydrophobicContact CZ3-CG 3.95Å; W12-I66 WeakPolarHBondContact CA-O 3.36Å; W12-K67 HydrophobicContact CD2-CB 4.49Å; W12-K67 HydrophobicContact CD2-CG 4.28Å; W12-K67 HydrophobicContact CE3-CB 3.99Å; W12-K67 HydrophobicContact CE3-CG 4.22Å; W12-K67 HydrophobicContact CH2-CB 4.1Å; W12-K67 HydrophobicContact CH2-CD 3.58Å; W12-K67 HydrophobicContact CH2-CG 3.84Å; W12-K67 HydrophobicContact CZ2-CD 3.73Å; W12-K67 HydrophobicContact CZ2-CG 3.85Å; W12-K67 HydrophobicContact CZ3-CB 3.8Å; W12-K67 HydrophobicContact CZ3-CD 4.16Å; W12-K67 HydrophobicContact CZ3-CG 4.01Å; W12-S82 WeakPolarHBondContact CZ3-OG 3.38Å
13	A	97	Very high	88.5	Confident	13 Å²	13	94.9 Å²	94.9	11%	0.107	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153	153.4	171.2	0	0	0	0	0	110.7	V30 I66	A13-V30 HydrophobicContact CB-CG1 4.11Å; A13-V30 HydrophobicContact CB-CG2 4.04Å; A13-I66 HydrophobicContact CB-CD1 4.09Å; A13-I66 HydrophobicContact CB-CG1 3.8Å; A13-I66 PolarHBondContact N-O 3.47Å; A13-I66 WeakPolarHBondContact O-CG1 3.29Å; A13-I66 PolarHBondContact O-N 3.23Å
14	I	97.9	Very high	90.2	Very high	99 Å²	99	97.4 Å²	97.4	51%	0.508	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	139.4	171.2	-65.4	170.8	0	0	0	108	I63 V64 L65	I14-I63 HydrophobicContact CG2-CG2 3.53Å; I14-V64 WeakPolarHBondContact CA-O 3.48Å; I14-L65 HydrophobicContact CD1-CD1 4.47Å; I14-L65 HydrophobicContact CG1-CD1 3.72Å
15	G	97.9	Very high	91.9	Very high	7 Å²	7	86.9 Å²	86.9	7%	0.072	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.6	169.5	178.1	0	0	0	0	0	113.4	R29 I63 V64	G15-R29 CarbonylContact C-O 3.59Å; G15-R29 WeakPolarHBondContact CA-O 3.22Å; G15-I63 WeakPolarHBondContact O-CA 3.4Å; G15-V64 PolarHBondContact N-O 3.37Å; G15-V64 WeakPolarHBondContact O-CG2 3.35Å; G15-V64 PolarHBondContact O-N 3.4Å
16	K	98.4	Very high	93.4	Very high	123 Å²	123	78.1 Å²	78.1	54%	0.535	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	132.1	177.6	-175	173.1	-176.3	170	0	110.7	I18 V28 R29 G61 D62	K16-I18 PolarHBondContact O-N 3.5Å; K16-V28 CarbonylContact O-C 3.53Å; K16-R29 PolarHBondContact N-O 3Å; K16-R29 PolarHBondContact O-N 3.42Å; K16-G61 WeakPolarHBondContact CE-O 3.49Å; K16-D62 CarbonylContact C-O 3.48Å; K16-D62 VanDerWaalsContact CA-O 3.3Å; K16-D62 WeakPolarHBondContact CA-O 3.45Å
17	V	98.6	Very high	94.6	Very high	2 Å²	2	79.6 Å²	79.6	1%	0.012	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.8	121.7	174.4	-177.8	0	0	0	0	109.4	T20 A26 V28 C58 T59 G61 D62 V64	V17-T20 HydrophobicContact CG1-CG2 3.76Å; V17-A26 HydrophobicContact CG1-CB 4.49Å; V17-V28 HydrophobicContact CG2-CG2 4.24Å; V17-C58 HydrophobicContact CG1-CB 4.48Å; V17-C58 HydrophobicContact CG2-CB 4.24Å; V17-T59 WeakPolarHBondContact CB-O 3.5Å; V17-T59 WeakPolarHBondContact CG1-O 3.27Å; V17-G61 PolarHBondContact O-N 3.46Å; V17-D62 HydrophobicContact CB-CB 4.47Å; V17-D62 HydrophobicContact CG2-CB 4Å; V17-D62 PolarHBondContact N-O 3.23Å; V17-V64 HydrophobicContact CG2-CB 4.46Å; V17-V64 HydrophobicContact CG2-CG1 3.71Å; V17-V64 HydrophobicContact CG2-CG2 3.84Å
18	I	98.2	Very high	95.7	Very high	55 Å²	55	70.6 Å²	70.6	28%	0.282	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.4	-34.2	176.1	-47.7	167.6	0	0	0	110.8	K16 K27 R29 T48 V60	K16-I18 PolarHBondContact O-N 3.5Å; I18-K27 PolarHBondContact N-O 2.89Å; I18-R29 HydrophobicContact CD1-CB 3.62Å; I18-R29 HydrophobicContact CD1-CG 4.15Å; I18-R29 HydrophobicContact CG1-CB 3.68Å; I18-T48 HydrophobicContact CD1-CG2 3.83Å; I18-V60 WeakPolarHBondContact O-CG1 3.49Å
19	G	97.7	Very high	96.2	Very high	19 Å²	19	73.9 Å²	73.9	20%	0.196	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.7	145.6	-172.6	0	0	0	0	0	113.7	K27	G19-K27 PolarHBondContact N-O 3.18Å; G19-K27 WeakPolarHBondContact O-CB 3.47Å; G19-K27 PolarHBondContact O-N 3.48Å
20	T	97.8	Very high	96.9	Very high	58 Å²	58	65.9 Å²	65.9	36%	0.356	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	19.8	-175.1	52.5	0	0	0	0	111.6	V17 M22 C58 V60	V17-T20 HydrophobicContact CG1-CG2 3.76Å; T20-M22 PolarHBondContact O-N 3.01Å; T20-M22 VanDerWaalsContact O-N 3.15Å; T20-C58 HydrophobicContact CG2-CB 4.21Å; T20-C58 WeakPolarHBondContact CG2-O 3.44Å; T20-V60 HydrophobicContact CG2-CG2 4.45Å
21	K	97.1	Very high	97.4	Very high	209 Å²	209	69.6 Å²	69.6	91%	0.909	34%	0.339	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-67.4	-11.9	-177.9	-65.8	-173.2	175.8	-173.6	0	114
22	M	95.9	Very high	97.6	Very high	96 Å²	96	70.3 Å²	70.3	47%	0.473	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	141.3	-177.3	-64.4	174.5	64.9	0	0	109.8	T20 K24 T25 F50	T20-M22 PolarHBondContact O-N 3.01Å; T20-M22 VanDerWaalsContact O-N 3.15Å; M22-K24 PolarHBondContact O-N 3.5Å; M22-T25 HydrophobicContact CE-CG2 4.2Å; M22-T25 PolarHBondContact O-N 3.35Å; M22-T25 HydrophobicContact SD-CG2 4.49Å; M22-F50 HydrophobicContact CE-CD1 4.45Å; M22-F50 HydrophobicContact CE-CE1 4.42Å; M22-F50 HydrophobicContact SD-CD1 3.97Å; M22-F50 HydrophobicContact SD-CE1 3.65Å
23	Q	96.4	Very high	97.6	Very high	154 Å²	154	69.5 Å²	69.5	72%	0.72	34%	0.337	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.7	130.9	176.2	-60.7	-66.4	-44.8	0	0	110.5	T25	Q23-T25 PolarHBondContact O-N 3.5Å; Q23-T25 PolarHBondContact O-OG1 2.97Å
24	K	96.7	Very high	97.7	Very high	115 Å²	115	71.9 Å²	71.9	50%	0.5	35%	0.35	S	S	.	.	T	Hydrogen-bonded Turn	trans	48.3	28	177.9	-57.5	-176.2	179.5	-177.9	0	114.8	M22 H52 D53 E56	M22-K24 PolarHBondContact O-N 3.5Å; K24-H52 PolarHBondContact O-ND1 3.29Å; K24-D53 CarbonylContact C-O 3.2Å; K24-D53 WeakPolarHBondContact CA-O 3.16Å; K24-D53 VanDerWaalsContact CB-O 3.29Å; K24-D53 WeakPolarHBondContact CB-O 3.3Å; K24-D53 PolarHBondContact O-N 3.48Å; K24-E56 HydrophobicContact CG-CG 4.22Å; K24-E56 WeakPolarHBondContact CG-OE1 3.28Å; K24-E56 PolarHBondContact N-OE1 3.05Å
25	T	97.7	Very high	97.7	Very high	21 Å²	21	70.7 Å²	70.7	13%	0.129	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147	122.2	-173.7	-51.1	0	0	0	0	111.2	M22 Q23 F50 V51 V77	M22-T25 HydrophobicContact CE-CG2 4.2Å; M22-T25 PolarHBondContact O-N 3.35Å; M22-T25 HydrophobicContact SD-CG2 4.49Å; Q23-T25 PolarHBondContact O-N 3.5Å; Q23-T25 PolarHBondContact O-OG1 2.97Å; T25-F50 HydrophobicContact CG2-CB 4.15Å; T25-F50 HydrophobicContact CG2-CD1 4.19Å; T25-V51 CarbonylContact C-O 3.5Å; T25-V51 VanDerWaalsContact CA-O 3.25Å; T25-V51 WeakPolarHBondContact CA-O 3.48Å; T25-V51 WeakPolarHBondContact CG2-O 3.3Å; T25-V77 HydrophobicContact CG2-CG2 4.18Å
26	A	97.9	Very high	97.7	Very high	1 Å²	1	72.9 Å²	72.9	1%	0.008	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	141	173.4	0	0	0	0	0	111.4	V17 V28 V51 C58	V17-A26 HydrophobicContact CG1-CB 4.49Å; A26-V28 HydrophobicContact CB-CG2 4.32Å; A26-V51 PolarHBondContact N-O 2.8Å; A26-V51 PolarHBondContact O-N 3.26Å; A26-C58 HydrophobicContact CB-CB 4.13Å
27	K	98.3	Very high	97.6	Very high	87 Å²	87	71.8 Å²	71.8	38%	0.378	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.7	111.1	170.9	-174.6	177.2	-177.1	173.7	0	109.2	I18 G19 F50	I18-K27 PolarHBondContact N-O 2.89Å; G19-K27 PolarHBondContact N-O 3.18Å; G19-K27 WeakPolarHBondContact O-CB 3.47Å; G19-K27 PolarHBondContact O-N 3.48Å; K27-F50 HydrophobicContact CB-CE1 4.46Å; K27-F50 HydrophobicContact CG-CE1 4.35Å
28	V	98.3	Very high	97.6	Very high	0 Å²	0	78.5 Å²	78.5	0%	0	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	134.5	-173.6	-179.5	0	0	0	0	111.2	K16 V17 A26 T48 Y49 V51 V64 I66	K16-V28 CarbonylContact O-C 3.53Å; V17-V28 HydrophobicContact CG2-CG2 4.24Å; A26-V28 HydrophobicContact CB-CG2 4.32Å; V28-T48 CarbonylContact O-C 3.54Å; V28-T48 VanDerWaalsContact O-CA 3.3Å; V28-T48 WeakPolarHBondContact O-CA 3.49Å; V28-Y49 PolarHBondContact N-O 3.42Å; V28-Y49 PolarHBondContact O-N 3.28Å; V28-V51 HydrophobicContact CB-CG2 3.92Å; V28-V51 HydrophobicContact CG2-CB 4.18Å; V28-V51 HydrophobicContact CG2-CG2 3.54Å; V28-V64 HydrophobicContact CB-CG2 4.5Å; V28-V64 HydrophobicContact CG1-CG2 3.83Å; V28-V64 HydrophobicContact CG2-CG2 3.79Å; V28-I66 HydrophobicContact CG1-CG2 4.42Å
29	R	98.4	Very high	97.6	Very high	96 Å²	96	81.1 Å²	81.1	36%	0.362	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	114.8	171.1	-159.3	170.4	-79.2	163.1	-1.3	109.6	G15 K16 I18 R46	G15-R29 CarbonylContact C-O 3.59Å; G15-R29 WeakPolarHBondContact CA-O 3.22Å; K16-R29 PolarHBondContact N-O 3Å; K16-R29 PolarHBondContact O-N 3.42Å; I18-R29 HydrophobicContact CD1-CB 3.62Å; I18-R29 HydrophobicContact CD1-CG 4.15Å; I18-R29 HydrophobicContact CG1-CB 3.68Å; R29-R46 HydrophobicContact CG-CB 3.99Å
30	V	98	Very high	97.6	Very high	6 Å²	6	86.4 Å²	86.4	4%	0.036	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.5	133.9	167.2	177.7	0	0	0	0	108.1	A13 R32 R46 K47 Y49 I66	A13-V30 HydrophobicContact CB-CG1 4.11Å; A13-V30 HydrophobicContact CB-CG2 4.04Å; V30-R32 HydrophobicContact CG1-CG 4.39Å; V30-R46 CarbonylContact O-C 3.54Å; V30-R46 WeakPolarHBondContact O-CA 3.48Å; V30-K47 PolarHBondContact N-O 3.12Å; V30-K47 PolarHBondContact O-N 2.95Å; V30-Y49 HydrophobicContact CB-CD2 3.9Å; V30-Y49 HydrophobicContact CB-CE2 3.86Å; V30-Y49 HydrophobicContact CG1-CE2 4.5Å; V30-Y49 HydrophobicContact CG2-CD2 3.55Å; V30-Y49 HydrophobicContact CG2-CE2 3.9Å; V30-I66 HydrophobicContact CG2-CD1 4.02Å
31	T	97.3	Very high	97.6	Very high	82 Å²	82	89.4 Å²	89.4	50%	0.503	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	138.9	174.1	55.2	0	0	0	0	109	R46	T31-R46 HydrophobicContact CG2-CB 4.24Å
32	R	96.6	Very high	97.6	Very high	103 Å²	103	86.4 Å²	86.4	39%	0.389	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	144.9	175.4	-61.7	-177	-179.6	-167.1	-5.5	108.3	V30 K45	V30-R32 HydrophobicContact CG1-CG 4.39Å; R32-K45 PolarHBondContact N-O 3.47Å; R32-K45 PolarHBondContact O-N 3.09Å
33	L	97.8	Very high	97.7	Very high	113 Å²	113	86.6 Å²	86.6	59%	0.592	42%	0.421	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.7	127.2	171.4	-65.5	172.4	0	0	0	108.9	Y42 N44	L33-Y42 HydrophobicContact CB-CD1 3.98Å; L33-Y42 HydrophobicContact CB-CG 4.47Å; L33-N44 WeakPolarHBondContact CD2-OD1 3.25Å
34	V	98.1	Very high	97.8	Very high	64 Å²	64	85.1 Å²	85.1	39%	0.388	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	129.9	175	178.2	0	0	0	0	107.8	Y43 K45	V34-Y43 PolarHBondContact N-O 3.39Å; V34-Y43 PolarHBondContact O-N 2.96Å; V34-K45 HydrophobicContact CB-CB 4.24Å; V34-K45 HydrophobicContact CB-CD 4.5Å; V34-K45 HydrophobicContact CG2-CB 3.63Å; V34-K45 HydrophobicContact CG2-CD 3.84Å; V34-K45 HydrophobicContact CG2-CG 4.38Å
35	L	98.2	Very high	97.9	Very high	74 Å²	74	86.3 Å²	86.3	39%	0.387	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.1	127.3	176.6	-176.2	65.6	0	0	0	109.4	L40 Y42	L35-L40 VanDerWaalsContact CD1-C 3.46Å; L35-L40 HydrophobicContact CD2-CD2 4.47Å; L35-Y42 HydrophobicContact CB-CD1 4.14Å; L35-Y42 HydrophobicContact CB-CE1 3.84Å; L35-Y42 HydrophobicContact CD1-CD2 4.36Å; L35-Y42 HydrophobicContact CD1-CE1 4.34Å; L35-Y42 HydrophobicContact CD1-CE2 4.16Å
36	D	98	Very high	97.8	Very high	53 Å²	53	93.8 Å²	93.8	28%	0.283	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	120.9	163.4	-172.2	-58.8	0	0	0	108.8	N38 L39 L40 K41 Y43	D36-N38 VanDerWaalsContact C-N 3.27Å; D36-N38 PolarHBondContact O-N 3.18Å; D36-N38 WeakPolarHBondContact OD1-CB 3.35Å; D36-N38 PolarHBondContact OD1-N 3.2Å; D36-L39 HydrophobicContact CB-CB 4.49Å; D36-L39 PolarHBondContact OD1-N 3.35Å; D36-L40 VanDerWaalsContact O-CA 3.25Å; D36-L40 WeakPolarHBondContact O-CA 3.26Å; D36-L40 PolarHBondContact O-N 3.49Å; D36-K41 PolarHBondContact N-O 3.35Å; D36-Y43 HydrophobicContact CB-CD2 3.96Å; D36-Y43 HydrophobicContact CB-CE2 3.89Å
37	P	97.6	Very high	97.8	Very high	100 Å²	100	99.9 Å²	99.9	65%	0.649	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.4	-23.4	-175.2	28.5	-35	0	0	0	113.4
38	N	97.6	Very high	97.8	Very high	143 Å²	143	99 Å²	99	77%	0.765	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.8	-42.3	-177.8	-65.4	-16	0	0	0	111.1	D36	D36-N38 VanDerWaalsContact C-N 3.27Å; D36-N38 PolarHBondContact O-N 3.18Å; D36-N38 WeakPolarHBondContact OD1-CB 3.35Å; D36-N38 PolarHBondContact OD1-N 3.2Å
39	L	97.6	Very high	97.7	Very high	109 Å²	109	100.3 Å²	100.3	57%	0.571	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.4	-11.1	-177.5	-76.4	76.9	0	0	0	113.2	D36 K41 Y43	D36-L39 HydrophobicContact CB-CB 4.49Å; D36-L39 PolarHBondContact OD1-N 3.35Å; L39-K41 HydrophobicContact CB-CB 4.35Å; L39-K41 PolarHBondContact O-N 3.41Å; L39-K41 VanDerWaalsContact O-N 3.12Å; L39-Y43 WeakPolarHBondContact CD2-OH 3.44Å
40	L	97.5	Very high	97.7	Very high	130 Å²	130	98.1 Å²	98.1	68%	0.681	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.4	33.9	-173.1	-60.4	175.6	0	0	0	113.2	L35 D36	L35-L40 VanDerWaalsContact CD1-C 3.46Å; L35-L40 HydrophobicContact CD2-CD2 4.47Å; D36-L40 VanDerWaalsContact O-CA 3.25Å; D36-L40 WeakPolarHBondContact O-CA 3.26Å; D36-L40 PolarHBondContact O-N 3.49Å
41	K	98.3	Very high	97.6	Very high	122 Å²	122	97.9 Å²	97.9	53%	0.53	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	140.3	179.4	-178.2	169.7	175.4	178.7	0	110.5	D36 L39 Y43	D36-K41 PolarHBondContact N-O 3.35Å; L39-K41 HydrophobicContact CB-CB 4.35Å; L39-K41 PolarHBondContact O-N 3.41Å; L39-K41 VanDerWaalsContact O-N 3.12Å; K41-Y43 HydrophobicContact CB-CE2 3.78Å; K41-Y43 HydrophobicContact CD-CE1 4.37Å; K41-Y43 HydrophobicContact CD-CE2 4.28Å; K41-Y43 HydrophobicContact CG-CE2 3.91Å; K41-Y43 VanDerWaalsContact O-CD2 3.28Å; K41-Y43 WeakPolarHBondContact O-CD2 3.25Å
42	Y	98.4	Very high	97.6	Very high	145 Å²	145	94.8 Å²	94.8	57%	0.569	45%	0.454	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.8	132.6	175.3	-71.4	-82.3	0	0	0	111.4	L33 L35	L33-Y42 HydrophobicContact CB-CD1 3.98Å; L33-Y42 HydrophobicContact CB-CG 4.47Å; L35-Y42 HydrophobicContact CB-CD1 4.14Å; L35-Y42 HydrophobicContact CB-CE1 3.84Å; L35-Y42 HydrophobicContact CD1-CD2 4.36Å; L35-Y42 HydrophobicContact CD1-CE1 4.34Å; L35-Y42 HydrophobicContact CD1-CE2 4.16Å
43	Y	98.1	Very high	97.7	Very high	101 Å²	101	90.3 Å²	90.3	40%	0.396	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	149.5	174.9	-65.8	-87.4	0	0	0	111.4	V34 D36 L39 K41 K45	V34-Y43 PolarHBondContact N-O 3.39Å; V34-Y43 PolarHBondContact O-N 2.96Å; D36-Y43 HydrophobicContact CB-CD2 3.96Å; D36-Y43 HydrophobicContact CB-CE2 3.89Å; L39-Y43 WeakPolarHBondContact CD2-OH 3.44Å; K41-Y43 HydrophobicContact CB-CE2 3.78Å; K41-Y43 HydrophobicContact CD-CE1 4.37Å; K41-Y43 HydrophobicContact CD-CE2 4.28Å; K41-Y43 HydrophobicContact CG-CE2 3.91Å; K41-Y43 VanDerWaalsContact O-CD2 3.28Å; K41-Y43 WeakPolarHBondContact O-CD2 3.25Å; Y43-K45 PolarHBondContact O-N 3.39Å
44	N	97.9	Very high	97.6	Very high	122 Å²	122	87.6 Å²	87.6	65%	0.652	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.5	103.6	178.3	-72.9	-30.6	0	0	0	110.9	L33	L33-N44 WeakPolarHBondContact CD2-OD1 3.25Å
45	K	97.7	Very high	97.5	Very high	141 Å²	141	90.7 Å²	90.7	61%	0.613	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.9	120.7	170	-165	171.5	-172.1	168.9	0	109.9	R32 V34 Y43	R32-K45 PolarHBondContact N-O 3.47Å; R32-K45 PolarHBondContact O-N 3.09Å; V34-K45 HydrophobicContact CB-CB 4.24Å; V34-K45 HydrophobicContact CB-CD 4.5Å; V34-K45 HydrophobicContact CG2-CB 3.63Å; V34-K45 HydrophobicContact CG2-CD 3.84Å; V34-K45 HydrophobicContact CG2-CG 4.38Å; Y43-K45 PolarHBondContact O-N 3.39Å
46	R	97.4	Very high	97.4	Very high	178 Å²	178	91.9 Å²	91.9	67%	0.672	45%	0.449	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.1	141.7	-179.4	65.2	-170.6	-179.8	-158.5	0.5	112.1	R29 V30 T31	R29-R46 HydrophobicContact CG-CB 3.99Å; V30-R46 CarbonylContact O-C 3.54Å; V30-R46 WeakPolarHBondContact O-CA 3.48Å; T31-R46 HydrophobicContact CG2-CB 4.24Å
47	K	97.1	Very high	97.3	Very high	129 Å²	129	94.1 Å²	94.1	56%	0.561	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-135.6	137.5	169.3	-175.3	167.6	176.4	175.9	0	109.8	V30 Y49	V30-K47 PolarHBondContact N-O 3.12Å; V30-K47 PolarHBondContact O-N 2.95Å; K47-Y49 HydrophobicContact CB-CE2 3.94Å; K47-Y49 HydrophobicContact CD-CE2 3.96Å; K47-Y49 HydrophobicContact CG-CD2 4.35Å; K47-Y49 HydrophobicContact CG-CE2 3.73Å
48	T	97.8	Very high	97.3	Very high	69 Å²	69	89.8 Å²	89.8	42%	0.423	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.6	136.3	178.2	52.7	0	0	0	0	111	I18 V28	I18-T48 HydrophobicContact CD1-CG2 3.83Å; V28-T48 CarbonylContact O-C 3.54Å; V28-T48 VanDerWaalsContact O-CA 3.3Å; V28-T48 WeakPolarHBondContact O-CA 3.49Å
49	Y	97.1	Very high	97.3	Very high	27 Å²	27	85.6 Å²	85.6	11%	0.106	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	144.1	176.2	-69.5	-88.8	0	0	0	109.4	V28 V30 K47 I66 H79	V28-Y49 PolarHBondContact N-O 3.42Å; V28-Y49 PolarHBondContact O-N 3.28Å; V30-Y49 HydrophobicContact CB-CD2 3.9Å; V30-Y49 HydrophobicContact CB-CE2 3.86Å; V30-Y49 HydrophobicContact CG1-CE2 4.5Å; V30-Y49 HydrophobicContact CG2-CD2 3.55Å; V30-Y49 HydrophobicContact CG2-CE2 3.9Å; K47-Y49 HydrophobicContact CB-CE2 3.94Å; K47-Y49 HydrophobicContact CD-CE2 3.96Å; K47-Y49 HydrophobicContact CG-CD2 4.35Å; K47-Y49 HydrophobicContact CG-CE2 3.73Å; Y49-I66 HydrophobicContact CG-CD1 4.3Å; Y49-H79 AromaticContact CD1-CD2 3.42Å; Y49-H79 VanDerWaalsContact CD1-CD2 3.42Å; Y49-H79 WeakPolarHBondContact CD1-CD2 3.5Å; Y49-H79 AromaticContact CD1-NE2 3.15Å; Y49-H79 WeakPolarHBondContact CD1-NE2 3.38Å; Y49-H79 AromaticContact CE1-NE2 3.41Å; Y49-H79 WeakPolarHBondContact CE1-NE2 3.32Å
50	F	97.3	Very high	97.3	Very high	50 Å²	50	84.4 Å²	84.4	22%	0.219	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.5	129.5	169.2	-66.3	-82.3	0	0	0	108.9	M22 T25 K27 H76 V77	M22-F50 HydrophobicContact CE-CD1 4.45Å; M22-F50 HydrophobicContact CE-CE1 4.42Å; M22-F50 HydrophobicContact SD-CD1 3.97Å; M22-F50 HydrophobicContact SD-CE1 3.65Å; T25-F50 HydrophobicContact CG2-CB 4.15Å; T25-F50 HydrophobicContact CG2-CD1 4.19Å; K27-F50 HydrophobicContact CB-CE1 4.46Å; K27-F50 HydrophobicContact CG-CE1 4.35Å; F50-H76 HydrophobicContact CD2-CB 3.61Å; F50-H76 HydrophobicContact CE2-CB 4.05Å; F50-H76 HydrophobicContact CG-CB 4.39Å; F50-V77 HydrophobicContact CB-CG2 4Å
51	V	97.7	Very high	97.4	Very high	0 Å²	0	79 Å²	79	0%	0	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	126.7	-170.5	-177.7	0	0	0	0	107.5	T25 A26 V28 D53 I66 H79 E80 L81	T25-V51 CarbonylContact C-O 3.5Å; T25-V51 VanDerWaalsContact CA-O 3.25Å; T25-V51 WeakPolarHBondContact CA-O 3.48Å; T25-V51 WeakPolarHBondContact CG2-O 3.3Å; A26-V51 PolarHBondContact N-O 2.8Å; A26-V51 PolarHBondContact O-N 3.26Å; V28-V51 HydrophobicContact CB-CG2 3.92Å; V28-V51 HydrophobicContact CG2-CB 4.18Å; V28-V51 HydrophobicContact CG2-CG2 3.54Å; V51-D53 PolarHBondContact O-N 3.08Å; V51-I66 HydrophobicContact CB-CG2 4.43Å; V51-I66 HydrophobicContact CG1-CG2 3.95Å; V51-I66 HydrophobicContact CG2-CB 4.23Å; V51-I66 HydrophobicContact CG2-CD1 4.3Å; V51-I66 HydrophobicContact CG2-CG2 3.6Å; V51-H79 WeakPolarHBondContact CA-O 3.41Å; V51-H79 HydrophobicContact CG2-CB 4.22Å; V51-E80 VanDerWaalsContact CG1-C 3.42Å; V51-L81 HydrophobicContact CG1-CB 3.93Å
52	H	97.3	Very high	97.4	Very high	17 Å²	17	73.2 Å²	73.2	8%	0.079	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.7	125	171.9	-173.9	46.5	0	0	0	109.5	K24 R73 V77 H79 L81	K24-H52 PolarHBondContact O-ND1 3.29Å; H52-R73 VanDerWaalsContact NE2-CZ 3.29Å; H52-R73 PolarHBondContact NE2-NH1 3.5Å; H52-R73 VanDerWaalsContact NE2-NH1 3.12Å; H52-V77 HydrophobicContact CB-CG1 3.92Å; H52-H79 PolarHBondContact N-O 2.95Å; H52-L81 PolarHBondContact O-N 3.26Å
53	D	97	Very high	97.3	Very high	9 Å²	9	69.4 Å²	69.4	5%	0.048	35%	0.345	C	S	.	.			trans	-123.2	105.9	173.8	179.5	-4	0	0	0	107	K24 V51 L55 E56 Q57 C58 L81	K24-D53 CarbonylContact C-O 3.2Å; K24-D53 WeakPolarHBondContact CA-O 3.16Å; K24-D53 VanDerWaalsContact CB-O 3.29Å; K24-D53 WeakPolarHBondContact CB-O 3.3Å; K24-D53 PolarHBondContact O-N 3.48Å; V51-D53 PolarHBondContact O-N 3.08Å; D53-L55 VanDerWaalsContact C-N 3.31Å; D53-L55 PolarHBondContact O-N 2.91Å; D53-L55 PolarHBondContact OD1-N 3.11Å; D53-E56 PolarHBondContact OD1-N 3.25Å; D53-E56 WeakPolarHBondContact OD2-CA 3.47Å; D53-Q57 PolarHBondContact OD2-N 2.8Å; D53-C58 WeakPolarHBondContact OD2-CB 3.25Å; D53-C58 PolarHBondContact OD2-N 2.96Å; D53-C58 PolarHBondContact OD2-SG 2.64Å; D53-L81 HydrophobicContact CB-CB 4.49Å; D53-L81 HydrophobicContact CB-CD2 4.24Å
54	A	95.6	Very high	97.4	Very high	56 Å²	56	64.6 Å²	64.6	46%	0.463	33%	0.326	S	S	.	.	S	Bend	trans	-70.5	-29.8	-173.6	0	0	0	0	0	113
55	L	96.8	Very high	97.4	Very high	130 Å²	130	60.5 Å²	60.5	68%	0.681	30%	0.304	S	S	*	.	S	Bend	trans	-105.8	-1	-172.1	-61.7	175.9	0	0	0	112.5	D53 Q57	D53-L55 VanDerWaalsContact C-N 3.31Å; D53-L55 PolarHBondContact O-N 2.91Å; D53-L55 PolarHBondContact OD1-N 3.11Å; L55-Q57 HydrophobicContact CB-CG 3.7Å; L55-Q57 PolarHBondContact O-N 2.91Å
56	E	96.4	Very high	97.3	Very high	98 Å²	98	53.8 Å²	53.8	46%	0.458	28%	0.275	S	S	.	.			trans	53.6	36	-179.7	-60.1	-176.1	168.6	0	0	112.9	K24 D53 C58	K24-E56 HydrophobicContact CG-CG 4.22Å; K24-E56 WeakPolarHBondContact CG-OE1 3.28Å; K24-E56 PolarHBondContact N-OE1 3.05Å; D53-E56 PolarHBondContact OD1-N 3.25Å; D53-E56 WeakPolarHBondContact OD2-CA 3.47Å; E56-C58 VanDerWaalsContact C-N 3.34Å
57	Q	96	Very high	97.3	Very high	101 Å²	101	49.9 Å²	49.9	47%	0.472	26%	0.263	S	S	.	.			trans	-78	-20.7	-176.7	-68.1	176.7	5.5	0	0	112.7	D53 L55 I84 K87	D53-Q57 PolarHBondContact OD2-N 2.8Å; L55-Q57 HydrophobicContact CB-CG 3.7Å; L55-Q57 PolarHBondContact O-N 2.91Å; Q57-I84 HydrophobicContact CB-CD1 3.93Å; Q57-K87 PolarHBondContact O-NZ 2.82Å
58	C	97.2	Very high	97.2	Very high	8 Å²	8	44.8 Å²	44.8	5%	0.054	25%	0.245	C	C	.	.			trans	-65.3	135.8	-178.3	-68.5	0	0	0	0	112	V17 T20 A26 D53 E56 L81	V17-C58 HydrophobicContact CG1-CB 4.48Å; V17-C58 HydrophobicContact CG2-CB 4.24Å; T20-C58 HydrophobicContact CG2-CB 4.21Å; T20-C58 WeakPolarHBondContact CG2-O 3.44Å; A26-C58 HydrophobicContact CB-CB 4.13Å; D53-C58 WeakPolarHBondContact OD2-CB 3.25Å; D53-C58 PolarHBondContact OD2-N 2.96Å; D53-C58 PolarHBondContact OD2-SG 2.64Å; E56-C58 VanDerWaalsContact C-N 3.34Å; C58-L81 WeakPolarHBondContact SG-CD2 3.42Å
59	T	97.8	Very high	97	Very high	55 Å²	55	42.4 Å²	42.4	34%	0.337	23%	0.23	S	C	.	.			trans	-111.9	154.1	167.6	40.1	0	0	0	0	111.1	V17 G61 D62 K87 V88	V17-T59 WeakPolarHBondContact CB-O 3.5Å; V17-T59 WeakPolarHBondContact CG1-O 3.27Å; T59-G61 PolarHBondContact O-N 3.04Å; T59-D62 PolarHBondContact N-OD2 2.86Å; T59-D62 WeakPolarHBondContact O-CB 3.25Å; T59-D62 VanDerWaalsContact O-CG 3.24Å; T59-D62 PolarHBondContact O-N 3.09Å; T59-D62 PolarHBondContact OG1-OD1 3.23Å; T59-D62 PolarHBondContact OG1-OD2 3.12Å; T59-K87 WeakPolarHBondContact OG1-CE 3.14Å; T59-K87 PolarHBondContact OG1-NZ 2.67Å; T59-V88 WeakPolarHBondContact OG1-CG1 3.34Å
60	V	98.1	Very high	96.6	Very high	84 Å²	84	44.9 Å²	44.9	51%	0.509	25%	0.251	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.5	124.6	176.6	179.3	0	0	0	0	109	I18 T20	I18-V60 WeakPolarHBondContact O-CG1 3.49Å; T20-V60 HydrophobicContact CG2-CG2 4.45Å
61	G	97.8	Very high	96.3	Very high	17 Å²	17	47.1 Å²	47.1	18%	0.175	27%	0.269	C	S	.	.	T	Hydrogen-bonded Turn	trans	106.5	-16.8	-178	0	0	0	0	0	115	K16 V17 T59	K16-G61 WeakPolarHBondContact CE-O 3.49Å; V17-G61 PolarHBondContact O-N 3.46Å; T59-G61 PolarHBondContact O-N 3.04Å
62	D	98.3	Very high	95.8	Very high	0 Å²	0	50.1 Å²	50.1	0%	0	29%	0.287	C	S	.	.			trans	-61.4	148.5	178.9	-66.8	-4.7	0	0	0	112	K16 V17 T59 V64 I84 Y86 K87 V88	K16-D62 CarbonylContact C-O 3.48Å; K16-D62 VanDerWaalsContact CA-O 3.3Å; K16-D62 WeakPolarHBondContact CA-O 3.45Å; V17-D62 HydrophobicContact CB-CB 4.47Å; V17-D62 HydrophobicContact CG2-CB 4Å; V17-D62 PolarHBondContact N-O 3.23Å; T59-D62 PolarHBondContact N-OD2 2.86Å; T59-D62 WeakPolarHBondContact O-CB 3.25Å; T59-D62 VanDerWaalsContact O-CG 3.24Å; T59-D62 PolarHBondContact O-N 3.09Å; T59-D62 PolarHBondContact OG1-OD1 3.23Å; T59-D62 PolarHBondContact OG1-OD2 3.12Å; D62-V64 HydrophobicContact CB-CG1 4.07Å; D62-I84 HydrophobicContact CB-CG2 4.32Å; D62-Y86 WeakPolarHBondContact CA-O 3.06Å; D62-K87 IonicContact OD1-NZ 3.99Å; D62-K87 WeakPolarHBondContact OD2-CD 3.49Å; D62-K87 IonicContact OD2-NZ 2.8Å; D62-K87 PolarHBondContact OD2-NZ 2.87Å; D62-V88 WeakPolarHBondContact OD1-CB 3.45Å; D62-V88 VanDerWaalsContact OD1-CG1 3.25Å; D62-V88 WeakPolarHBondContact OD1-CG1 3.46Å; D62-V88 PolarHBondContact OD1-N 2.79Å
63	I	98.1	Very high	95.5	Very high	65 Å²	65	56.8 Å²	56.8	33%	0.333	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	121.5	167	-56.2	-169.9	0	0	0	107.9	I14 G15 V85 Y86	I14-I63 HydrophobicContact CG2-CG2 3.53Å; G15-I63 WeakPolarHBondContact O-CA 3.4Å; I63-V85 HydrophobicContact CG2-CB 4.5Å; I63-V85 PolarHBondContact O-N 2.86Å; I63-Y86 HydrophobicContact CB-CD2 3.96Å; I63-Y86 HydrophobicContact CB-CG 4.49Å; I63-Y86 HydrophobicContact CD1-CD2 3.97Å; I63-Y86 HydrophobicContact CG1-CD2 4.38Å; I63-Y86 HydrophobicContact CG2-CD2 4.14Å; I63-Y86 PolarHBondContact N-O 2.8Å; I63-Y86 PolarHBondContact O-N 3.21Å
64	V	98.3	Very high	95.3	Very high	0 Å²	0	59.5 Å²	59.5	0%	0	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	143.8	-171	-64.3	0	0	0	0	111.4	I14 G15 V17 V28 D62 I66 L81 I84	I14-V64 WeakPolarHBondContact CA-O 3.48Å; G15-V64 PolarHBondContact N-O 3.37Å; G15-V64 WeakPolarHBondContact O-CG2 3.35Å; G15-V64 PolarHBondContact O-N 3.4Å; V17-V64 HydrophobicContact CG2-CB 4.46Å; V17-V64 HydrophobicContact CG2-CG1 3.71Å; V17-V64 HydrophobicContact CG2-CG2 3.84Å; V28-V64 HydrophobicContact CB-CG2 4.5Å; V28-V64 HydrophobicContact CG1-CG2 3.83Å; V28-V64 HydrophobicContact CG2-CG2 3.79Å; D62-V64 HydrophobicContact CB-CG1 4.07Å; V64-I66 HydrophobicContact CG2-CG2 4.04Å; V64-L81 HydrophobicContact CB-CD1 3.7Å; V64-L81 HydrophobicContact CG1-CD1 3.82Å; V64-L81 HydrophobicContact CG2-CD1 4.39Å; V64-I84 HydrophobicContact CG1-CG1 4.18Å; V64-I84 HydrophobicContact CG1-CG2 4.48Å
65	L	98.2	Very high	95.1	Very high	36 Å²	36	64.9 Å²	64.9	19%	0.188	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	122.9	170.1	-178	65.8	0	0	0	108.8	W12 I14 S82 E83 V85	W12-L65 HydrophobicContact CE3-CD1 3.97Å; W12-L65 HydrophobicContact CE3-CD2 3.96Å; W12-L65 HydrophobicContact CE3-CG 3.87Å; W12-L65 HydrophobicContact CZ3-CD2 3.7Å; W12-L65 HydrophobicContact CZ3-CG 3.95Å; I14-L65 HydrophobicContact CD1-CD1 4.47Å; I14-L65 HydrophobicContact CG1-CD1 3.72Å; L65-S82 WeakPolarHBondContact O-CB 3.47Å; L65-S82 PolarHBondContact O-N 2.92Å; L65-E83 HydrophobicContact CB-CB 4.33Å; L65-E83 PolarHBondContact N-O 2.91Å; L65-E83 PolarHBondContact O-N 3.24Å; L65-V85 HydrophobicContact CB-CG2 3.83Å
66	I	97.3	Very high	94.9	Very high	0 Å²	0	64.2 Å²	64.2	0%	0	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	136.8	-177.8	66.4	162.8	0	0	0	110.1	W12 A13 V28 V30 Y49 V51 V64 H79 E80	W12-I66 WeakPolarHBondContact CA-O 3.36Å; A13-I66 HydrophobicContact CB-CD1 4.09Å; A13-I66 HydrophobicContact CB-CG1 3.8Å; A13-I66 PolarHBondContact N-O 3.47Å; A13-I66 WeakPolarHBondContact O-CG1 3.29Å; A13-I66 PolarHBondContact O-N 3.23Å; V28-I66 HydrophobicContact CG1-CG2 4.42Å; V30-I66 HydrophobicContact CG2-CD1 4.02Å; Y49-I66 HydrophobicContact CG-CD1 4.3Å; V51-I66 HydrophobicContact CB-CG2 4.43Å; V51-I66 HydrophobicContact CG1-CG2 3.95Å; V51-I66 HydrophobicContact CG2-CB 4.23Å; V51-I66 HydrophobicContact CG2-CD1 4.3Å; V51-I66 HydrophobicContact CG2-CG2 3.6Å; V64-I66 HydrophobicContact CG2-CG2 4.04Å; I66-H79 HydrophobicContact CB-CB 4.4Å; I66-H79 HydrophobicContact CD1-CB 4.29Å; I66-E80 WeakPolarHBondContact CA-O 3.46Å
67	K	96.3	Very high	94.9	Very high	96 Å²	96	60.2 Å²	60.2	42%	0.417	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	142.4	179.9	-173	-177.6	-177.1	175.4	0	110	T11 W12 H79 E80	T11-K67 CarbonylContact O-C 3.44Å; T11-K67 WeakPolarHBondContact O-CA 3.38Å; W12-K67 HydrophobicContact CD2-CB 4.49Å; W12-K67 HydrophobicContact CD2-CG 4.28Å; W12-K67 HydrophobicContact CE3-CB 3.99Å; W12-K67 HydrophobicContact CE3-CG 4.22Å; W12-K67 HydrophobicContact CH2-CB 4.1Å; W12-K67 HydrophobicContact CH2-CD 3.58Å; W12-K67 HydrophobicContact CH2-CG 3.84Å; W12-K67 HydrophobicContact CZ2-CD 3.73Å; W12-K67 HydrophobicContact CZ2-CG 3.85Å; W12-K67 HydrophobicContact CZ3-CB 3.8Å; W12-K67 HydrophobicContact CZ3-CD 4.16Å; W12-K67 HydrophobicContact CZ3-CG 4.01Å; K67-H79 CarbonylContact O-C 3.48Å; K67-H79 WeakPolarHBondContact O-CA 3.45Å; K67-H79 WeakPolarHBondContact O-CB 3.46Å; K67-E80 PolarHBondContact N-O 3.16Å; K67-E80 PolarHBondContact O-N 3.18Å
68	A	95.8	Very high	94.9	Very high	23 Å²	23	59.8 Å²	59.8	19%	0.19	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.8	134.1	171.4	0	0	0	0	0	111.1	V8 T11	V8-A68 HydrophobicContact CB-CB 4.27Å; V8-A68 HydrophobicContact CG2-CB 4.31Å; T11-A68 PolarHBondContact O-N 3.19Å
69	L	92.8	Very high	94.9	Very high	18 Å²	18	59.6 Å²	59.6	9%	0.094	31%	0.314	C	S	.	.			trans	-73.7	146.7	171.9	-75.3	165.4	0	0	0	110.8	V71 R73 K78 E80	L69-V71 VanDerWaalsContact C-N 3.31Å; L69-V71 VanDerWaalsContact CB-O 3.29Å; L69-V71 WeakPolarHBondContact CB-O 3.3Å; L69-R73 HydrophobicContact CD1-CG 3.74Å; L69-K78 PolarHBondContact N-O 2.97Å; L69-E80 HydrophobicContact CD2-CB 3.72Å; L69-E80 HydrophobicContact CD2-CG 4.41Å; L69-E80 WeakPolarHBondContact CD2-OE2 3.17Å; L69-E80 HydrophobicContact CG-CB 3.93Å
70	S	89.8	Confident	94.8	Very high	79 Å²	79	60.4 Å²	60.4	55%	0.552	31%	0.314	S	S	*	.	S	Bend	trans	-67	-35.3	169.8	54.1	0	0	0	0	111.9	I6	I6-S70 WeakPolarHBondContact CD1-O 3.34Å; I6-S70 VanDerWaalsContact CG1-O 3.28Å; I6-S70 WeakPolarHBondContact CG1-O 3.33Å; I6-S70 PolarHBondContact N-O 3.33Å; I6-S70 VanDerWaalsContact N-O 3.16Å
71	V	88.9	Confident	94.8	Very high	97 Å²	97	57.7 Å²	57.7	59%	0.588	30%	0.297	S	S	*	.	S	Bend	trans	-127.1	132.8	178.3	-176.9	0	0	0	0	110.1	I6 L69 R73	I6-V71 VanDerWaalsContact CD1-C 3.41Å; I6-V71 VanDerWaalsContact CD1-CA 3.42Å; L69-V71 VanDerWaalsContact C-N 3.31Å; L69-V71 VanDerWaalsContact CB-O 3.29Å; L69-V71 WeakPolarHBondContact CB-O 3.3Å; V71-R73 PolarHBondContact O-N 2.89Å
72	T	88.5	Confident	94.8	Very high	63 Å²	63	59.8 Å²	59.8	39%	0.387	31%	0.309	S	S	.	.			trans	-71	126.8	-179.2	44.9	0	0	0	0	108.5	I6 K78	I6-T72 HydrophobicContact CD1-CG2 3.38Å; T72-K78 HydrophobicContact CG2-CG 3.93Å
73	R	90.5	Very high	94.7	Very high	158 Å²	158	65.3 Å²	65.3	60%	0.596	34%	0.335	S	S	*	.	S	Bend	trans	-72.7	-35.8	173.8	-69.3	-107.2	-176.4	160.7	5.1	111.7	H52 L69 V71 V77	H52-R73 VanDerWaalsContact NE2-CZ 3.29Å; H52-R73 PolarHBondContact NE2-NH1 3.5Å; H52-R73 VanDerWaalsContact NE2-NH1 3.12Å; L69-R73 HydrophobicContact CD1-CG 3.74Å; V71-R73 PolarHBondContact O-N 2.89Å; R73-V77 HydrophobicContact CB-CB 4.37Å; R73-V77 HydrophobicContact CB-CG1 4.23Å; R73-V77 PolarHBondContact N-O 3.36Å
74	S	92.1	Very high	94.7	Very high	66 Å²	66	64.1 Å²	64.1	46%	0.462	33%	0.328	S	S	.	.	S	Bend	trans	-152.7	176.6	179.9	-177.8	0	0	0	0	110.3	H76 V77	S74-H76 PolarHBondContact O-N 3.04Å; S74-V77 PolarHBondContact O-N 2.87Å
75	K	92	Very high	94.6	Very high	169 Å²	169	66.4 Å²	66.4	74%	0.735	34%	0.343	S	S	*	.	S	Bend	trans	-52.7	-41.6	178.9	-175.2	177.2	-179.4	178	0	112.7
76	H	93.9	Very high	94.6	Very high	115 Å²	115	68.9 Å²	68.9	53%	0.532	35%	0.35	S	S	.	.	S	Bend	trans	-104.5	-21.1	-175.5	-56.2	109.2	0	0	0	113.8	F50 S74 K78	F50-H76 HydrophobicContact CD2-CB 3.61Å; F50-H76 HydrophobicContact CE2-CB 4.05Å; F50-H76 HydrophobicContact CG-CB 4.39Å; S74-H76 PolarHBondContact O-N 3.04Å; H76-K78 PolarHBondContact O-N 3.19Å
77	V	96.1	Very high	94.6	Very high	14 Å²	14	71.6 Å²	71.6	9%	0.085	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	94.2	-177.7	-172.9	0	0	0	0	109.2	T25 F50 H52 R73 S74	T25-V77 HydrophobicContact CG2-CG2 4.18Å; F50-V77 HydrophobicContact CB-CG2 4Å; H52-V77 HydrophobicContact CB-CG1 3.92Å; R73-V77 HydrophobicContact CB-CB 4.37Å; R73-V77 HydrophobicContact CB-CG1 4.23Å; R73-V77 PolarHBondContact N-O 3.36Å; S74-V77 PolarHBondContact O-N 2.87Å
78	K	95.4	Very high	94.6	Very high	92 Å²	92	70.7 Å²	70.7	40%	0.4	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	-8.3	-179.3	-56.5	-173.1	179.7	-176	0	113.2	L69 T72 H76	L69-K78 PolarHBondContact N-O 2.97Å; T72-K78 HydrophobicContact CG2-CG 3.93Å; H76-K78 PolarHBondContact O-N 3.19Å
79	H	96.9	Very high	94.6	Very high	4 Å²	4	73.4 Å²	73.4	2%	0.019	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	155.9	-176.1	-58.2	-79.6	0	0	0	110.6	A10 Y49 V51 H52 I66 K67	A10-H79 PolarHBondContact O-CE1 3.17Å; A10-H79 VanDerWaalsContact O-CE1 3.24Å; Y49-H79 AromaticContact CD1-CD2 3.42Å; Y49-H79 VanDerWaalsContact CD1-CD2 3.42Å; Y49-H79 WeakPolarHBondContact CD1-CD2 3.5Å; Y49-H79 AromaticContact CD1-NE2 3.15Å; Y49-H79 WeakPolarHBondContact CD1-NE2 3.38Å; Y49-H79 AromaticContact CE1-NE2 3.41Å; Y49-H79 WeakPolarHBondContact CE1-NE2 3.32Å; V51-H79 WeakPolarHBondContact CA-O 3.41Å; V51-H79 HydrophobicContact CG2-CB 4.22Å; H52-H79 PolarHBondContact N-O 2.95Å; I66-H79 HydrophobicContact CB-CB 4.4Å; I66-H79 HydrophobicContact CD1-CB 4.29Å; K67-H79 CarbonylContact O-C 3.48Å; K67-H79 WeakPolarHBondContact O-CA 3.45Å; K67-H79 WeakPolarHBondContact O-CB 3.46Å
80	E	96.5	Very high	94.7	Very high	73 Å²	73	82.2 Å²	82.2	34%	0.341	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	148.7	174.4	-178.7	169.8	-143.9	0	0	109	V51 I66 K67 L69 S82	V51-E80 VanDerWaalsContact CG1-C 3.42Å; I66-E80 WeakPolarHBondContact CA-O 3.46Å; K67-E80 PolarHBondContact N-O 3.16Å; K67-E80 PolarHBondContact O-N 3.18Å; L69-E80 HydrophobicContact CD2-CB 3.72Å; L69-E80 HydrophobicContact CD2-CG 4.41Å; L69-E80 WeakPolarHBondContact CD2-OE2 3.17Å; L69-E80 HydrophobicContact CG-CB 3.93Å; E80-S82 PolarHBondContact O-N 2.96Å
81	L	97.6	Very high	95	Very high	27 Å²	27	80.9 Å²	80.9	14%	0.141	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.2	118.8	172.9	-177.9	69.2	0	0	0	108.3	V51 H52 D53 C58 V64 I84	V51-L81 HydrophobicContact CG1-CB 3.93Å; H52-L81 PolarHBondContact O-N 3.26Å; D53-L81 HydrophobicContact CB-CB 4.49Å; D53-L81 HydrophobicContact CB-CD2 4.24Å; C58-L81 WeakPolarHBondContact SG-CD2 3.42Å; V64-L81 HydrophobicContact CB-CD1 3.7Å; V64-L81 HydrophobicContact CG1-CD1 3.82Å; V64-L81 HydrophobicContact CG2-CD1 4.39Å; L81-I84 HydrophobicContact CD2-CG1 4.38Å
82	S	97.3	Very high	95.3	Very high	61 Å²	61	79.5 Å²	79.5	43%	0.427	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	-50.1	174.3	-169.9	0	0	0	0	110.7	W12 L65 E80	W12-S82 WeakPolarHBondContact CZ3-OG 3.38Å; L65-S82 WeakPolarHBondContact O-CB 3.47Å; L65-S82 PolarHBondContact O-N 2.92Å; E80-S82 PolarHBondContact O-N 2.96Å
83	E	96.6	Very high	95.6	Very high	116 Å²	116	78 Å²	78	54%	0.542	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.6	146.6	-173.4	-171.2	178.5	171.7	0	0	110.3	L65	L65-E83 HydrophobicContact CB-CB 4.33Å; L65-E83 PolarHBondContact N-O 2.91Å; L65-E83 PolarHBondContact O-N 3.24Å
84	I	97.7	Very high	95.8	Very high	39 Å²	39	75.3 Å²	75.3	20%	0.2	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	101	166.6	-58.7	172.6	0	0	0	106.9	Q57 D62 V64 L81 K87	Q57-I84 HydrophobicContact CB-CD1 3.93Å; D62-I84 HydrophobicContact CB-CG2 4.32Å; V64-I84 HydrophobicContact CG1-CG1 4.18Å; V64-I84 HydrophobicContact CG1-CG2 4.48Å; L81-I84 HydrophobicContact CD2-CG1 4.38Å; I84-K87 HydrophobicContact CD1-CD 4.49Å; I84-K87 HydrophobicContact CG2-CB 4.33Å; I84-K87 HydrophobicContact CG2-CD 4.02Å
85	V	97.3	Very high	95.8	Very high	49 Å²	49	79.7 Å²	79.7	30%	0.297	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.4	-46.5	-177.2	-175.4	0	0	0	0	110.4	I63 L65	I63-V85 HydrophobicContact CG2-CB 4.5Å; I63-V85 PolarHBondContact O-N 2.86Å; L65-V85 HydrophobicContact CB-CG2 3.83Å
86	Y	97.5	Very high	95.8	Very high	88 Å²	88	74.3 Å²	74.3	35%	0.345	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.8	116.3	176.5	-56.8	-63.5	0	0	0	110.3	D62 I63 V91	D62-Y86 WeakPolarHBondContact CA-O 3.06Å; I63-Y86 HydrophobicContact CB-CD2 3.96Å; I63-Y86 HydrophobicContact CB-CG 4.49Å; I63-Y86 HydrophobicContact CD1-CD2 3.97Å; I63-Y86 HydrophobicContact CG1-CD2 4.38Å; I63-Y86 HydrophobicContact CG2-CD2 4.14Å; I63-Y86 PolarHBondContact N-O 2.8Å; I63-Y86 PolarHBondContact O-N 3.21Å; Y86-V91 HydrophobicContact CD1-CG1 3.77Å; Y86-V91 HydrophobicContact CE1-CG1 4.31Å
87	K	97.4	Very high	95.7	Very high	57 Å²	57	71.5 Å²	71.5	25%	0.248	40%	0.399	C	S	.	.	B	Isolated β-bridge	trans	-79.2	132.5	174.7	-166.7	71.7	-176.7	165.9	0	109.9	Q57 T59 D62 I84 G89 R90 V91	Q57-K87 PolarHBondContact O-NZ 2.82Å; T59-K87 WeakPolarHBondContact OG1-CE 3.14Å; T59-K87 PolarHBondContact OG1-NZ 2.67Å; D62-K87 IonicContact OD1-NZ 3.99Å; D62-K87 WeakPolarHBondContact OD2-CD 3.49Å; D62-K87 IonicContact OD2-NZ 2.8Å; D62-K87 PolarHBondContact OD2-NZ 2.87Å; I84-K87 HydrophobicContact CD1-CD 4.49Å; I84-K87 HydrophobicContact CG2-CB 4.33Å; I84-K87 HydrophobicContact CG2-CD 4.02Å; K87-G89 PolarHBondContact O-N 2.72Å; K87-R90 HydrophobicContact CB-CB 4.33Å; K87-R90 HydrophobicContact CG-CB 4.36Å; K87-R90 CarbonylContact O-C 3.57Å; K87-R90 PolarHBondContact O-N 2.94Å; K87-V91 WeakPolarHBondContact O-CG2 3.5Å
88	V	96.6	Very high	95.6	Very high	77 Å²	77	72.7 Å²	72.7	47%	0.467	40%	0.403	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.2	126.1	177	70.7	0	0	0	0	110.3	T59 D62 R90	T59-V88 WeakPolarHBondContact OG1-CG1 3.34Å; D62-V88 WeakPolarHBondContact OD1-CB 3.45Å; D62-V88 VanDerWaalsContact OD1-CG1 3.25Å; D62-V88 WeakPolarHBondContact OD1-CG1 3.46Å; D62-V88 PolarHBondContact OD1-N 2.79Å; V88-R90 PolarHBondContact O-N 2.87Å; V88-R90 VanDerWaalsContact O-N 3.16Å
89	G	94.8	Very high	95.5	Very high	79 Å²	79	71.2 Å²	71.2	81%	0.814	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	73.2	-5.6	179.6	0	0	0	0	0	116.3	K87	K87-G89 PolarHBondContact O-N 2.72Å
90	R	94.8	Very high	95.5	Very high	203 Å²	203	72.3 Å²	72.3	77%	0.766	41%	0.411	S	S	*	.	B	Isolated β-bridge	trans	-135.1	60.7	176.8	-64	-174.6	-174.6	-178.7	0.9	109.7	K87 V88	K87-R90 HydrophobicContact CB-CB 4.33Å; K87-R90 HydrophobicContact CG-CB 4.36Å; K87-R90 CarbonylContact O-C 3.57Å; K87-R90 PolarHBondContact O-N 2.94Å; V88-R90 PolarHBondContact O-N 2.87Å; V88-R90 VanDerWaalsContact O-N 3.16Å
91	V	96.6	Very high	95.4	Very high	51 Å²	51	72.1 Å²	72.1	31%	0.309	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.4	130.4	180	178.7	0	0	0	0	108.5	Y86 K87 S99 V100	Y86-V91 HydrophobicContact CD1-CG1 3.77Å; Y86-V91 HydrophobicContact CE1-CG1 4.31Å; K87-V91 WeakPolarHBondContact O-CG2 3.5Å; V91-S99 WeakPolarHBondContact O-CA 3.3Å; V91-V100 PolarHBondContact O-N 3.02Å
92	V	95.8	Very high	95.1	Very high	69 Å²	69	74.5 Å²	74.5	42%	0.418	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	132.4	174	179.1	0	0	0	0	107.5	G97 K98	V92-G97 VanDerWaalsContact CG1-C 3.43Å; V92-G97 VanDerWaalsContact CG1-O 3.3Å; V92-G97 WeakPolarHBondContact CG1-O 3.46Å; V92-K98 WeakPolarHBondContact CA-O 3.46Å
93	D	94.8	Very high	94.8	Very high	32 Å²	32	78.2 Å²	78.2	17%	0.171	47%	0.474	C	S	.	.			trans	-68.9	125	174.8	169.4	31	0	0	0	110	L95 T96 G97 K98 V100 F105	D93-L95 PolarHBondContact O-N 2.9Å; D93-L95 PolarHBondContact OD1-N 2.81Å; D93-L95 VanDerWaalsContact OD1-N 3.09Å; D93-T96 WeakPolarHBondContact CB-OG1 3.43Å; D93-T96 WeakPolarHBondContact OD2-CB 3.18Å; D93-T96 WeakPolarHBondContact OD2-CG2 3.44Å; D93-T96 PolarHBondContact OD2-N 2.76Å; D93-T96 PolarHBondContact OD2-OG1 3.33Å; D93-G97 VanDerWaalsContact O-CA 3.32Å; D93-G97 WeakPolarHBondContact O-CA 3.41Å; D93-G97 PolarHBondContact O-N 2.86Å; D93-K98 PolarHBondContact N-O 2.88Å; D93-V100 HydrophobicContact CB-CG2 3.73Å; D93-F105 HydrophobicContact CB-CE1 4.09Å
94	P	94.2	Very high	94.7	Very high	100 Å²	100	79.5 Å²	79.5	65%	0.649	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	-19	179.2	27	-36.9	0	0	0	114
95	L	92.8	Very high	94.5	Very high	158 Å²	158	80.8 Å²	80.8	83%	0.827	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	-45.9	-179.2	-61	-179.9	0	0	0	112.4	D93	D93-L95 PolarHBondContact O-N 2.9Å; D93-L95 PolarHBondContact OD1-N 2.81Å; D93-L95 VanDerWaalsContact OD1-N 3.09Å
96	T	91.7	Very high	94.2	Very high	57 Å²	57	83 Å²	83	35%	0.35	50%	0.498	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.4	-18.1	-176	58.9	0	0	0	0	114.3	D93 K98 F105	D93-T96 WeakPolarHBondContact CB-OG1 3.43Å; D93-T96 WeakPolarHBondContact OD2-CB 3.18Å; D93-T96 WeakPolarHBondContact OD2-CG2 3.44Å; D93-T96 PolarHBondContact OD2-N 2.76Å; D93-T96 PolarHBondContact OD2-OG1 3.33Å; T96-K98 PolarHBondContact O-N 2.86Å; T96-K98 PolarHBondContact OG1-N 2.81Å; T96-F105 HydrophobicContact CG2-CE1 4.36Å; T96-F105 HydrophobicContact CG2-CZ 4.11Å; T96-F105 VanDerWaalsContact OG1-CE1 3.25Å; T96-F105 WeakPolarHBondContact OG1-CE1 3.42Å
97	G	91.5	Very high	93.8	Very high	55 Å²	55	84.7 Å²	84.7	57%	0.567	51%	0.509	S	S	*	.			trans	70.7	5.2	-174.2	0	0	0	0	0	114.3	V92 D93	V92-G97 VanDerWaalsContact CG1-C 3.43Å; V92-G97 VanDerWaalsContact CG1-O 3.3Å; V92-G97 WeakPolarHBondContact CG1-O 3.46Å; D93-G97 VanDerWaalsContact O-CA 3.32Å; D93-G97 WeakPolarHBondContact O-CA 3.41Å; D93-G97 PolarHBondContact O-N 2.86Å
98	K	92.9	Very high	93.1	Very high	40 Å²	40	86.1 Å²	86.1	17%	0.174	52%	0.524	C	S	.	.			trans	-90.1	154.1	178.7	-68.2	-176.2	175.5	-165.6	0	111.4	V92 D93 T96 F105 L109	V92-K98 WeakPolarHBondContact CA-O 3.46Å; D93-K98 PolarHBondContact N-O 2.88Å; T96-K98 PolarHBondContact O-N 2.86Å; T96-K98 PolarHBondContact OG1-N 2.81Å; K98-F105 HydrophobicContact CB-CD1 3.91Å; K98-F105 HydrophobicContact CB-CE1 4.23Å; K98-L109 HydrophobicContact CD-CD2 3.51Å
99	S	95.2	Very high	92	Very high	61 Å²	61	85.6 Å²	85.6	43%	0.427	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	139.5	177.8	-65.4	0	0	0	0	111.1	V91 V106	V91-S99 WeakPolarHBondContact O-CA 3.3Å; S99-V106 PolarHBondContact O-N 3.19Å
100	V	95.8	Very high	90.9	Very high	26 Å²	26	84.6 Å²	84.6	16%	0.158	50%	0.499	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	138.1	-176	-176.6	0	0	0	0	111	V91 D93 G102 E104 F105	V91-V100 PolarHBondContact O-N 3.02Å; D93-V100 HydrophobicContact CB-CG2 3.73Å; V100-G102 VanDerWaalsContact CG1-O 3.26Å; V100-G102 WeakPolarHBondContact CG1-O 3.38Å; V100-E104 CarbonylContact C-O 3.59Å; V100-E104 WeakPolarHBondContact CA-O 3.15Å; V100-E104 VanDerWaalsContact CG1-O 3.25Å; V100-E104 WeakPolarHBondContact CG1-O 3.49Å; V100-F105 HydrophobicContact CG2-CD1 3.62Å; V100-F105 HydrophobicContact CG2-CE1 3.66Å
101	A	94.4	Very high	89.2	Confident	69 Å²	69	79.1 Å²	79.1	57%	0.57	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.9	91.7	168.2	0	0	0	0	0	109.5	T103 E104 V106	A101-T103 PolarHBondContact O-N 3Å; A101-T103 VanDerWaalsContact O-N 3.11Å; A101-E104 PolarHBondContact N-O 2.85Å; A101-E104 PolarHBondContact O-N 2.84Å; A101-V106 HydrophobicContact CB-CG2 4.37Å
102	G	91.1	Very high	87.4	Confident	78 Å²	78	81.5 Å²	81.5	80%	0.804	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.1	-106.3	-177.9	0	0	0	0	0	111.8	V100	V100-G102 VanDerWaalsContact CG1-O 3.26Å; V100-G102 WeakPolarHBondContact CG1-O 3.38Å
103	T	92.2	Very high	85.5	Confident	139 Å²	139	82 Å²	82	85%	0.853	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.2	-10.2	178.3	44.1	0	0	0	0	113.5	A101	A101-T103 PolarHBondContact O-N 3Å; A101-T103 VanDerWaalsContact O-N 3.11Å
104	E	92.8	Very high	83.6	Confident	143 Å²	143	85.2 Å²	85.2	67%	0.668	52%	0.515	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.9	141.3	-173.3	-64.9	176.1	-172.6	0	0	111.1	V100 A101	V100-E104 CarbonylContact C-O 3.59Å; V100-E104 WeakPolarHBondContact CA-O 3.15Å; V100-E104 VanDerWaalsContact CG1-O 3.25Å; V100-E104 WeakPolarHBondContact CG1-O 3.49Å; A101-E104 PolarHBondContact N-O 2.85Å; A101-E104 PolarHBondContact O-N 2.84Å
105	F	94.4	Very high	81.8	Confident	66 Å²	66	87.3 Å²	87.3	29%	0.289	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.9	139.5	170.6	-68.2	-77.2	0	0	0	110.2	D93 T96 K98 V100 E107 L109	D93-F105 HydrophobicContact CB-CE1 4.09Å; T96-F105 HydrophobicContact CG2-CE1 4.36Å; T96-F105 HydrophobicContact CG2-CZ 4.11Å; T96-F105 VanDerWaalsContact OG1-CE1 3.25Å; T96-F105 WeakPolarHBondContact OG1-CE1 3.42Å; K98-F105 HydrophobicContact CB-CD1 3.91Å; K98-F105 HydrophobicContact CB-CE1 4.23Å; V100-F105 HydrophobicContact CG2-CD1 3.62Å; V100-F105 HydrophobicContact CG2-CE1 3.66Å; F105-E107 VanDerWaalsContact C-N 3.26Å; F105-E107 VanDerWaalsContact CB-O 3.22Å; F105-E107 WeakPolarHBondContact CB-O 3.41Å; F105-E107 PolarHBondContact O-N 3.18Å; F105-L109 HydrophobicContact CD1-CD2 4.37Å; F105-L109 HydrophobicContact CD2-CD1 3.99Å; F105-L109 HydrophobicContact CD2-CD2 4.08Å; F105-L109 HydrophobicContact CD2-CG 3.81Å; F105-L109 HydrophobicContact CE1-CD2 4.42Å; F105-L109 HydrophobicContact CE2-CD1 3.6Å; F105-L109 HydrophobicContact CE2-CD2 4.13Å; F105-L109 HydrophobicContact CE2-CG 3.92Å; F105-L109 HydrophobicContact CG-CD2 4.21Å; F105-L109 HydrophobicContact CG-CG 4.35Å; F105-L109 HydrophobicContact CZ-CD1 4.21Å; F105-L109 HydrophobicContact CZ-CD2 4.3Å
106	V	91.6	Very high	80.3	Confident	95 Å²	95	86.2 Å²	86.2	58%	0.576	51%	0.507	S	S	*	.	S	Bend	trans	-63.9	-39	174.4	177.1	0	0	0	0	110.2	S99 A101	S99-V106 PolarHBondContact O-N 3.19Å; A101-V106 HydrophobicContact CB-CG2 4.37Å
107	E	87.9	Confident	78.7	Confident	124 Å²	124	87.8 Å²	87.8	58%	0.579	51%	0.513	S	S	*	.	S	Bend	trans	-112.6	123.3	173.6	-69.3	173.4	-176.5	0	0	108.9	F105	F105-E107 VanDerWaalsContact C-N 3.26Å; F105-E107 VanDerWaalsContact CB-O 3.22Å; F105-E107 WeakPolarHBondContact CB-O 3.41Å; F105-E107 PolarHBondContact O-N 3.18Å
108	P	82.6	Confident	77.2	Confident	87 Å²	87	89.7 Å²	89.7	57%	0.565	51%	0.509	S	S	*	.			trans	-60.7	146.9	-178.2	24.4	-32.4	0	0	0	111.3	S110	P108-S110 PolarHBondContact O-N 2.99Å; P108-S110 PolarHBondContact O-OG 3.37Å
109	L	74.6	Confident	76	Confident	65 Å²	65	90.2 Å²	90.2	34%	0.34	52%	0.518	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.5	9.7	-178.1	-62.3	-177.2	0	0	0	114.6	K98 F105 D111 L112	K98-L109 HydrophobicContact CD-CD2 3.51Å; F105-L109 HydrophobicContact CD1-CD2 4.37Å; F105-L109 HydrophobicContact CD2-CD1 3.99Å; F105-L109 HydrophobicContact CD2-CD2 4.08Å; F105-L109 HydrophobicContact CD2-CG 3.81Å; F105-L109 HydrophobicContact CE1-CD2 4.42Å; F105-L109 HydrophobicContact CE2-CD1 3.6Å; F105-L109 HydrophobicContact CE2-CD2 4.13Å; F105-L109 HydrophobicContact CE2-CG 3.92Å; F105-L109 HydrophobicContact CG-CD2 4.21Å; F105-L109 HydrophobicContact CG-CG 4.35Å; F105-L109 HydrophobicContact CZ-CD1 4.21Å; F105-L109 HydrophobicContact CZ-CD2 4.3Å; L109-D111 PolarHBondContact O-N 3.05Å; L109-D111 VanDerWaalsContact O-N 3.08Å; L109-L112 PolarHBondContact O-N 2.84Å
110	S	70.3	Confident	74.7	Confident	59 Å²	59	92 Å²	92	41%	0.413	52%	0.522	S	S	.	.	H	α-helix	trans	-55.2	-28	-176.2	28.9	0	0	0	0	114	P108 L112 V113 L114	P108-S110 PolarHBondContact O-N 2.99Å; P108-S110 PolarHBondContact O-OG 3.37Å; S110-L112 PolarHBondContact O-N 3.38Å; S110-V113 PolarHBondContact O-N 3.41Å; S110-L114 PolarHBondContact O-N 2.95Å
111	D	60.2	Low	73.7	Confident	88 Å²	88	93 Å²	93	47%	0.471	53%	0.53	S	S	.	.	H	α-helix	trans	-68.7	-31.8	-175.8	-53.8	-29.6	0	0	0	113.4	L109 V113 L114 E115	L109-D111 PolarHBondContact O-N 3.05Å; L109-D111 VanDerWaalsContact O-N 3.08Å; D111-V113 VanDerWaalsContact C-N 3.33Å; D111-V113 PolarHBondContact O-N 2.82Å; D111-L114 PolarHBondContact O-N 3.15Å; D111-E115 PolarHBondContact O-N 2.83Å
112	L	57.6	Low	72.8	Confident	100 Å²	100	93 Å²	93	52%	0.524	52%	0.521	S	S	.	.	H	α-helix	trans	-69.5	-34.5	177.3	-67.1	175.9	0	0	0	111.8	L109 S110 L114 E116	L109-L112 PolarHBondContact O-N 2.84Å; S110-L112 PolarHBondContact O-N 3.38Å; L112-L114 VanDerWaalsContact C-N 3.34Å; L112-E116 PolarHBondContact O-N 2.92Å
113	V	56.9	Low	72.2	Confident	81 Å²	81	94.8 Å²	94.8	49%	0.491	51%	0.506	S	S	.	.	H	α-helix	trans	-72.8	-30.1	179.2	178.9	0	0	0	0	111	S110 D111 N117	S110-V113 PolarHBondContact O-N 3.41Å; D111-V113 VanDerWaalsContact C-N 3.33Å; D111-V113 PolarHBondContact O-N 2.82Å; V113-N117 WeakPolarHBondContact CG1-ND2 3.44Å; V113-N117 WeakPolarHBondContact O-CB 3.47Å; V113-N117 PolarHBondContact O-N 3Å; V113-N117 PolarHBondContact O-ND2 3.47Å
114	L	55.7	Low	71.4	Confident	98 Å²	98	93.9 Å²	93.9	51%	0.513	50%	0.495	S	S	.	.	H	α-helix	trans	-72.4	-41.4	177.9	-68.9	173.7	0	0	0	112	S110 D111 L112 E116 N117 I118	S110-L114 PolarHBondContact O-N 2.95Å; D111-L114 PolarHBondContact O-N 3.15Å; L112-L114 VanDerWaalsContact C-N 3.34Å; L114-E116 PolarHBondContact O-N 2.83Å; L114-N117 PolarHBondContact O-N 3.22Å; L114-I118 WeakPolarHBondContact O-CB 3.43Å; L114-I118 VanDerWaalsContact O-CD1 3.3Å; L114-I118 WeakPolarHBondContact O-CD1 3.41Å; L114-I118 WeakPolarHBondContact O-CG1 3.48Å; L114-I118 PolarHBondContact O-N 2.87Å
115	E	56.6	Low	70.6	Confident	145 Å²	145	93.6 Å²	93.6	68%	0.678	49%	0.492	S	S	*	.	H	α-helix	trans	-64.8	-40	178.1	-68	-163.1	175.8	0	0	112.7	D111 S119	D111-E115 PolarHBondContact O-N 2.83Å; E115-S119 WeakPolarHBondContact O-CB 3.25Å; E115-S119 PolarHBondContact O-N 3.21Å; E115-S119 VanDerWaalsContact O-N 3.09Å
116	E	59.4	Low	69.4	Low	135 Å²	135	97.5 Å²	97.5	63%	0.631	51%	0.511	S	S	*	.	H	α-helix	trans	-64.2	-43.9	175.1	-72	-176.3	168.3	0	0	111.8	L112 L114 S119 L120	L112-E116 PolarHBondContact O-N 2.92Å; L114-E116 PolarHBondContact O-N 2.83Å; E116-S119 PolarHBondContact O-N 2.94Å; E116-L120 WeakPolarHBondContact O-CG 3.45Å; E116-L120 PolarHBondContact O-N 2.8Å
117	N	58.5	Low	68.3	Low	89 Å²	89	99.5 Å²	99.5	48%	0.476	52%	0.518	S	S	.	.	H	α-helix	trans	-68	-38.2	-179.4	-75.1	-34.4	0	0	0	112.9	V113 L114 L120 S121	V113-N117 WeakPolarHBondContact CG1-ND2 3.44Å; V113-N117 WeakPolarHBondContact O-CB 3.47Å; V113-N117 PolarHBondContact O-N 3Å; V113-N117 PolarHBondContact O-ND2 3.47Å; L114-N117 PolarHBondContact O-N 3.22Å; N117-L120 PolarHBondContact O-N 2.82Å; N117-S121 WeakPolarHBondContact O-CB 3.15Å; N117-S121 PolarHBondContact O-N 3.42Å; N117-S121 PolarHBondContact O-OG 3.46Å
118	I	60.5	Low	67.2	Low	95 Å²	95	100.4 Å²	100.4	49%	0.487	53%	0.527	S	S	.	.	H	α-helix	trans	-63.6	-47.6	175.5	-66.2	160.7	0	0	0	109.3	L114 L120 S121 D122	L114-I118 WeakPolarHBondContact O-CB 3.43Å; L114-I118 VanDerWaalsContact O-CD1 3.3Å; L114-I118 WeakPolarHBondContact O-CD1 3.41Å; L114-I118 WeakPolarHBondContact O-CG1 3.48Å; L114-I118 PolarHBondContact O-N 2.87Å; I118-L120 PolarHBondContact O-N 2.92Å; I118-S121 PolarHBondContact O-N 2.74Å; I118-S121 PolarHBondContact O-OG 2.98Å; I118-D122 WeakPolarHBondContact CG2-OD2 3.29Å; I118-D122 PolarHBondContact O-N 2.92Å
119	S	66.8	Low	65.9	Low	52 Å²	52	103 Å²	103	36%	0.364	53%	0.534	S	S	.	.	H	α-helix	trans	-58.2	-42.4	177.9	-174.2	0	0	0	0	113.4	E115 E116 K123	E115-S119 WeakPolarHBondContact O-CB 3.25Å; E115-S119 PolarHBondContact O-N 3.21Å; E115-S119 VanDerWaalsContact O-N 3.09Å; E116-S119 PolarHBondContact O-N 2.94Å; S119-K123 WeakPolarHBondContact O-CB 3.33Å; S119-K123 VanDerWaalsContact O-CG 3.27Å; S119-K123 WeakPolarHBondContact O-CG 3.35Å; S119-K123 PolarHBondContact O-N 2.95Å; S119-K123 VanDerWaalsContact O-N 3.12Å
120	L	69.1	Low	64.9	Low	99 Å²	99	105.4 Å²	105.4	52%	0.518	56%	0.557	S	S	.	*	H	α-helix	trans	-70.1	-39.2	178	-66.9	-177.8	0	0	0	112	E116 N117 I118 D122 K123 L124	E116-L120 WeakPolarHBondContact O-CG 3.45Å; E116-L120 PolarHBondContact O-N 2.8Å; N117-L120 PolarHBondContact O-N 2.82Å; I118-L120 PolarHBondContact O-N 2.92Å; L120-D122 VanDerWaalsContact C-N 3.34Å; L120-D122 PolarHBondContact O-N 3Å; L120-K123 PolarHBondContact O-N 2.95Å; L120-L124 VanDerWaalsContact O-CG 3.29Å; L120-L124 WeakPolarHBondContact O-CG 3.05Å; L120-L124 PolarHBondContact O-N 3.47Å
121	S	74.1	Confident	64	Low	47 Å²	47	107.4 Å²	107.4	33%	0.329	58%	0.577	S	S	.	*	H	α-helix	trans	-66.8	-35.4	178.5	72.4	0	0	0	0	112.7	N117 I118 L124 K125	N117-S121 WeakPolarHBondContact O-CB 3.15Å; N117-S121 PolarHBondContact O-N 3.42Å; N117-S121 PolarHBondContact O-OG 3.46Å; I118-S121 PolarHBondContact O-N 2.74Å; I118-S121 PolarHBondContact O-OG 2.98Å; S121-L124 PolarHBondContact O-N 3.24Å; S121-K125 WeakPolarHBondContact O-CG 3.29Å; S121-K125 PolarHBondContact O-N 2.85Å
122	D	75.6	Confident	63.2	Low	68 Å²	68	107.5 Å²	107.5	36%	0.364	59%	0.59	S	S	.	*	H	α-helix	trans	-74.8	-39.2	177.5	-66.9	-26.2	0	0	0	111.7	I118 L120 L124 K125 E126	I118-D122 WeakPolarHBondContact CG2-OD2 3.29Å; I118-D122 PolarHBondContact O-N 2.92Å; L120-D122 VanDerWaalsContact C-N 3.34Å; L120-D122 PolarHBondContact O-N 3Å; D122-L124 VanDerWaalsContact C-N 3.3Å; D122-L124 PolarHBondContact O-N 3.23Å; D122-K125 PolarHBondContact O-N 3.48Å; D122-K125 IonicContact OD1-NZ 2.82Å; D122-K125 PolarHBondContact OD1-NZ 3.49Å; D122-E126 PolarHBondContact O-N 3.33Å
123	K	77.9	Confident	62.7	Low	116 Å²	116	108 Å²	108	50%	0.504	60%	0.602	S	S	.	*	H	α-helix	trans	-59.5	-37.9	170.2	-74.5	172.5	-176.1	173.5	0	112.8	S119 L120 E126 L127	S119-K123 WeakPolarHBondContact O-CB 3.33Å; S119-K123 VanDerWaalsContact O-CG 3.27Å; S119-K123 WeakPolarHBondContact O-CG 3.35Å; S119-K123 PolarHBondContact O-N 2.95Å; S119-K123 VanDerWaalsContact O-N 3.12Å; L120-K123 PolarHBondContact O-N 2.95Å; K123-E126 PolarHBondContact O-N 3.12Å; K123-L127 WeakPolarHBondContact O-CG 3.28Å; K123-L127 PolarHBondContact O-N 3.31Å
124	L	75.4	Confident	62	Low	119 Å²	119	110.2 Å²	110.2	62%	0.623	62%	0.621	S	S	*	*	H	α-helix	trans	-69.9	-32.1	177.2	-74.5	170.2	0	0	0	112.8	L120 S121 D122 L127	L120-L124 VanDerWaalsContact O-CG 3.29Å; L120-L124 WeakPolarHBondContact O-CG 3.05Å; L120-L124 PolarHBondContact O-N 3.47Å; S121-L124 PolarHBondContact O-N 3.24Å; D122-L124 VanDerWaalsContact C-N 3.3Å; D122-L124 PolarHBondContact O-N 3.23Å; L124-L127 HydrophobicContact CD2-CD1 4.5Å; L124-L127 PolarHBondContact O-N 3.33Å
125	K	75.9	Confident	61.5	Low	138 Å²	138	110.4 Å²	110.4	60%	0.6	64%	0.637	S	S	*	*	H	α-helix	trans	-69	-37.7	175.2	-69.6	166.9	-163.2	157	0	111.9	S121 D122 L127 N128	S121-K125 WeakPolarHBondContact O-CG 3.29Å; S121-K125 PolarHBondContact O-N 2.85Å; D122-K125 PolarHBondContact O-N 3.48Å; D122-K125 IonicContact OD1-NZ 2.82Å; D122-K125 PolarHBondContact OD1-NZ 3.49Å; K125-L127 VanDerWaalsContact C-N 3.27Å; K125-L127 PolarHBondContact O-N 3.4Å; K125-N128 PolarHBondContact O-N 3.16Å
126	E	70.5	Confident	60.9	Low	148 Å²	148	108.3 Å²	108.3	69%	0.692	64%	0.644	S	S	*	*	H	α-helix	trans	-65.5	-29.3	177	-70.4	178	178.4	0	0	112.9	D122 K123 N128	D122-E126 PolarHBondContact O-N 3.33Å; K123-E126 PolarHBondContact O-N 3.12Å; E126-N128 VanDerWaalsContact C-N 3.31Å; E126-N128 PolarHBondContact O-N 3.03Å
127	L	67.6	Low	59.9	Low	136 Å²	136	109 Å²	109	71%	0.712	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	-12	179.3	-68.1	169.5	0	0	0	114	K123 L124 K125 I129	K123-L127 WeakPolarHBondContact O-CG 3.28Å; K123-L127 PolarHBondContact O-N 3.31Å; L124-L127 HydrophobicContact CD2-CD1 4.5Å; L124-L127 PolarHBondContact O-N 3.33Å; K125-L127 VanDerWaalsContact C-N 3.27Å; K125-L127 PolarHBondContact O-N 3.4Å; L127-I129 PolarHBondContact O-N 3.16Å
128	N	64.5	Low	58.9	Low	144 Å²	144	109.3 Å²	109.3	77%	0.77	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.8	16.8	-175.4	-130.8	29	0	0	0	114.2	K125 E126	K125-N128 PolarHBondContact O-N 3.16Å; E126-N128 VanDerWaalsContact C-N 3.31Å; E126-N128 PolarHBondContact O-N 3.03Å
129	I	57.2	Low	58.4	Low	140 Å²	140	110.1 Å²	110.1	72%	0.718	67%	0.672	S	S	*	*			trans	-90.5	112.2	169.1	-57.6	169.2	0	0	0	107.3	L127	L127-I129 PolarHBondContact O-N 3.16Å
130	S	53.2	Low	57.9	Low	116 Å²	116	113 Å²	113	81%	0.811	69%	0.693	S	S	*	*			trans	118.1	41.9	167.8	-44.2	0	0	0	0	117
131	A	50	Low	56.7	Low	102 Å²	102	115 Å²	115	84%	0.843	71%	0.709	S	S	*	*			trans	-117.5	55.8	152.1	0	0	0	0	0	109.7
132	A	43.3	Very low	55.5	Low	89 Å²	89	121.5 Å²	121.5	74%	0.736	73%	0.734	S	S	*	*			trans	-86.7	116.9	165.8	0	0	0	0	0	109.3
133	S	49	Very low	54.2	Low	112 Å²	112	124.7 Å²	124.7	78%	0.783	76%	0.756	S	S	*	*			trans	48.4	108.6	147	62.4	0	0	0	0	119.6
134	S	40.4	Very low	52.9	Low	126 Å²	126	125.1 Å²	125.1	88%	0.881	77%	0.771	S	S	*	*			trans	-135.9	105.7	133.2	53.2	0	0	0	0	109.8
135	A	46.4	Very low	51.4	Low	103 Å²	103	125.8 Å²	125.8	85%	0.851	78%	0.78	S	S	*	*			trans	-81.9	131.3	164.9	0	0	0	0	0	109.3
136	A	42.9	Very low	50.4	Low	100 Å²	100	128.3 Å²	128.3	83%	0.826	82%	0.815	S	S	*	*			trans	166	138.5	159.7	0	0	0	0	0	106.2
137	D	38.9	Very low	49.3	Very low	150 Å²	150	127.4 Å²	127.4	80%	0.802	82%	0.821	S	S	*	*			cis	-165.6	161	1.1	-168.1	-6.9	0	0	0	105.9
138	S	38.6	Very low	48.4	Very low	95 Å²	95	126.9 Å²	126.9	66%	0.664	83%	0.827	S	S	*	*			trans	-53.9	-178.5	-178.4	62.8	0	0	0	0	117.4
139	P	48.4	Very low	47.5	Very low	112 Å²	112	125.9 Å²	125.9	73%	0.727	83%	0.83	S	S	*	*			cis	-139.4	177.9	9.9	38.4	-15.9	0	0	0	117.9
140	S	57.1	Low	46.9	Very low	114 Å²	114	125.1 Å²	125.1	80%	0.797	84%	0.837	S	S	*	*			trans	-69.8	140	175.7	44.6	0	0	0	0	114
141	V	43.8	Very low	46.5	Very low	141 Å²	141	125.7 Å²	125.7	86%	0.855	84%	0.838	S	S	*	*			trans	-124.6	125.4	167.2	175.6	0	0	0	0	109.3
142	Q	49.8	Very low	46.3	Very low	182 Å²	182	127.3 Å²	127.3	85%	0.85	84%	0.838	S	S	*	*	P	Polyproline II helix	trans	-74.2	143.9	-178.9	-62.4	170.9	-14.1	0	0	111.5
143	T	46.5	Very low	46.5	Very low	136 Å²	136	130 Å²	130	83%	0.834	85%	0.845	S	S	*	*	P	Polyproline II helix	trans	-89.9	135.2	165.7	30.8	0	0	0	0	110.5
144	P	50.5	Low	46.3	Very low	124 Å²	124	131.4 Å²	131.4	81%	0.805	85%	0.85	S	S	*	*	P	Polyproline II helix	trans	-87.2	133.4	169.3	32.7	-27.8	0	0	0	110.4
145	T	45.4	Very low	46.8	Very low	133 Å²	133	131.8 Å²	131.8	82%	0.816	85%	0.848	S	S	*	*	P	Polyproline II helix	trans	-71.2	136.5	167.8	-25.8	0	0	0	0	110.2
146	S	53.5	Low	46.9	Very low	192 Å²	192	134.5 Å²	134.5	100%	1.343	85%	0.847	S	S	*	*			trans	-157.2	0	148.2	-67.9	0	0	0	0	108.4

Retrieved 146 of 146 residues in 96.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).