A0A087XY55_POEFO Loading...

Progonadoliberin

Stimulates the secretion of gonadotropins.

AlphaFold DB , UniProt , Accession A0A087XY55, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 86 aa.

						>A0A087XY55_POEFO|A0A087XY55
VSVMSRLILLLVLLMCVSAQLSDAQHWSHGWYPGGKRELDSFGASEMSEEIKLCEAGECSYLRPQRRNTLRNIVLDALARELQKRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	V	60.5	Low	86.9	Confident	133 Å²	133	105 Å²	105	81%	0.806	56%	0.563	S	S	*	*				0	109	0	-173.6	0	0	0	0	108.2	R6	V1-R6 HydrophobicContact CG1-CG 3.96Å
2	S	84.2	Confident	87.5	Confident	71 Å²	71	103.4 Å²	103.4	50%	0.497	56%	0.56	S	S	.	*			trans	-58.1	152.4	-178.8	171.7	0	0	0	0	111.3	M4 S5 R6	S2-M4 PolarHBondContact O-N 3.5Å; S2-M4 PolarHBondContact OG-N 3.36Å; S2-S5 WeakPolarHBondContact O-CB 3.31Å; S2-S5 PolarHBondContact O-N 3.49Å; S2-R6 PolarHBondContact O-N 3.04Å; S2-R6 VanDerWaalsContact O-N 3.08Å
3	V	82.9	Confident	87.9	Confident	111 Å²	111	104.5 Å²	104.5	67%	0.673	56%	0.564	S	S	*	*	H	α-helix	trans	-53.4	-35.7	174.9	178.3	0	0	0	0	110.9	R6 L7	V3-R6 PolarHBondContact O-N 3.45Å; V3-L7 PolarHBondContact O-N 3.12Å
4	M	84.8	Confident	88.2	Confident	105 Å²	105	105.7 Å²	105.7	52%	0.517	57%	0.569	S	S	.	*	H	α-helix	trans	-64.9	-42.4	174.3	-70.3	-61.7	89.5	0	0	113.3	S2 R6 L7 I8	S2-M4 PolarHBondContact O-N 3.5Å; S2-M4 PolarHBondContact OG-N 3.36Å; M4-R6 VanDerWaalsContact C-N 3.28Å; M4-R6 PolarHBondContact O-N 3.34Å; M4-L7 HydrophobicContact CE-CB 4.28Å; M4-L7 HydrophobicContact CE-CD2 3.7Å; M4-L7 PolarHBondContact O-N 2.8Å; M4-L7 HydrophobicContact SD-CD2 4.43Å; M4-I8 WeakPolarHBondContact O-CD1 3.34Å; M4-I8 VanDerWaalsContact O-CG1 3.23Å; M4-I8 WeakPolarHBondContact O-CG1 3.43Å; M4-I8 PolarHBondContact O-N 3.3Å
5	S	86.4	Confident	88.2	Confident	52 Å²	52	106.9 Å²	106.9	36%	0.364	57%	0.572	S	S	.	*	H	α-helix	trans	-63.6	-36.1	175	-54	0	0	0	0	111.8	S2 L9	S2-S5 WeakPolarHBondContact O-CB 3.31Å; S2-S5 PolarHBondContact O-N 3.49Å; S5-L9 WeakPolarHBondContact O-CB 3.42Å; S5-L9 WeakPolarHBondContact O-CD1 3.36Å; S5-L9 WeakPolarHBondContact O-CG 3.39Å; S5-L9 PolarHBondContact O-N 3.36Å
6	R	91.2	Very high	88.1	Confident	153 Å²	153	104.6 Å²	104.6	58%	0.577	57%	0.565	S	S	*	*	H	α-helix	trans	-67.8	-41.1	175.8	-64.1	179.5	-178.3	-100.5	5.7	111.9	V1 S2 V3 M4 L9 L10	V1-R6 HydrophobicContact CG1-CG 3.96Å; S2-R6 PolarHBondContact O-N 3.04Å; S2-R6 VanDerWaalsContact O-N 3.08Å; V3-R6 PolarHBondContact O-N 3.45Å; M4-R6 VanDerWaalsContact C-N 3.28Å; M4-R6 PolarHBondContact O-N 3.34Å; R6-L9 PolarHBondContact O-N 3.04Å; R6-L10 WeakPolarHBondContact O-CG 3.23Å; R6-L10 PolarHBondContact O-N 3.46Å
7	L	91.8	Very high	87.8	Confident	90 Å²	90	103.1 Å²	103.1	47%	0.471	56%	0.56	S	S	.	*	H	α-helix	trans	-63.2	-45.5	176.9	-174.6	67.8	0	0	0	111.4	V3 M4 L9 L10 L11	V3-L7 PolarHBondContact O-N 3.12Å; M4-L7 HydrophobicContact CE-CB 4.28Å; M4-L7 HydrophobicContact CE-CD2 3.7Å; M4-L7 PolarHBondContact O-N 2.8Å; M4-L7 HydrophobicContact SD-CD2 4.43Å; L7-L9 PolarHBondContact O-N 3.48Å; L7-L10 PolarHBondContact O-N 3.38Å; L7-L11 WeakPolarHBondContact O-CB 3.48Å; L7-L11 PolarHBondContact O-N 3.04Å
8	I	93.8	Very high	87.3	Confident	106 Å²	106	100.3 Å²	100.3	54%	0.544	55%	0.55	S	S	.	*	H	α-helix	trans	-60.8	-45.6	177.1	-67.3	164	0	0	0	110.6	M4 L10 L11 V12	M4-I8 WeakPolarHBondContact O-CD1 3.34Å; M4-I8 VanDerWaalsContact O-CG1 3.23Å; M4-I8 WeakPolarHBondContact O-CG1 3.43Å; M4-I8 PolarHBondContact O-N 3.3Å; I8-L10 PolarHBondContact O-N 3.34Å; I8-L11 WeakPolarHBondContact O-CB 3.31Å; I8-L11 PolarHBondContact O-N 3.39Å; I8-V12 WeakPolarHBondContact O-CG2 3.49Å; I8-V12 PolarHBondContact O-N 2.81Å
9	L	92.8	Very high	86.6	Confident	107 Å²	107	98.3 Å²	98.3	56%	0.56	55%	0.548	S	S	*	.	H	α-helix	trans	-60.7	-43.3	177.4	-73.8	168.8	0	0	0	112.2	S5 R6 L7 V12 L13	S5-L9 WeakPolarHBondContact O-CB 3.42Å; S5-L9 WeakPolarHBondContact O-CD1 3.36Å; S5-L9 WeakPolarHBondContact O-CG 3.39Å; S5-L9 PolarHBondContact O-N 3.36Å; R6-L9 PolarHBondContact O-N 3.04Å; L7-L9 PolarHBondContact O-N 3.48Å; L9-V12 PolarHBondContact O-N 3.42Å; L9-L13 PolarHBondContact O-N 3.46Å
10	L	93.8	Very high	85.8	Confident	119 Å²	119	97.2 Å²	97.2	62%	0.623	54%	0.538	S	S	*	.	H	α-helix	trans	-63.1	-41.3	175.7	-75.7	168.3	0	0	0	111.9	R6 L7 I8 L13 L14	R6-L10 WeakPolarHBondContact O-CG 3.23Å; R6-L10 PolarHBondContact O-N 3.46Å; L7-L10 PolarHBondContact O-N 3.38Å; I8-L10 PolarHBondContact O-N 3.34Å; L10-L13 PolarHBondContact O-N 3.23Å; L10-L14 WeakPolarHBondContact O-CB 3.47Å; L10-L14 PolarHBondContact O-N 2.97Å
11	L	93.9	Very high	84.9	Confident	108 Å²	108	98 Å²	98	57%	0.565	54%	0.541	S	S	*	.	H	α-helix	trans	-61.9	-46.5	177.9	-139	89.2	0	0	0	111.3	L7 I8 L14 M15	L7-L11 WeakPolarHBondContact O-CB 3.48Å; L7-L11 PolarHBondContact O-N 3.04Å; I8-L11 WeakPolarHBondContact O-CB 3.31Å; I8-L11 PolarHBondContact O-N 3.39Å; L11-L14 PolarHBondContact O-N 3.37Å; L11-M15 VanDerWaalsContact O-CG 3.27Å; L11-M15 WeakPolarHBondContact O-CG 3.46Å; L11-M15 PolarHBondContact O-N 2.89Å
12	V	93.5	Very high	85	Confident	86 Å²	86	95.6 Å²	95.6	52%	0.521	53%	0.53	S	S	.	.	H	α-helix	trans	-61.9	-45.4	177.5	172.1	0	0	0	0	110.6	I8 L9 L14 M15 C16	I8-V12 WeakPolarHBondContact O-CG2 3.49Å; I8-V12 PolarHBondContact O-N 2.81Å; L9-V12 PolarHBondContact O-N 3.42Å; V12-L14 VanDerWaalsContact C-N 3.32Å; V12-L14 PolarHBondContact O-N 3.11Å; V12-M15 PolarHBondContact O-N 3.36Å; V12-C16 PolarHBondContact O-N 2.98Å; V12-C16 PolarHBondContact O-SG 2.94Å
13	L	93.3	Very high	83.6	Confident	117 Å²	117	98.7 Å²	98.7	61%	0.613	54%	0.542	S	S	*	.	H	α-helix	trans	-59.2	-45	177	-122.5	112.7	0	0	0	111.6	L9 L10 M15 C16 V17	L9-L13 PolarHBondContact O-N 3.46Å; L10-L13 PolarHBondContact O-N 3.23Å; L13-M15 VanDerWaalsContact C-N 3.34Å; L13-M15 PolarHBondContact O-N 2.95Å; L13-C16 PolarHBondContact O-N 3.27Å; L13-V17 WeakPolarHBondContact O-CG2 3.21Å; L13-V17 PolarHBondContact O-N 3.45Å
14	L	91.9	Very high	82.3	Confident	122 Å²	122	97.2 Å²	97.2	64%	0.639	54%	0.541	S	S	*	.	H	α-helix	trans	-62.9	-42.1	179.8	-170.7	65.1	0	0	0	111.4	L10 L11 V12 V17 S18	L10-L14 WeakPolarHBondContact O-CB 3.47Å; L10-L14 PolarHBondContact O-N 2.97Å; L11-L14 PolarHBondContact O-N 3.37Å; V12-L14 VanDerWaalsContact C-N 3.32Å; V12-L14 PolarHBondContact O-N 3.11Å; L14-V17 PolarHBondContact O-N 3.19Å; L14-S18 WeakPolarHBondContact O-CB 3.35Å; L14-S18 PolarHBondContact O-N 3.06Å; L14-S18 PolarHBondContact O-OG 2.96Å
15	M	88.3	Confident	80.8	Confident	124 Å²	124	98.4 Å²	98.4	61%	0.611	55%	0.545	S	S	*	.	H	α-helix	trans	-64.2	-40.1	175.7	-70	-63.7	-66.6	0	0	112.6	L11 V12 L13 V17 S18 A19	L11-M15 VanDerWaalsContact O-CG 3.27Å; L11-M15 WeakPolarHBondContact O-CG 3.46Å; L11-M15 PolarHBondContact O-N 2.89Å; V12-M15 PolarHBondContact O-N 3.36Å; L13-M15 VanDerWaalsContact C-N 3.34Å; L13-M15 PolarHBondContact O-N 2.95Å; M15-V17 VanDerWaalsContact C-N 3.35Å; M15-S18 WeakPolarHBondContact CA-OG 3.39Å; M15-S18 PolarHBondContact O-OG 3.29Å; M15-A19 VanDerWaalsContact O-CB 3.3Å; M15-A19 WeakPolarHBondContact O-CB 3.13Å; M15-A19 PolarHBondContact O-N 2.96Å
16	C	86.4	Confident	78.9	Confident	69 Å²	69	102.5 Å²	102.5	47%	0.466	56%	0.558	S	S	.	*	H	α-helix	trans	-67.1	-36	176.1	-67.6	0	0	0	0	112.4	V12 L13 Q20	V12-C16 PolarHBondContact O-N 2.98Å; V12-C16 PolarHBondContact O-SG 2.94Å; L13-C16 PolarHBondContact O-N 3.27Å; C16-Q20 VanDerWaalsContact O-CG 3.29Å; C16-Q20 WeakPolarHBondContact O-CG 3.29Å; C16-Q20 PolarHBondContact O-N 3.38Å; C16-Q20 PolarHBondContact O-NE2 3.15Å
17	V	84.1	Confident	76.7	Confident	79 Å²	79	104.9 Å²	104.9	48%	0.479	57%	0.567	S	S	.	*	H	α-helix	trans	-72	-44.5	176.3	172.8	0	0	0	0	110.5	L13 L14 M15 Q20 L21	L13-V17 WeakPolarHBondContact O-CG2 3.21Å; L13-V17 PolarHBondContact O-N 3.45Å; L14-V17 PolarHBondContact O-N 3.19Å; M15-V17 VanDerWaalsContact C-N 3.35Å; V17-Q20 PolarHBondContact O-N 3.43Å; V17-L21 WeakPolarHBondContact O-CB 3.36Å; V17-L21 PolarHBondContact O-N 2.86Å
18	S	77.9	Confident	74.8	Confident	54 Å²	54	104 Å²	104	38%	0.378	57%	0.569	S	S	.	*	H	α-helix	trans	-65.7	-39.1	179.9	64	0	0	0	0	112.5	L14 M15 Q20 L21 S22	L14-S18 WeakPolarHBondContact O-CB 3.35Å; L14-S18 PolarHBondContact O-N 3.06Å; L14-S18 PolarHBondContact O-OG 2.96Å; M15-S18 WeakPolarHBondContact CA-OG 3.39Å; M15-S18 PolarHBondContact O-OG 3.29Å; S18-Q20 VanDerWaalsContact C-N 3.33Å; S18-Q20 PolarHBondContact O-N 3.41Å; S18-L21 PolarHBondContact O-N 3.28Å; S18-S22 VanDerWaalsContact O-CB 3.27Å; S18-S22 WeakPolarHBondContact O-CB 3.22Å; S18-S22 PolarHBondContact O-N 3.08Å
19	A	74.8	Confident	72.8	Confident	62 Å²	62	107 Å²	107	51%	0.512	58%	0.58	S	S	.	*	H	α-helix	trans	-60.7	-42.4	174.3	0	0	0	0	0	111.9	M15 S22 D23	M15-A19 VanDerWaalsContact O-CB 3.3Å; M15-A19 WeakPolarHBondContact O-CB 3.13Å; M15-A19 PolarHBondContact O-N 2.96Å; A19-S22 PolarHBondContact O-N 3.38Å; A19-D23 PolarHBondContact O-N 2.88Å
20	Q	70.6	Confident	71.1	Confident	75 Å²	75	105.1 Å²	105.1	35%	0.35	59%	0.587	S	S	.	*	H	α-helix	trans	-70.8	-33.8	176.9	-70.8	-178.1	97.7	0	0	112.9	C16 V17 S18 A24 L70	C16-Q20 VanDerWaalsContact O-CG 3.29Å; C16-Q20 WeakPolarHBondContact O-CG 3.29Å; C16-Q20 PolarHBondContact O-N 3.38Å; C16-Q20 PolarHBondContact O-NE2 3.15Å; V17-Q20 PolarHBondContact O-N 3.43Å; S18-Q20 VanDerWaalsContact C-N 3.33Å; S18-Q20 PolarHBondContact O-N 3.41Å; Q20-A24 PolarHBondContact O-N 3.16Å; Q20-A24 VanDerWaalsContact O-N 3.12Å; Q20-L70 VanDerWaalsContact OE1-CD2 3.27Å
21	L	66.8	Low	68.9	Low	114 Å²	114	109.9 Å²	109.9	60%	0.597	60%	0.597	S	S	*	*	H	α-helix	trans	-74.5	-32.6	176	-150.4	71.4	0	0	0	111.4	V17 S18 A24 Q25	V17-L21 WeakPolarHBondContact O-CB 3.36Å; V17-L21 PolarHBondContact O-N 2.86Å; S18-L21 PolarHBondContact O-N 3.28Å; L21-A24 CarbonylContact O-C 3.43Å; L21-A24 PolarHBondContact O-N 2.95Å; L21-Q25 WeakPolarHBondContact O-CB 3.27Å; L21-Q25 WeakPolarHBondContact O-CG 3.3Å; L21-Q25 PolarHBondContact O-N 3.5Å
22	S	61.7	Low	66.6	Low	83 Å²	83	114.6 Å²	114.6	58%	0.58	61%	0.608	S	S	*	*	H	α-helix	trans	-67.2	-35.7	172.5	-169.8	0	0	0	0	111.9	S18 A19 A24 Q25 H26	S18-S22 VanDerWaalsContact O-CB 3.27Å; S18-S22 WeakPolarHBondContact O-CB 3.22Å; S18-S22 PolarHBondContact O-N 3.08Å; A19-S22 PolarHBondContact O-N 3.38Å; S22-A24 VanDerWaalsContact C-N 3.33Å; S22-Q25 CarbonylContact O-C 3.14Å; S22-Q25 PolarHBondContact O-N 3.4Å; S22-H26 PolarHBondContact O-N 3.29Å
23	D	56	Low	64.8	Low	137 Å²	137	115.9 Å²	115.9	73%	0.733	62%	0.619	S	S	*	*	H	α-helix	trans	-66.2	-36.4	171.1	-170.7	47	0	0	0	111.4	A19 Q25 H26	A19-D23 PolarHBondContact O-N 2.88Å; D23-Q25 VanDerWaalsContact C-N 3.29Å; D23-Q25 PolarHBondContact O-N 2.9Å; D23-H26 PolarHBondContact O-N 2.95Å
24	A	54.1	Low	63.4	Low	80 Å²	80	113.9 Å²	113.9	66%	0.661	63%	0.626	S	S	*	*	H	α-helix	trans	-75.8	-14.9	171.2	0	0	0	0	0	114	Q20 L21 S22	Q20-A24 PolarHBondContact O-N 3.16Å; Q20-A24 VanDerWaalsContact O-N 3.12Å; L21-A24 CarbonylContact O-C 3.43Å; L21-A24 PolarHBondContact O-N 2.95Å; S22-A24 VanDerWaalsContact C-N 3.33Å
25	Q	53.3	Low	61.4	Low	129 Å²	129	111.5 Å²	111.5	60%	0.603	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.9	41.6	173.7	-66.4	-90	-53.1	0	0	109.1	L21 S22 D23 W27	L21-Q25 WeakPolarHBondContact O-CB 3.27Å; L21-Q25 WeakPolarHBondContact O-CG 3.3Å; L21-Q25 PolarHBondContact O-N 3.5Å; S22-Q25 CarbonylContact O-C 3.14Å; S22-Q25 PolarHBondContact O-N 3.4Å; D23-Q25 VanDerWaalsContact C-N 3.29Å; D23-Q25 PolarHBondContact O-N 2.9Å; Q25-W27 PolarHBondContact O-N 3.28Å
26	H	47.8	Very low	59.7	Low	138 Å²	138	115.1 Å²	115.1	64%	0.639	64%	0.644	S	S	*	*			trans	-66	97.9	159.2	-169.4	74.4	0	0	0	106.3	S22 D23 S28 H29	S22-H26 PolarHBondContact O-N 3.29Å; D23-H26 PolarHBondContact O-N 2.95Å; H26-S28 PolarHBondContact O-N 3.42Å; H26-H29 AromaticContact CE1-CD2 3.7Å; H26-H29 AromaticContact NE2-CD2 3.9Å
27	W	45.2	Very low	58.4	Low	203 Å²	203	122.3 Å²	122.3	77%	0.769	66%	0.661	S	S	*	*			trans	-44.2	130.5	166.1	-72.1	23.7	0	0	0	106.5	Q25 H29	Q25-W27 PolarHBondContact O-N 3.28Å; W27-H29 PolarHBondContact O-N 3.26Å
28	S	51.7	Low	56.9	Low	73 Å²	73	127 Å²	127	51%	0.51	68%	0.678	S	S	.	*			trans	-60.4	95.1	172.3	46.4	0	0	0	0	107.5	H26 G30 W31	H26-S28 PolarHBondContact O-N 3.42Å; S28-G30 PolarHBondContact O-N 3.45Å; S28-W31 PolarHBondContact OG-NE1 3.3Å
29	H	52.2	Low	55.3	Low	168 Å²	168	132.1 Å²	132.1	78%	0.778	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	69	174.3	-91.7	-83	0	0	0	109.4	H26 W27	H26-H29 AromaticContact CE1-CD2 3.7Å; H26-H29 AromaticContact NE2-CD2 3.9Å; W27-H29 PolarHBondContact O-N 3.26Å
30	G	56.7	Low	53.8	Low	68 Å²	68	135 Å²	135	70%	0.701	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	162.6	10.4	-179.2	0	0	0	0	0	117.8	S28 Y32	S28-G30 PolarHBondContact O-N 3.45Å; G30-Y32 PolarHBondContact O-N 2.96Å
31	W	46.1	Very low	53	Low	218 Å²	218	136.4 Å²	136.4	83%	0.826	73%	0.725	S	S	*	*			trans	-79.3	88.4	162.4	-68.4	62.9	0	0	0	107	S28 P33	S28-W31 PolarHBondContact OG-NE1 3.3Å; W31-P33 VanDerWaalsContact O-CD 3.31Å; W31-P33 WeakPolarHBondContact O-CD 3.49Å
32	Y	46.7	Very low	51.7	Low	207 Å²	207	141.3 Å²	141.3	81%	0.812	74%	0.742	S	S	*	*			trans	-60.2	117.1	161.8	-152.5	-92.6	0	0	0	106.7	G30 G34	G30-Y32 PolarHBondContact O-N 2.96Å; Y32-G34 PolarHBondContact O-N 2.91Å
33	P	54.6	Low	50.4	Low	113 Å²	113	140.9 Å²	140.9	73%	0.734	75%	0.751	S	S	*	*	S	Bend	trans	-70.4	120.1	-178.4	28.6	-29.9	0	0	0	107.9	W31	W31-P33 VanDerWaalsContact O-CD 3.31Å; W31-P33 WeakPolarHBondContact O-CD 3.49Å
34	G	64.7	Low	49.9	Very low	75 Å²	75	139.5 Å²	139.5	77%	0.773	76%	0.759	S	S	*	*			trans	71.9	75.2	167.6	0	0	0	0	0	115.7	Y32 K36	Y32-G34 PolarHBondContact O-N 2.91Å; G34-K36 PolarHBondContact O-N 3.29Å
35	G	49.7	Very low	49.1	Very low	73 Å²	73	141.3 Å²	141.3	75%	0.753	77%	0.766	S	S	*	*			trans	-87.5	98.3	164.6	0	0	0	0	0	111.2	R37	G35-R37 PolarHBondContact O-N 3.48Å
36	K	52.2	Low	48.4	Very low	200 Å²	200	144 Å²	144	87%	0.87	78%	0.779	S	S	*	*			trans	-68.1	117.5	159.3	-166.9	-177.1	-178.1	-169.8	0	106.9	G34	G34-K36 PolarHBondContact O-N 3.29Å
37	R	60.5	Low	48	Very low	219 Å²	219	146.2 Å²	146.2	83%	0.826	79%	0.792	S	S	*	*	S	Bend	trans	-8.4	129.2	167.9	-56.3	178.3	-174.7	109.1	2.7	116.3	G35	G35-R37 PolarHBondContact O-N 3.48Å
38	E	52.7	Low	47.8	Very low	177 Å²	177	142.3 Å²	142.3	83%	0.827	80%	0.795	S	S	*	*			trans	48.2	111.1	144.8	-54.7	-81.3	161.4	0	0	117
39	L	43.3	Very low	47.6	Very low	162 Å²	162	147.6 Å²	147.6	85%	0.848	81%	0.812	S	S	*	*			trans	-161.3	99.6	145.3	-112.9	143.7	0	0	0	111.2
40	D	43.3	Very low	47.2	Very low	124 Å²	124	148 Å²	148	66%	0.663	81%	0.814	S	S	*	*			trans	36.2	115.1	141.9	-59.9	-42.8	0	0	0	121
41	S	53.4	Low	46.7	Very low	103 Å²	103	152.6 Å²	152.6	72%	0.72	82%	0.821	S	S	*	*			trans	30.4	101	132.1	-29	0	0	0	0	118.3
42	F	40	Very low	46.4	Very low	217 Å²	217	151.4 Å²	151.4	95%	0.952	82%	0.821	S	S	*	*			trans	-157.2	126.4	146	-89.7	-73.1	0	0	0	112
43	G	34.6	Very low	46.2	Very low	75 Å²	75	149.7 Å²	149.7	77%	0.773	83%	0.826	S	S	*	*			trans	94.7	104.1	144.3	0	0	0	0	0	116.6	S45	G43-S45 PolarHBondContact O-N 2.68Å
44	A	44.2	Very low	46	Very low	108 Å²	108	147.9 Å²	147.9	89%	0.893	82%	0.815	S	S	*	*			trans	-45.3	132.1	159.8	0	0	0	0	0	112.3
45	S	37.8	Very low	45.1	Very low	118 Å²	118	152.9 Å²	152.9	83%	0.825	82%	0.818	S	S	*	*			trans	-157.2	123.6	143	-170.5	0	0	0	0	108.6	G43	G43-S45 PolarHBondContact O-N 2.68Å
46	E	38.8	Very low	45.2	Very low	185 Å²	185	154.1 Å²	154.1	86%	0.864	82%	0.821	S	S	*	*			trans	-58.2	165.4	-174.6	-65.2	159.9	112.4	0	0	114.1
47	M	40.3	Very low	45	Very low	185 Å²	185	148.5 Å²	148.5	91%	0.911	82%	0.82	S	S	*	*			trans	97.5	80.9	150.6	-155.3	-173.1	-168	0	0	117.1
48	S	40.7	Very low	44.2	Very low	120 Å²	120	146.6 Å²	146.6	84%	0.839	82%	0.82	S	S	*	*				-164.5	69.4	119.6	-159.8	0	0	0	0	108.6	E50	S48-E50 PolarHBondContact O-N 2.86Å
49	E	46.8	Very low	44.1	Very low	184 Å²	184	141.9 Å²	141.9	86%	0.86	81%	0.806	S	S	*	*			trans	-54.9	123.2	148.5	-63.8	172.5	135.6	0	0	104.6
50	E	43.9	Very low	44.3	Very low	177 Å²	177	138.5 Å²	138.5	83%	0.827	80%	0.796	S	S	*	*				-162.7	115.4	67.9	-26.7	178.6	-177.6	0	0	104.5	S48	S48-E50 PolarHBondContact O-N 2.86Å
51	I	46.5	Very low	44.5	Very low	165 Å²	165	143.5 Å²	143.5	85%	0.846	81%	0.807	S	S	*	*	S	Bend		-168	103.7	81.3	-72.4	144.8	0	0	0	105.5
52	K	39.9	Very low	44.4	Very low	192 Å²	192	146.2 Å²	146.2	84%	0.835	81%	0.813	S	S	*	*			trans	-156.7	81.6	155.6	-96.4	-175	-170.7	170.1	0	108.7	C54	K52-C54 VanDerWaalsContact C-N 3.28Å; K52-C54 PolarHBondContact O-N 3.07Å; K52-C54 VanDerWaalsContact O-N 3.17Å
53	L	41.6	Very low	44.8	Very low	172 Å²	172	145.6 Å²	145.6	90%	0.901	80%	0.804	S	S	*	*			trans	-73.9	89.1	152.3	-90.1	140.7	0	0	0	107.1
54	C	50.3	Low	45.5	Very low	74 Å²	74	147.4 Å²	147.4	50%	0.5	80%	0.802	S	S	.	*			trans	-123.4	79.7	159.5	-84.8	0	0	0	0	106.8	K52 C59	K52-C54 VanDerWaalsContact C-N 3.28Å; K52-C54 PolarHBondContact O-N 3.07Å; K52-C54 VanDerWaalsContact O-N 3.17Å; C54-C59 HydrophobicContact CB-CB 4.14Å; C54-C59 WeakPolarHBondContact CB-SG 3.29Å; C54-C59 WeakPolarHBondContact SG-CB 3.34Å; C54-C59 CovalentContact SG-SG 2.08Å; C54-C59 PolarHBondContact SG-SG 3.38Å
55	E	47.3	Very low	45.8	Very low	180 Å²	180	150.2 Å²	150.2	84%	0.841	80%	0.797	S	S	*	*			trans	-98	129.5	165.1	-170.1	143.9	-168.5	0	0	108.5
56	A	50.7	Low	46.6	Very low	99 Å²	99	154 Å²	154	82%	0.818	79%	0.793	S	S	*	*	S	Bend	trans	62.6	87.4	176.6	0	0	0	0	0	117	E58	A56-E58 PolarHBondContact O-N 2.99Å
57	G	47.9	Very low	47.6	Very low	82 Å²	82	154 Å²	154	85%	0.845	79%	0.785	S	S	*	*	S	Bend	trans	101.5	-32.8	133.6	0	0	0	0	0	118.6
58	E	43.8	Very low	48.8	Very low	180 Å²	180	148.8 Å²	148.8	84%	0.841	76%	0.761	S	S	*	*			trans	-143	84.8	-177.4	-65	-170	160.9	0	0	111.4	A56 S60	A56-E58 PolarHBondContact O-N 2.99Å; E58-S60 PolarHBondContact O-N 2.93Å
59	C	50.4	Low	50.3	Low	77 Å²	77	147.2 Å²	147.2	52%	0.52	75%	0.746	S	S	.	*			trans	-76.1	81.8	172.2	-144.3	0	0	0	0	107.3	C54 Y61	C54-C59 HydrophobicContact CB-CB 4.14Å; C54-C59 WeakPolarHBondContact CB-SG 3.29Å; C54-C59 WeakPolarHBondContact SG-CB 3.34Å; C54-C59 CovalentContact SG-SG 2.08Å; C54-C59 PolarHBondContact SG-SG 3.38Å; C59-Y61 PolarHBondContact O-N 3.37Å
60	S	47.6	Very low	51.5	Low	92 Å²	92	142.9 Å²	142.9	64%	0.643	73%	0.729	S	S	*	*			trans	-65	116.8	169.3	61.2	0	0	0	0	107.4	E58 L62	E58-S60 PolarHBondContact O-N 2.93Å; S60-L62 PolarHBondContact O-N 2.99Å
61	Y	47.4	Very low	52.9	Low	229 Å²	229	142.7 Å²	142.7	90%	0.898	72%	0.72	S	S	*	*			trans	-53.9	104.2	171.2	-75.4	-95.9	0	0	0	107.2	C59 R63	C59-Y61 PolarHBondContact O-N 3.37Å; Y61-R63 PolarHBondContact O-N 3Å
62	L	52.3	Low	54.2	Low	160 Å²	160	138.5 Å²	138.5	84%	0.838	70%	0.7	S	S	*	*			trans	-65.6	87.7	164.6	-70	179.7	0	0	0	105.4	S60 P64	S60-L62 PolarHBondContact O-N 2.99Å; L62-P64 WeakPolarHBondContact O-CD 3.38Å; L62-P64 VanDerWaalsContact O-N 3.09Å
63	R	48.5	Very low	56.2	Low	203 Å²	203	134.4 Å²	134.4	77%	0.766	69%	0.686	S	S	*	*			trans	-47.1	122	168.1	-173.6	-177.4	-170.1	126.3	3.9	105	Y61 Q65	Y61-R63 PolarHBondContact O-N 3Å; R63-Q65 PolarHBondContact O-N 3Å
64	P	48.8	Very low	58.3	Low	113 Å²	113	130.6 Å²	130.6	73%	0.734	67%	0.669	S	S	*	*			trans	-50	117.8	173	-23.9	31.8	0	0	0	106	L62 R66	L62-P64 WeakPolarHBondContact O-CD 3.38Å; L62-P64 VanDerWaalsContact O-N 3.09Å; P64-R66 PolarHBondContact O-N 2.84Å
65	Q	51.3	Low	60.1	Low	168 Å²	168	131.4 Å²	131.4	79%	0.785	67%	0.668	S	S	*	*			trans	-63	93.7	-177.4	-177.1	173.3	-1.5	0	0	105.9	R63 R67	R63-Q65 PolarHBondContact O-N 3Å; Q65-R67 PolarHBondContact O-N 3.19Å
66	R	54.4	Low	62	Low	196 Å²	196	126.6 Å²	126.6	74%	0.74	65%	0.648	S	S	*	*			trans	-65.7	74.8	-174.1	-170.8	-171.2	-178	172	7.3	108.4	P64 N68	P64-R66 PolarHBondContact O-N 2.84Å; R66-N68 VanDerWaalsContact C-N 3.28Å; R66-N68 WeakPolarHBondContact CG-OD1 3.4Å; R66-N68 PolarHBondContact NE-OD1 2.97Å; R66-N68 PolarHBondContact O-N 3.02Å
67	R	59.5	Low	63.8	Low	187 Å²	187	124.3 Å²	124.3	71%	0.706	63%	0.63	S	S	*	*			trans	-72.3	93.2	166.7	-98.2	-179.5	168	167.2	-2	105.6	Q65 T69	Q65-R67 PolarHBondContact O-N 3.19Å; R67-T69 VanDerWaalsContact C-N 3.3Å; R67-T69 PolarHBondContact O-N 3.43Å
68	N	64.8	Low	65.9	Low	74 Å²	74	125.3 Å²	125.3	40%	0.396	62%	0.615	S	S	.	*			trans	-61.1	96.8	167.3	-88.1	19.8	0	0	0	107.5	R66 L70 R71 N72	R66-N68 VanDerWaalsContact C-N 3.28Å; R66-N68 WeakPolarHBondContact CG-OD1 3.4Å; R66-N68 PolarHBondContact NE-OD1 2.97Å; R66-N68 PolarHBondContact O-N 3.02Å; N68-L70 PolarHBondContact O-N 3.26Å; N68-R71 HydrophobicContact CB-CB 3.62Å; N68-R71 WeakPolarHBondContact O-CA 3.36Å; N68-R71 VanDerWaalsContact O-CB 3.26Å; N68-R71 WeakPolarHBondContact O-CB 3.26Å; N68-R71 PolarHBondContact O-N 3.01Å; N68-N72 PolarHBondContact O-N 3.15Å; N68-N72 VanDerWaalsContact O-N 3.15Å
69	T	71.6	Confident	68.1	Low	87 Å²	87	119 Å²	119	53%	0.534	59%	0.593	S	S	.	*	H	α-helix	trans	-52.7	-39.1	178.5	-54.2	0	0	0	0	111.3	R67 R71 N72 I73	R67-T69 VanDerWaalsContact C-N 3.3Å; R67-T69 PolarHBondContact O-N 3.43Å; T69-R71 VanDerWaalsContact C-N 3.34Å; T69-R71 PolarHBondContact O-N 2.77Å; T69-N72 PolarHBondContact O-N 3.48Å; T69-N72 VanDerWaalsContact O-N 3.16Å; T69-I73 HydrophobicContact CG2-CD1 4.11Å; T69-I73 WeakPolarHBondContact O-CG1 3.4Å; T69-I73 PolarHBondContact O-N 3.12Å
70	L	72.3	Confident	70	Confident	93 Å²	93	122.6 Å²	122.6	49%	0.487	60%	0.596	S	S	.	*	H	α-helix	trans	-58.5	-41.5	171.9	-67.2	175.3	0	0	0	113.3	Q20 N68 N72 I73 V74	Q20-L70 VanDerWaalsContact OE1-CD2 3.27Å; N68-L70 PolarHBondContact O-N 3.26Å; L70-N72 VanDerWaalsContact C-N 3.29Å; L70-N72 PolarHBondContact O-N 2.89Å; L70-I73 PolarHBondContact O-N 3.29Å; L70-V74 WeakPolarHBondContact O-CB 3.3Å; L70-V74 WeakPolarHBondContact O-CG2 3.27Å; L70-V74 PolarHBondContact O-N 3.45Å
71	R	74.5	Confident	72	Confident	174 Å²	174	123 Å²	123	66%	0.657	59%	0.588	S	S	*	*	H	α-helix	trans	-62.8	-40.7	177.8	-173.2	-179.4	177.3	176.4	-0.3	110.1	N68 T69 V74 L75	N68-R71 HydrophobicContact CB-CB 3.62Å; N68-R71 WeakPolarHBondContact O-CA 3.36Å; N68-R71 VanDerWaalsContact O-CB 3.26Å; N68-R71 WeakPolarHBondContact O-CB 3.26Å; N68-R71 PolarHBondContact O-N 3.01Å; T69-R71 VanDerWaalsContact C-N 3.34Å; T69-R71 PolarHBondContact O-N 2.77Å; R71-V74 PolarHBondContact O-N 2.87Å; R71-L75 HydrophobicContact CG-CD1 3.95Å; R71-L75 HydrophobicContact CG-CG 4.39Å; R71-L75 VanDerWaalsContact O-CB 3.29Å; R71-L75 WeakPolarHBondContact O-CB 3.48Å; R71-L75 WeakPolarHBondContact O-CG 3.23Å; R71-L75 PolarHBondContact O-N 3.29Å
72	N	74.2	Confident	74	Confident	77 Å²	77	117.2 Å²	117.2	41%	0.412	57%	0.572	S	S	.	*	H	α-helix	trans	-66.4	-42.6	176.6	-66.6	-31.2	0	0	0	111.9	N68 T69 L70 L75 D76	N68-N72 PolarHBondContact O-N 3.15Å; N68-N72 VanDerWaalsContact O-N 3.15Å; T69-N72 PolarHBondContact O-N 3.48Å; T69-N72 VanDerWaalsContact O-N 3.16Å; L70-N72 VanDerWaalsContact C-N 3.29Å; L70-N72 PolarHBondContact O-N 2.89Å; N72-L75 PolarHBondContact O-N 2.67Å; N72-D76 WeakPolarHBondContact O-CB 3.37Å; N72-D76 PolarHBondContact O-N 2.89Å
73	I	81.9	Confident	75.4	Confident	105 Å²	105	116.6 Å²	116.6	54%	0.538	57%	0.565	S	S	.	*	H	α-helix	trans	-62.5	-45.2	176.8	-66.2	165.2	0	0	0	110.9	T69 L70 D76 A77	T69-I73 HydrophobicContact CG2-CD1 4.11Å; T69-I73 WeakPolarHBondContact O-CG1 3.4Å; T69-I73 PolarHBondContact O-N 3.12Å; L70-I73 PolarHBondContact O-N 3.29Å; I73-D76 PolarHBondContact O-N 3.36Å; I73-A77 WeakPolarHBondContact O-CB 3.41Å; I73-A77 PolarHBondContact O-N 3.17Å
74	V	85.8	Confident	76.8	Confident	92 Å²	92	114.6 Å²	114.6	56%	0.558	56%	0.562	S	S	*	*	H	α-helix	trans	-64.1	-43	178	170.3	0	0	0	0	111.1	L70 R71 A77 L78	L70-V74 WeakPolarHBondContact O-CB 3.3Å; L70-V74 WeakPolarHBondContact O-CG2 3.27Å; L70-V74 PolarHBondContact O-N 3.45Å; R71-V74 PolarHBondContact O-N 2.87Å; V74-A77 PolarHBondContact O-N 2.88Å; V74-L78 VanDerWaalsContact O-CB 3.3Å; V74-L78 WeakPolarHBondContact O-CB 3.41Å; V74-L78 PolarHBondContact O-N 3.34Å
75	L	86.6	Confident	77.6	Confident	92 Å²	92	119.4 Å²	119.4	48%	0.482	57%	0.565	S	S	.	*	H	α-helix	trans	-65	-40.1	177.1	-73.6	172	0	0	0	112	R71 N72 L78 A79	R71-L75 HydrophobicContact CG-CD1 3.95Å; R71-L75 HydrophobicContact CG-CG 4.39Å; R71-L75 VanDerWaalsContact O-CB 3.29Å; R71-L75 WeakPolarHBondContact O-CB 3.48Å; R71-L75 WeakPolarHBondContact O-CG 3.23Å; R71-L75 PolarHBondContact O-N 3.29Å; N72-L75 PolarHBondContact O-N 2.67Å; L75-L78 PolarHBondContact O-N 3.49Å; L75-A79 WeakPolarHBondContact O-CB 3.21Å; L75-A79 PolarHBondContact O-N 3.17Å
76	D	86.8	Confident	77.7	Confident	78 Å²	78	122.5 Å²	122.5	42%	0.417	58%	0.576	S	S	.	*	H	α-helix	trans	-66.2	-43.4	177.1	-170.7	61.4	0	0	0	111.6	N72 I73 L78 A79 R80	N72-D76 WeakPolarHBondContact O-CB 3.37Å; N72-D76 PolarHBondContact O-N 2.89Å; I73-D76 PolarHBondContact O-N 3.36Å; D76-L78 VanDerWaalsContact C-N 3.35Å; D76-L78 PolarHBondContact O-N 2.08Å; D76-A79 PolarHBondContact O-N 3.5Å; D76-R80 VanDerWaalsContact O-CG 3.31Å; D76-R80 WeakPolarHBondContact O-CG 3.32Å; D76-R80 PolarHBondContact O-N 3.4Å; D76-R80 IonicContact OD1-CZ 4Å; D76-R80 IonicContact OD1-NE 3.78Å; D76-R80 IonicContact OD1-NH2 3.49Å; D76-R80 PolarHBondContact OD1-NH2 3.25Å; D76-R80 IonicContact OD2-CZ 3.25Å; D76-R80 VanDerWaalsContact OD2-CZ 3.25Å; D76-R80 IonicContact OD2-NE 2.81Å; D76-R80 PolarHBondContact OD2-NE 3.49Å; D76-R80 IonicContact OD2-NH2 2.8Å; D76-R80 PolarHBondContact OD2-NH2 2.72Å
77	A	89.9	Confident	78.9	Confident	52 Å²	52	118.9 Å²	118.9	43%	0.43	57%	0.568	S	S	.	*	H	α-helix	trans	-61.7	-43	175	0	0	0	0	0	111.9	I73 V74 R80 E81	I73-A77 WeakPolarHBondContact O-CB 3.41Å; I73-A77 PolarHBondContact O-N 3.17Å; V74-A77 PolarHBondContact O-N 2.88Å; A77-R80 PolarHBondContact O-N 2.81Å; A77-E81 PolarHBondContact O-N 2.72Å; A77-E81 VanDerWaalsContact O-N 3.11Å
78	L	91.8	Very high	79.9	Confident	102 Å²	102	115.3 Å²	115.3	53%	0.534	56%	0.561	S	S	.	*	H	α-helix	trans	-67.1	-39.6	178.5	-168.9	133.2	0	0	0	111.9	V74 L75 D76 R80 E81 L82	V74-L78 VanDerWaalsContact O-CB 3.3Å; V74-L78 WeakPolarHBondContact O-CB 3.41Å; V74-L78 PolarHBondContact O-N 3.34Å; L75-L78 PolarHBondContact O-N 3.49Å; D76-L78 VanDerWaalsContact C-N 3.35Å; D76-L78 PolarHBondContact O-N 2.08Å; L78-R80 VanDerWaalsContact C-N 3.34Å; L78-R80 PolarHBondContact O-N 2.84Å; L78-E81 PolarHBondContact O-N 3.23Å; L78-L82 HydrophobicContact CD2-CD1 3.73Å; L78-L82 HydrophobicContact CD2-CG 4.43Å; L78-L82 WeakPolarHBondContact O-CG 3.14Å; L78-L82 PolarHBondContact O-N 3.48Å
79	A	90.4	Very high	80.7	Confident	47 Å²	47	117.6 Å²	117.6	39%	0.388	57%	0.57	S	S	.	*	H	α-helix	trans	-61.7	-41.7	174.8	0	0	0	0	0	112	L75 D76 L82 Q83	L75-A79 WeakPolarHBondContact O-CB 3.21Å; L75-A79 PolarHBondContact O-N 3.17Å; D76-A79 PolarHBondContact O-N 3.5Å; A79-L82 PolarHBondContact O-N 3.2Å; A79-Q83 VanDerWaalsContact O-CG 3.31Å; A79-Q83 WeakPolarHBondContact O-CG 3.31Å; A79-Q83 PolarHBondContact O-N 3Å
80	R	89.1	Confident	81.3	Confident	154 Å²	154	119.4 Å²	119.4	58%	0.581	57%	0.572	S	S	*	*	H	α-helix	trans	-64.2	-39.4	176.6	-70.1	172.7	-164.8	-82.7	-4.2	112.7	D76 A77 L78 Q83 K84	D76-R80 VanDerWaalsContact O-CG 3.31Å; D76-R80 WeakPolarHBondContact O-CG 3.32Å; D76-R80 PolarHBondContact O-N 3.4Å; D76-R80 IonicContact OD1-CZ 4Å; D76-R80 IonicContact OD1-NE 3.78Å; D76-R80 IonicContact OD1-NH2 3.49Å; D76-R80 PolarHBondContact OD1-NH2 3.25Å; D76-R80 IonicContact OD2-CZ 3.25Å; D76-R80 VanDerWaalsContact OD2-CZ 3.25Å; D76-R80 IonicContact OD2-NE 2.81Å; D76-R80 PolarHBondContact OD2-NE 3.49Å; D76-R80 IonicContact OD2-NH2 2.8Å; D76-R80 PolarHBondContact OD2-NH2 2.72Å; A77-R80 PolarHBondContact O-N 2.81Å; L78-R80 VanDerWaalsContact C-N 3.34Å; L78-R80 PolarHBondContact O-N 2.84Å; R80-Q83 PolarHBondContact O-N 2.71Å; R80-K84 PolarHBondContact O-N 3.21Å; R80-K84 VanDerWaalsContact O-N 3.12Å
81	E	90.2	Very high	81.8	Confident	99 Å²	99	121 Å²	121	46%	0.463	58%	0.577	S	S	.	*	H	α-helix	trans	-68.3	-37.8	176.8	-77.3	-57.8	137.2	0	0	112.5	A77 L78 K84 R85	A77-E81 PolarHBondContact O-N 2.72Å; A77-E81 VanDerWaalsContact O-N 3.11Å; L78-E81 PolarHBondContact O-N 3.23Å; E81-K84 PolarHBondContact O-N 3.45Å; E81-R85 PolarHBondContact O-N 2.88Å
82	L	88.4	Confident	82.3	Confident	108 Å²	108	117.5 Å²	117.5	57%	0.565	57%	0.572	S	S	*	*	H	α-helix	trans	-67.7	-36.4	175.2	-69.7	175	0	0	0	112.4	L78 A79 K84 R85	L78-L82 HydrophobicContact CD2-CD1 3.73Å; L78-L82 HydrophobicContact CD2-CG 4.43Å; L78-L82 WeakPolarHBondContact O-CG 3.14Å; L78-L82 PolarHBondContact O-N 3.48Å; A79-L82 PolarHBondContact O-N 3.2Å; L82-K84 VanDerWaalsContact C-N 3.34Å; L82-R85 PolarHBondContact O-N 3.26Å
83	Q	82.6	Confident	82.9	Confident	148 Å²	148	120.4 Å²	120.4	69%	0.692	58%	0.583	S	S	*	*	H	α-helix	trans	-67.1	-33.2	174.5	-71.3	-71.4	-43.5	0	0	112.6	A79 R80 R85	A79-Q83 VanDerWaalsContact O-CG 3.31Å; A79-Q83 WeakPolarHBondContact O-CG 3.31Å; A79-Q83 PolarHBondContact O-N 3Å; R80-Q83 PolarHBondContact O-N 2.71Å; Q83-R85 VanDerWaalsContact C-N 3.31Å; Q83-R85 PolarHBondContact O-N 3.25Å
84	K	77.5	Confident	83	Confident	160 Å²	160	121.5 Å²	121.5	70%	0.696	59%	0.587	S	S	*	*	H	α-helix	trans	-71.4	-22.7	175.1	-86.9	-178.4	177.8	176.2	0	114.2	R80 E81 L82	R80-K84 PolarHBondContact O-N 3.21Å; R80-K84 VanDerWaalsContact O-N 3.12Å; E81-K84 PolarHBondContact O-N 3.45Å; L82-K84 VanDerWaalsContact C-N 3.34Å
85	R	65.9	Low	82.7	Confident	215 Å²	215	124 Å²	124	81%	0.811	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.2	-2.1	-178.9	-74	-171.6	-177.7	-161.7	1	113.7	E81 L82 Q83	E81-R85 PolarHBondContact O-N 2.88Å; L82-R85 PolarHBondContact O-N 3.26Å; Q83-R85 VanDerWaalsContact C-N 3.31Å; Q83-R85 PolarHBondContact O-N 3.25Å
86	K	53.7	Low	82.4	Confident	233 Å²	233	126.9 Å²	126.9	100%	1.013	60%	0.599	S	S	*	*			trans	-104.1	0	176.1	-167	177.3	-174.7	-177	0	109.7

Retrieved 86 of 86 residues in 49.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).