A0A087XY80_POEFO Loading...

Cytochrome b-c1 complex subunit 8

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches.

AlphaFold DB , UniProt , Accession A0A087XY80, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 88 aa.

						>A0A087XY80_POEFO|A0A087XY80
ISSLVNMGRHFGDLAKVRHVITYSLSPFEQKAFANYFSKGIPNVWRRFTASFFKVAPPMILTYLIYSWGNMTHEQGKKKNPADYANDE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	I	47.9	Very low	62.2	Low	229 Å²	229	144.2 Å²	144.2	100%	1.174	76%	0.761	S	S	*	*				0	79.3	0	-57.2	165.2	0	0	0	107.5
2	S	44.4	Very low	64.2	Low	122 Å²	122	139.4 Å²	139.4	85%	0.853	77%	0.772	S	S	*	*			trans	-169.7	70.1	178.3	-177.2	0	0	0	0	111.2
3	S	48.1	Very low	66.2	Low	112 Å²	112	136.1 Å²	136.1	78%	0.783	75%	0.753	S	S	*	*			trans	-154.8	19.8	175.3	68.6	0	0	0	0	116.4
4	L	54	Low	67.8	Low	161 Å²	161	133.5 Å²	133.5	84%	0.843	74%	0.736	S	S	*	*			trans	-125.5	23.3	-170.2	-70.1	-178.8	0	0	0	117.1
5	V	56.6	Low	69.2	Low	111 Å²	111	130.1 Å²	130.1	67%	0.673	73%	0.732	S	S	*	*			trans	-142.6	80.9	171.4	-169.6	0	0	0	0	111
6	N	55.4	Low	70.5	Confident	146 Å²	146	132.8 Å²	132.8	78%	0.781	73%	0.734	S	S	*	*			trans	-130.1	73.2	155.9	-140.5	11.1	0	0	0	107.3
7	M	66.2	Low	71.7	Confident	150 Å²	150	131.1 Å²	131.1	74%	0.739	73%	0.728	S	S	*	*			trans	-89.9	96.6	174.9	-67.2	-172.4	83.4	0	0	108.3	R9	M7-R9 WeakPolarHBondContact O-CG 3.38Å; M7-R9 PolarHBondContact O-N 3.03Å
8	G	61.6	Low	73	Confident	29 Å²	29	133.7 Å²	133.7	30%	0.299	73%	0.725	S	S	.	*			trans	35.3	60.5	149.3	0	0	0	0	0	118.1	D13	G8-D13 WeakPolarHBondContact CA-O 3.17Å; G8-D13 WeakPolarHBondContact CA-OD2 3.42Å; G8-D13 PolarHBondContact N-OD2 3.15Å; G8-D13 VanDerWaalsContact N-OD2 3.15Å
9	R	77.1	Confident	74.2	Confident	186 Å²	186	136.5 Å²	136.5	70%	0.702	73%	0.732	S	S	*	*			trans	-100.6	-2.8	177.1	-61.8	-154.1	172	108.4	-1.3	114.3	M7	M7-R9 WeakPolarHBondContact O-CG 3.38Å; M7-R9 PolarHBondContact O-N 3.03Å
10	H	83.9	Confident	75.3	Confident	141 Å²	141	134.8 Å²	134.8	65%	0.653	73%	0.726	S	S	*	*	S	Bend	trans	-137.3	154.6	-171.5	-59.1	-65.4	0	0	0	112.4	G12 D13 L14	H10-G12 PolarHBondContact O-N 3.1Å; H10-D13 PolarHBondContact O-N 3.3Å; H10-D13 VanDerWaalsContact O-N 3.1Å; H10-L14 WeakPolarHBondContact O-CG 2.95Å
11	F	89.2	Confident	76.3	Confident	199 Å²	199	134.7 Å²	134.7	87%	0.873	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.1	128.3	172.9	-69.5	-67.7	0	0	0	110.4	L14	F11-L14 HydrophobicContact CD1-CD1 3.69Å; F11-L14 HydrophobicContact CE1-CD1 4.05Å
12	G	86.3	Confident	78.7	Confident	87 Å²	87	129.4 Å²	129.4	90%	0.897	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	108.8	-26.6	-173.6	0	0	0	0	0	114.5	H10	H10-G12 PolarHBondContact O-N 3.1Å
13	D	89.3	Confident	81.2	Confident	96 Å²	96	133.2 Å²	133.2	51%	0.513	70%	0.7	S	S	.	*	S	Bend	trans	-126.9	21	180	-169	37.5	0	0	0	112.9	G8 H10	G8-D13 WeakPolarHBondContact CA-O 3.17Å; G8-D13 WeakPolarHBondContact CA-OD2 3.42Å; G8-D13 PolarHBondContact N-OD2 3.15Å; G8-D13 VanDerWaalsContact N-OD2 3.15Å; H10-D13 PolarHBondContact O-N 3.3Å; H10-D13 VanDerWaalsContact O-N 3.1Å
14	L	88.6	Confident	83.5	Confident	100 Å²	100	133.4 Å²	133.4	52%	0.524	70%	0.701	S	S	.	*	S	Bend	trans	-73.2	-52.4	-173.8	-63.9	173.6	0	0	0	113.1	H10 F11	H10-L14 WeakPolarHBondContact O-CG 2.95Å; F11-L14 HydrophobicContact CD1-CD1 3.69Å; F11-L14 HydrophobicContact CE1-CD1 4.05Å
15	A	88.8	Confident	85.6	Confident	82 Å²	82	131.1 Å²	131.1	68%	0.678	69%	0.689	S	S	*	*			trans	-162.3	153.3	-173.8	0	0	0	0	0	111.1	V17	A15-V17 HydrophobicContact CB-CG2 4.31Å; A15-V17 PolarHBondContact O-N 3.48Å
16	K	90.1	Very high	87.5	Confident	173 Å²	173	128.4 Å²	128.4	75%	0.752	68%	0.675	S	S	*	*			trans	-91.6	98	171.8	-172.2	175.2	-177.1	175.6	0	109.8
17	V	91.8	Very high	89.4	Confident	105 Å²	105	126.4 Å²	126.4	64%	0.636	67%	0.67	S	S	*	*			trans	-107.2	139	175.3	-175.9	0	0	0	0	109.2	A15 V20	A15-V17 HydrophobicContact CB-CG2 4.31Å; A15-V17 PolarHBondContact O-N 3.48Å; V17-V20 HydrophobicContact CG1-CB 4.16Å; V17-V20 HydrophobicContact CG1-CG2 3.62Å
18	R	94.6	Very high	90.9	Very high	178 Å²	178	128.8 Å²	128.8	67%	0.672	68%	0.677	S	S	*	*			trans	-130.2	139.7	178.9	-68.9	-179.5	161.5	-176.2	-8.6	110.1	V20	R18-V20 PolarHBondContact O-N 3.46Å
19	H	96.8	Very high	92.5	Very high	187 Å²	187	134.3 Å²	134.3	87%	0.866	69%	0.694	S	S	*	*	S	Bend	trans	59.3	39.7	171.5	-44	113.2	0	0	0	116.2
20	V	95.9	Very high	93.5	Very high	102 Å²	102	130.5 Å²	130.5	62%	0.618	69%	0.685	S	S	*	*			trans	-108.2	119.8	171.4	178.8	0	0	0	0	108.8	V17 R18 T22	V17-V20 HydrophobicContact CG1-CB 4.16Å; V17-V20 HydrophobicContact CG1-CG2 3.62Å; R18-V20 PolarHBondContact O-N 3.46Å; V20-T22 HydrophobicContact CG1-CG2 4.18Å
21	I	96.3	Very high	93.9	Very high	132 Å²	132	132 Å²	132	68%	0.677	69%	0.69	S	S	*	*			trans	-106.7	126.4	177.2	-56.7	167.4	0	0	0	108.2	Y23	I21-Y23 HydrophobicContact CG2-CE1 4.03Å; I21-Y23 HydrophobicContact CG2-CE2 3.94Å
22	T	97.2	Very high	94.2	Very high	118 Å²	118	127.1 Å²	127.1	72%	0.724	69%	0.686	S	S	*	*			trans	-122	133.1	179.2	55.5	0	0	0	0	110.2	V20	V20-T22 HydrophobicContact CG1-CG2 4.18Å
23	Y	97.7	Very high	94.5	Very high	203 Å²	203	131.4 Å²	131.4	80%	0.796	68%	0.68	S	S	*	*			trans	-106.2	147.3	176.4	-55.4	-79.3	0	0	0	110.3	I21	I21-Y23 HydrophobicContact CG2-CE1 4.03Å; I21-Y23 HydrophobicContact CG2-CE2 3.94Å
24	S	96.3	Very high	94.6	Very high	116 Å²	116	129.7 Å²	129.7	81%	0.811	68%	0.679	S	S	*	*			trans	-148	147.3	178.1	-63.6	0	0	0	0	109.6
25	L	97.1	Very high	94.9	Very high	113 Å²	113	129.8 Å²	129.8	59%	0.592	68%	0.68	S	S	*	*			trans	-103.2	152.5	174.8	-68	171.2	0	0	0	109.8	Q30	L25-Q30 HydrophobicContact CB-CG 3.89Å; L25-Q30 PolarHBondContact O-NE2 2.79Å
26	S	97.1	Very high	95.1	Very high	53 Å²	53	132.4 Å²	132.4	37%	0.371	67%	0.673	S	S	.	*			trans	-60	139.8	174.8	176.9	0	0	0	0	110.5	F28 E29 Q30	S26-F28 PolarHBondContact O-N 3.25Å; S26-F28 VanDerWaalsContact O-N 3.15Å; S26-E29 WeakPolarHBondContact O-CB 3.49Å; S26-E29 PolarHBondContact O-N 3.41Å; S26-Q30 PolarHBondContact O-N 2.95Å
27	P	96.5	Very high	95.2	Very high	104 Å²	104	131.6 Å²	131.6	68%	0.675	67%	0.67	S	S	*	*	G	3₁₀ helix	trans	-56.2	-30.9	177.5	-26.4	35.1	0	0	0	113.6	E29 Q30	P27-E29 PolarHBondContact O-N 3.36Å; P27-Q30 PolarHBondContact O-N 3.15Å
28	F	96.6	Very high	95.3	Very high	201 Å²	201	130 Å²	130	88%	0.882	66%	0.664	S	S	*	*	G	3₁₀ helix	trans	-72.8	-14.3	178.2	-58.5	-70.7	0	0	0	113.6	S26	S26-F28 PolarHBondContact O-N 3.25Å; S26-F28 VanDerWaalsContact O-N 3.15Å
29	E	95.6	Very high	95.4	Very high	144 Å²	144	127.9 Å²	127.9	67%	0.673	66%	0.659	S	S	*	*	G	3₁₀ helix	trans	-97.4	-8.9	175.3	-61.8	-176.7	153.2	0	0	112.2	S26 P27	S26-E29 WeakPolarHBondContact O-CB 3.49Å; S26-E29 PolarHBondContact O-N 3.41Å; P27-E29 PolarHBondContact O-N 3.36Å
30	Q	97.1	Very high	95.3	Very high	106 Å²	106	120.3 Å²	120.3	50%	0.495	63%	0.632	S	S	.	*	S	Bend	trans	-102.1	155.1	-178.2	-63.7	-175.2	47.1	0	0	111.9	L25 S26 P27	L25-Q30 HydrophobicContact CB-CG 3.89Å; L25-Q30 PolarHBondContact O-NE2 2.79Å; S26-Q30 PolarHBondContact O-N 2.95Å; P27-Q30 PolarHBondContact O-N 3.15Å
31	K	94.2	Very high	95.3	Very high	174 Å²	174	119.5 Å²	119.5	76%	0.757	62%	0.623	S	S	*	*			trans	-85.3	125.3	168.8	-66.1	178.3	179.3	178.4	0	109.1	F33 A34	K31-F33 PolarHBondContact O-N 3.25Å; K31-A34 HydrophobicContact CB-CB 4.25Å
32	A	93.7	Very high	95.4	Very high	96 Å²	96	116.4 Å²	116.4	79%	0.793	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.8	-36.8	177.3	0	0	0	0	0	113
33	F	92.3	Very high	95.4	Very high	177 Å²	177	114.3 Å²	114.3	78%	0.776	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122.4	64.2	178.7	-57.9	-71.7	0	0	0	111.8	K31	K31-F33 PolarHBondContact O-N 3.25Å
34	A	92.7	Very high	95.4	Very high	59 Å²	59	109.3 Å²	109.3	49%	0.488	59%	0.587	S	S	.	*	T	Hydrogen-bonded Turn	trans	-68.8	140.7	174.7	0	0	0	0	0	111.9	K31 Y36	K31-A34 HydrophobicContact CB-CB 4.25Å; A34-Y36 VanDerWaalsContact C-N 3.27Å; A34-Y36 PolarHBondContact O-N 2.8Å; A34-Y36 VanDerWaalsContact O-N 3.16Å
35	N	94.4	Very high	95.4	Very high	103 Å²	103	111.6 Å²	111.6	55%	0.551	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.4	33.1	169.2	-58.1	-54.8	0	0	0	115.7	F37 S38 K39 G40	N35-F37 PolarHBondContact O-N 3.16Å; N35-S38 WeakPolarHBondContact CB-OG 3.49Å; N35-S38 PolarHBondContact OD1-OG 3.12Å; N35-K39 HydrophobicContact CB-CB 3.86Å; N35-K39 HydrophobicContact CB-CG 3.83Å; N35-K39 WeakPolarHBondContact O-CA 3.25Å; N35-K39 PolarHBondContact O-N 3.49Å; N35-G40 PolarHBondContact O-N 3.21Å
36	Y	92.2	Very high	95.5	Very high	137 Å²	137	113.2 Å²	113.2	54%	0.537	58%	0.576	S	S	.	*	I	π-helix	trans	-54.6	-52.4	-175.9	-176.6	-98.4	0	0	0	113.1	A34 G40 I41	A34-Y36 VanDerWaalsContact C-N 3.27Å; A34-Y36 PolarHBondContact O-N 2.8Å; A34-Y36 VanDerWaalsContact O-N 3.16Å; Y36-G40 CarbonylContact O-C 3.52Å; Y36-G40 WeakPolarHBondContact O-CA 3.47Å; Y36-G40 PolarHBondContact O-N 3Å; Y36-I41 HydrophobicContact CE1-CD1 4.32Å; Y36-I41 HydrophobicContact CE1-CG1 4.45Å; Y36-I41 PolarHBondContact O-N 2.73Å
37	F	94.3	Very high	95.5	Very high	156 Å²	156	119 Å²	119	68%	0.684	59%	0.589	S	S	*	*	I	π-helix	trans	-79.7	-40.9	-179.5	-61.5	-78	0	0	0	113	N35 I41 P42	N35-F37 PolarHBondContact O-N 3.16Å; F37-I41 HydrophobicContact CD1-CD1 3.54Å; F37-I41 HydrophobicContact CE1-CD1 4.11Å; F37-I41 HydrophobicContact CG-CD1 4.46Å; F37-P42 VanDerWaalsContact O-CD 3.27Å; F37-P42 WeakPolarHBondContact O-CD 3.28Å
38	S	93.8	Very high	95.5	Very high	72 Å²	72	119 Å²	119	50%	0.503	58%	0.579	S	S	.	*	I	π-helix	trans	-76	-29.5	-173.7	58.7	0	0	0	0	113.8	N35	N35-S38 WeakPolarHBondContact CB-OG 3.49Å; N35-S38 PolarHBondContact OD1-OG 3.12Å
39	K	95	Very high	95.6	Very high	133 Å²	133	112 Å²	112	58%	0.578	55%	0.552	S	S	*	*	I	π-helix	trans	-127.9	-36	-177.9	-61.2	-66.4	-178	-177.8	0	113	N35 N43	N35-K39 HydrophobicContact CB-CB 3.86Å; N35-K39 HydrophobicContact CB-CG 3.83Å; N35-K39 WeakPolarHBondContact O-CA 3.25Å; N35-K39 PolarHBondContact O-N 3.49Å; K39-N43 VanDerWaalsContact O-CB 3.28Å; K39-N43 WeakPolarHBondContact O-CB 3.43Å; K39-N43 PolarHBondContact O-N 2.98Å; K39-N43 VanDerWaalsContact O-N 3.15Å; K39-N43 PolarHBondContact O-ND2 2.78Å
40	G	95.4	Very high	95.6	Very high	28 Å²	28	107.9 Å²	107.9	29%	0.289	54%	0.544	S	S	.	.	I	π-helix	trans	-61.4	-62.6	-179.4	0	0	0	0	0	111.9	N35 Y36 N43 V44	N35-G40 PolarHBondContact O-N 3.21Å; Y36-G40 CarbonylContact O-C 3.52Å; Y36-G40 WeakPolarHBondContact O-CA 3.47Å; Y36-G40 PolarHBondContact O-N 3Å; G40-N43 PolarHBondContact O-N 3.4Å; G40-N43 VanDerWaalsContact O-N 3.14Å; G40-V44 WeakPolarHBondContact O-CG2 3.1Å; G40-V44 PolarHBondContact O-N 3.22Å
41	I	96.4	Very high	95.6	Very high	84 Å²	84	105.9 Å²	105.9	43%	0.431	54%	0.541	S	S	.	.	H	α-helix	trans	-58.1	-48.5	-178.2	-63.2	174.2	0	0	0	112.4	Y36 F37 N43 V44 W45	Y36-I41 HydrophobicContact CE1-CD1 4.32Å; Y36-I41 HydrophobicContact CE1-CG1 4.45Å; Y36-I41 PolarHBondContact O-N 2.73Å; F37-I41 HydrophobicContact CD1-CD1 3.54Å; F37-I41 HydrophobicContact CE1-CD1 4.11Å; F37-I41 HydrophobicContact CG-CD1 4.46Å; I41-N43 VanDerWaalsContact C-N 3.28Å; I41-N43 PolarHBondContact O-N 3.25Å; I41-V44 PolarHBondContact O-N 3.17Å; I41-V44 VanDerWaalsContact O-N 3.14Å; I41-W45 PolarHBondContact O-N 3.31Å
42	P	97.3	Very high	95.8	Very high	68 Å²	68	101.6 Å²	101.6	44%	0.442	52%	0.522	S	S	.	.	H	α-helix	trans	-59.2	-36.5	176.9	-28.3	37.1	0	0	0	113.7	F37 W45 R46	F37-P42 VanDerWaalsContact O-CD 3.27Å; F37-P42 WeakPolarHBondContact O-CD 3.28Å; P42-W45 PolarHBondContact O-N 2.85Å; P42-R46 WeakPolarHBondContact O-CB 3.25Å; P42-R46 PolarHBondContact O-N 3.02Å
43	N	96.9	Very high	95.9	Very high	73 Å²	73	104.5 Å²	104.5	39%	0.39	52%	0.518	S	S	.	.	H	α-helix	trans	-71.6	-36.7	176.2	-83.7	-58.4	0	0	0	112.7	K39 G40 I41 W45 R46 R47	K39-N43 VanDerWaalsContact O-CB 3.28Å; K39-N43 WeakPolarHBondContact O-CB 3.43Å; K39-N43 PolarHBondContact O-N 2.98Å; K39-N43 VanDerWaalsContact O-N 3.15Å; K39-N43 PolarHBondContact O-ND2 2.78Å; G40-N43 PolarHBondContact O-N 3.4Å; G40-N43 VanDerWaalsContact O-N 3.14Å; I41-N43 VanDerWaalsContact C-N 3.28Å; I41-N43 PolarHBondContact O-N 3.25Å; N43-W45 VanDerWaalsContact C-N 3.35Å; N43-R46 PolarHBondContact O-N 3.45Å; N43-R47 WeakPolarHBondContact O-CB 3.39Å; N43-R47 VanDerWaalsContact O-CG 3.25Å; N43-R47 WeakPolarHBondContact O-CG 3.33Å; N43-R47 PolarHBondContact O-N 3.23Å
44	V	97.5	Very high	96.1	Very high	99 Å²	99	104.1 Å²	104.1	60%	0.6	52%	0.516	S	S	*	.	H	α-helix	trans	-61.3	-47.1	172.9	173.5	0	0	0	0	110	G40 I41 R46 R47 F48	G40-V44 WeakPolarHBondContact O-CG2 3.1Å; G40-V44 PolarHBondContact O-N 3.22Å; I41-V44 PolarHBondContact O-N 3.17Å; I41-V44 VanDerWaalsContact O-N 3.14Å; V44-R46 PolarHBondContact O-N 3.3Å; V44-R47 PolarHBondContact O-N 3.18Å; V44-F48 WeakPolarHBondContact O-CB 3.39Å; V44-F48 PolarHBondContact O-N 2.91Å
45	W	97.8	Very high	96.3	Very high	164 Å²	164	105.5 Å²	105.5	62%	0.621	52%	0.518	S	S	*	.	H	α-helix	trans	-58.4	-48.6	176.4	-178.4	-113.3	0	0	0	112	I41 P42 N43 R47 F48 T49	I41-W45 PolarHBondContact O-N 3.31Å; P42-W45 PolarHBondContact O-N 2.85Å; N43-W45 VanDerWaalsContact C-N 3.35Å; W45-R47 VanDerWaalsContact C-N 3.29Å; W45-R47 PolarHBondContact O-N 3.15Å; W45-F48 HydrophobicContact CE3-CD1 4.02Å; W45-F48 HydrophobicContact CH2-CD1 4.39Å; W45-F48 HydrophobicContact CH2-CE1 4.41Å; W45-F48 AromaticContact CZ3-CD1 3.76Å; W45-F48 HydrophobicContact CZ3-CD1 3.76Å; W45-F48 AromaticContact CZ3-CE1 3.98Å; W45-F48 HydrophobicContact CZ3-CE1 3.98Å; W45-F48 WeakPolarHBondContact O-CB 3.44Å; W45-F48 PolarHBondContact O-N 3.25Å; W45-T49 HydrophobicContact CD2-CG2 3.95Å; W45-T49 HydrophobicContact CE3-CG2 4.47Å; W45-T49 HydrophobicContact CG-CG2 4.42Å; W45-T49 HydrophobicContact CH2-CG2 4.24Å; W45-T49 HydrophobicContact CZ2-CG2 3.68Å; W45-T49 WeakPolarHBondContact O-CG2 3.26Å; W45-T49 PolarHBondContact O-N 3.17Å; W45-T49 PolarHBondContact O-OG1 2.95Å
46	R	97.7	Very high	96.5	Very high	146 Å²	146	101.3 Å²	101.3	55%	0.551	50%	0.498	S	S	*	.	H	α-helix	trans	-57.5	-39.3	175.9	-171.5	-168.9	64.4	73.9	-1.8	112.7	P42 N43 V44 T49 A50	P42-R46 WeakPolarHBondContact O-CB 3.25Å; P42-R46 PolarHBondContact O-N 3.02Å; N43-R46 PolarHBondContact O-N 3.45Å; V44-R46 PolarHBondContact O-N 3.3Å; R46-T49 PolarHBondContact O-OG1 3.18Å; R46-A50 WeakPolarHBondContact O-CB 3.23Å; R46-A50 PolarHBondContact O-N 3.44Å
47	R	97.2	Very high	96.8	Very high	174 Å²	174	97.9 Å²	97.9	66%	0.657	49%	0.492	S	S	*	.	H	α-helix	trans	-70.4	-40	177.5	-73	176	71.9	178.5	3	111.9	N43 V44 W45 S51	N43-R47 WeakPolarHBondContact O-CB 3.39Å; N43-R47 VanDerWaalsContact O-CG 3.25Å; N43-R47 WeakPolarHBondContact O-CG 3.33Å; N43-R47 PolarHBondContact O-N 3.23Å; V44-R47 PolarHBondContact O-N 3.18Å; W45-R47 VanDerWaalsContact C-N 3.29Å; W45-R47 PolarHBondContact O-N 3.15Å; R47-S51 PolarHBondContact O-N 2.95Å; R47-S51 PolarHBondContact O-OG 3.5Å; R47-S51 VanDerWaalsContact O-OG 3.12Å
48	F	98	Very high	96.9	Very high	106 Å²	106	93.7 Å²	93.7	47%	0.465	48%	0.481	S	S	.	.	H	α-helix	trans	-62.2	-53.8	176.5	173.5	-99.6	0	0	0	110.9	V44 W45 A50 S51 F52	V44-F48 WeakPolarHBondContact O-CB 3.39Å; V44-F48 PolarHBondContact O-N 2.91Å; W45-F48 HydrophobicContact CE3-CD1 4.02Å; W45-F48 HydrophobicContact CH2-CD1 4.39Å; W45-F48 HydrophobicContact CH2-CE1 4.41Å; W45-F48 AromaticContact CZ3-CD1 3.76Å; W45-F48 HydrophobicContact CZ3-CD1 3.76Å; W45-F48 AromaticContact CZ3-CE1 3.98Å; W45-F48 HydrophobicContact CZ3-CE1 3.98Å; W45-F48 WeakPolarHBondContact O-CB 3.44Å; W45-F48 PolarHBondContact O-N 3.25Å; F48-A50 VanDerWaalsContact C-N 3.29Å; F48-A50 PolarHBondContact O-N 3.31Å; F48-S51 PolarHBondContact O-N 3.46Å; F48-F52 HydrophobicContact CE1-CB 4.39Å; F48-F52 AromaticContact CE1-CD2 3.79Å; F48-F52 HydrophobicContact CE1-CD2 3.79Å; F48-F52 HydrophobicContact CE1-CE2 4.43Å; F48-F52 HydrophobicContact CE1-CG 4.29Å; F48-F52 HydrophobicContact CE2-CD2 4.03Å; F48-F52 AromaticContact CZ-CD2 3.35Å; F48-F52 HydrophobicContact CZ-CD2 3.35Å; F48-F52 AromaticContact CZ-CE2 3.88Å; F48-F52 HydrophobicContact CZ-CE2 3.88Å; F48-F52 HydrophobicContact CZ-CG 4.25Å; F48-F52 WeakPolarHBondContact O-CB 3.15Å; F48-F52 PolarHBondContact O-N 2.93Å
49	T	97.1	Very high	97.1	Very high	52 Å²	52	96.5 Å²	96.5	32%	0.319	49%	0.487	S	S	.	.	H	α-helix	trans	-61.9	-36.2	-178.1	55.8	0	0	0	0	112.6	W45 R46 S51	W45-T49 HydrophobicContact CD2-CG2 3.95Å; W45-T49 HydrophobicContact CE3-CG2 4.47Å; W45-T49 HydrophobicContact CG-CG2 4.42Å; W45-T49 HydrophobicContact CH2-CG2 4.24Å; W45-T49 HydrophobicContact CZ2-CG2 3.68Å; W45-T49 WeakPolarHBondContact O-CG2 3.26Å; W45-T49 PolarHBondContact O-N 3.17Å; W45-T49 PolarHBondContact O-OG1 2.95Å; R46-T49 PolarHBondContact O-OG1 3.18Å; T49-S51 PolarHBondContact O-N 2.87Å
50	A	97.4	Very high	97.3	Very high	59 Å²	59	94.7 Å²	94.7	49%	0.488	48%	0.483	S	S	.	.	H	α-helix	trans	-64	-23.2	175.9	0	0	0	0	0	114.2	R46 F48	R46-A50 WeakPolarHBondContact O-CB 3.23Å; R46-A50 PolarHBondContact O-N 3.44Å; F48-A50 VanDerWaalsContact C-N 3.29Å; F48-A50 PolarHBondContact O-N 3.31Å
51	S	96.6	Very high	97.4	Very high	63 Å²	63	98.3 Å²	98.3	44%	0.441	50%	0.495	S	S	.	.	H	α-helix	trans	-106.5	-23.6	-177.9	-50.1	0	0	0	0	112.7	R47 F48 T49 F53 K54 V55	R47-S51 PolarHBondContact O-N 2.95Å; R47-S51 PolarHBondContact O-OG 3.5Å; R47-S51 VanDerWaalsContact O-OG 3.12Å; F48-S51 PolarHBondContact O-N 3.46Å; T49-S51 PolarHBondContact O-N 2.87Å; S51-F53 PolarHBondContact O-N 3.14Å; S51-K54 WeakPolarHBondContact O-CB 3.49Å; S51-K54 PolarHBondContact O-N 2.95Å; S51-V55 PolarHBondContact O-N 3.14Å
52	F	97.3	Very high	97.5	Very high	84 Å²	84	98.7 Å²	98.7	37%	0.368	50%	0.502	S	S	.	.	H	α-helix	trans	-53	-50.9	-173	-177.2	-98.9	0	0	0	112.6	F48 K54 V55 A56	F48-F52 HydrophobicContact CE1-CB 4.39Å; F48-F52 AromaticContact CE1-CD2 3.79Å; F48-F52 HydrophobicContact CE1-CD2 3.79Å; F48-F52 HydrophobicContact CE1-CE2 4.43Å; F48-F52 HydrophobicContact CE1-CG 4.29Å; F48-F52 HydrophobicContact CE2-CD2 4.03Å; F48-F52 AromaticContact CZ-CD2 3.35Å; F48-F52 HydrophobicContact CZ-CD2 3.35Å; F48-F52 AromaticContact CZ-CE2 3.88Å; F48-F52 HydrophobicContact CZ-CE2 3.88Å; F48-F52 HydrophobicContact CZ-CG 4.25Å; F48-F52 WeakPolarHBondContact O-CB 3.15Å; F48-F52 PolarHBondContact O-N 2.93Å; F52-K54 PolarHBondContact O-N 3.28Å; F52-V55 PolarHBondContact O-N 3.15Å; F52-A56 HydrophobicContact CD1-CB 4.24Å; F52-A56 HydrophobicContact CD2-CB 4.04Å; F52-A56 HydrophobicContact CE1-CB 3.97Å; F52-A56 HydrophobicContact CE2-CB 3.78Å; F52-A56 HydrophobicContact CG-CB 4.27Å; F52-A56 HydrophobicContact CZ-CB 3.74Å; F52-A56 WeakPolarHBondContact O-CB 3.45Å; F52-A56 PolarHBondContact O-N 3.01Å
53	F	96.1	Very high	97.6	Very high	158 Å²	158	102.8 Å²	102.8	69%	0.693	51%	0.509	S	S	*	.	H	α-helix	trans	-72.1	-11.5	-178.5	-66.3	-72.4	0	0	0	114.7	S51 P57	S51-F53 PolarHBondContact O-N 3.14Å; F53-P57 VanDerWaalsContact O-CD 3.25Å; F53-P57 WeakPolarHBondContact O-CD 3.43Å; F53-P57 VanDerWaalsContact O-CG 3.26Å; F53-P57 WeakPolarHBondContact O-CG 3.33Å
54	K	96.9	Very high	97.7	Very high	169 Å²	169	104 Å²	104	74%	0.735	52%	0.515	S	S	*	.	H	α-helix	trans	-87	-33.3	173.5	-62.9	177.3	-178.5	173.2	0	111.5	S51 F52	S51-K54 WeakPolarHBondContact O-CB 3.49Å; S51-K54 PolarHBondContact O-N 2.95Å; F52-K54 PolarHBondContact O-N 3.28Å
55	V	97.7	Very high	97.7	Very high	88 Å²	88	104.2 Å²	104.2	53%	0.533	51%	0.512	S	S	.	.	H	α-helix	trans	-100.9	-42.1	-172.6	-178.4	0	0	0	0	112.3	S51 F52 P58 M59	S51-V55 PolarHBondContact O-N 3.14Å; F52-V55 PolarHBondContact O-N 3.15Å; V55-P58 WeakPolarHBondContact O-CD 3.27Å; V55-P58 WeakPolarHBondContact O-CG 3.45Å; V55-M59 HydrophobicContact CG1-CG 4.32Å; V55-M59 VanDerWaalsContact O-CG 3.23Å; V55-M59 WeakPolarHBondContact O-CG 3.4Å
56	A	98	Very high	97.7	Very high	15 Å²	15	103.6 Å²	103.6	12%	0.124	51%	0.51	C	S	.	.	H	α-helix	trans	-65.7	-43.1	-173.1	0	0	0	0	0	113.8	F52 M59 I60	F52-A56 HydrophobicContact CD1-CB 4.24Å; F52-A56 HydrophobicContact CD2-CB 4.04Å; F52-A56 HydrophobicContact CE1-CB 3.97Å; F52-A56 HydrophobicContact CE2-CB 3.78Å; F52-A56 HydrophobicContact CG-CB 4.27Å; F52-A56 HydrophobicContact CZ-CB 3.74Å; F52-A56 WeakPolarHBondContact O-CB 3.45Å; F52-A56 PolarHBondContact O-N 3.01Å; A56-M59 PolarHBondContact O-N 2.96Å; A56-I60 HydrophobicContact CB-CD1 4.21Å; A56-I60 WeakPolarHBondContact O-CB 3.49Å; A56-I60 VanDerWaalsContact O-CG1 3.25Å; A56-I60 WeakPolarHBondContact O-CG1 3.35Å; A56-I60 PolarHBondContact O-N 3.4Å
57	P	97.9	Very high	97.8	Very high	64 Å²	64	99 Å²	99	42%	0.416	50%	0.501	S	S	.	.	H	α-helix	trans	-58.3	-50.7	-176.9	-26	36.1	0	0	0	115.2	F53 M59 I60 L61	F53-P57 VanDerWaalsContact O-CD 3.25Å; F53-P57 WeakPolarHBondContact O-CD 3.43Å; F53-P57 VanDerWaalsContact O-CG 3.26Å; F53-P57 WeakPolarHBondContact O-CG 3.33Å; P57-M59 VanDerWaalsContact C-N 3.31Å; P57-M59 PolarHBondContact O-N 2.89Å; P57-I60 PolarHBondContact O-N 3.37Å; P57-L61 WeakPolarHBondContact O-CB 3.49Å; P57-L61 PolarHBondContact O-N 3.4Å
58	P	97.8	Very high	97.8	Very high	69 Å²	69	98.9 Å²	98.9	45%	0.448	50%	0.501	S	S	.	.	H	α-helix	trans	-65.7	-33.9	178.1	25.3	-34	0	0	0	112.6	V55 T62	V55-P58 WeakPolarHBondContact O-CD 3.27Å; V55-P58 WeakPolarHBondContact O-CG 3.45Å; P58-T62 WeakPolarHBondContact O-CB 3.25Å; P58-T62 PolarHBondContact O-N 3.04Å; P58-T62 PolarHBondContact O-OG1 3.38Å
59	M	98.1	Very high	97.8	Very high	131 Å²	131	95.2 Å²	95.2	65%	0.645	49%	0.492	S	S	*	.	H	α-helix	trans	-64.5	-46.6	176.2	-69.5	-66.6	-67.3	0	0	111.9	V55 A56 P57 T62 Y63	V55-M59 HydrophobicContact CG1-CG 4.32Å; V55-M59 VanDerWaalsContact O-CG 3.23Å; V55-M59 WeakPolarHBondContact O-CG 3.4Å; A56-M59 PolarHBondContact O-N 2.96Å; P57-M59 VanDerWaalsContact C-N 3.31Å; P57-M59 PolarHBondContact O-N 2.89Å; M59-T62 PolarHBondContact O-N 2.97Å; M59-Y63 PolarHBondContact O-N 2.88Å
60	I	98.3	Very high	97.9	Very high	95 Å²	95	96.2 Å²	96.2	49%	0.487	50%	0.496	S	S	.	.	H	α-helix	trans	-62.9	-46.9	177.5	-67.5	164.5	0	0	0	109.8	A56 P57 T62 Y63 L64	A56-I60 HydrophobicContact CB-CD1 4.21Å; A56-I60 WeakPolarHBondContact O-CB 3.49Å; A56-I60 VanDerWaalsContact O-CG1 3.25Å; A56-I60 WeakPolarHBondContact O-CG1 3.35Å; A56-I60 PolarHBondContact O-N 3.4Å; P57-I60 PolarHBondContact O-N 3.37Å; I60-T62 VanDerWaalsContact C-N 3.3Å; I60-T62 PolarHBondContact O-N 2.95Å; I60-Y63 WeakPolarHBondContact O-CB 3.36Å; I60-Y63 PolarHBondContact O-N 3.01Å; I60-Y63 VanDerWaalsContact O-N 3.17Å; I60-L64 HydrophobicContact CG2-CD1 4.13Å; I60-L64 HydrophobicContact CG2-CG 4.37Å; I60-L64 WeakPolarHBondContact O-CG 3.4Å; I60-L64 PolarHBondContact O-N 3.36Å
61	L	98.4	Very high	97.9	Very high	103 Å²	103	98.6 Å²	98.6	54%	0.539	50%	0.498	S	S	.	.	H	α-helix	trans	-58	-44.7	179.1	-178.7	61.9	0	0	0	111.7	P57 Y63 L64 I65	P57-L61 WeakPolarHBondContact O-CB 3.49Å; P57-L61 PolarHBondContact O-N 3.4Å; L61-Y63 VanDerWaalsContact C-N 3.33Å; L61-Y63 PolarHBondContact O-N 3.25Å; L61-L64 PolarHBondContact O-N 3.44Å; L61-I65 HydrophobicContact CD1-CD1 4.27Å; L61-I65 HydrophobicContact CG-CD1 4.04Å; L61-I65 WeakPolarHBondContact O-CG1 3.19Å; L61-I65 PolarHBondContact O-N 3.34Å
62	T	98.4	Very high	97.9	Very high	93 Å²	93	98.4 Å²	98.4	57%	0.571	49%	0.494	S	S	*	.	H	α-helix	trans	-61.2	-43.5	177.9	-57	0	0	0	0	111.3	P58 M59 I60 L64 I65 Y66	P58-T62 WeakPolarHBondContact O-CB 3.25Å; P58-T62 PolarHBondContact O-N 3.04Å; P58-T62 PolarHBondContact O-OG1 3.38Å; M59-T62 PolarHBondContact O-N 2.97Å; I60-T62 VanDerWaalsContact C-N 3.3Å; I60-T62 PolarHBondContact O-N 2.95Å; T62-L64 VanDerWaalsContact C-N 3.35Å; T62-L64 PolarHBondContact O-N 3.17Å; T62-I65 PolarHBondContact O-N 3.49Å; T62-Y66 WeakPolarHBondContact O-CB 3.39Å; T62-Y66 PolarHBondContact O-N 2.96Å
63	Y	98.4	Very high	97.9	Very high	153 Å²	153	99.6 Å²	99.6	60%	0.6	50%	0.501	S	S	*	.	H	α-helix	trans	-62.9	-40.3	177.2	178.2	-104.4	0	0	0	112.6	M59 I60 L61 Y66 S67	M59-Y63 PolarHBondContact O-N 2.88Å; I60-Y63 WeakPolarHBondContact O-CB 3.36Å; I60-Y63 PolarHBondContact O-N 3.01Å; I60-Y63 VanDerWaalsContact O-N 3.17Å; L61-Y63 VanDerWaalsContact C-N 3.33Å; L61-Y63 PolarHBondContact O-N 3.25Å; Y63-Y66 PolarHBondContact O-N 3.34Å; Y63-S67 WeakPolarHBondContact O-CB 3.49Å; Y63-S67 PolarHBondContact O-N 2.94Å
64	L	98.6	Very high	98	Very high	100 Å²	100	96.8 Å²	96.8	52%	0.524	49%	0.49	S	S	.	.	H	α-helix	trans	-63.3	-46.2	176.2	-67.2	175.5	0	0	0	111.6	I60 L61 T62 Y66 S67 W68	I60-L64 HydrophobicContact CG2-CD1 4.13Å; I60-L64 HydrophobicContact CG2-CG 4.37Å; I60-L64 WeakPolarHBondContact O-CG 3.4Å; I60-L64 PolarHBondContact O-N 3.36Å; L61-L64 PolarHBondContact O-N 3.44Å; T62-L64 VanDerWaalsContact C-N 3.35Å; T62-L64 PolarHBondContact O-N 3.17Å; L64-Y66 VanDerWaalsContact C-N 3.33Å; L64-Y66 PolarHBondContact O-N 3.43Å; L64-S67 PolarHBondContact O-N 3.46Å; L64-W68 WeakPolarHBondContact O-CB 3.46Å; L64-W68 PolarHBondContact O-N 3.49Å
65	I	98.4	Very high	97.8	Very high	102 Å²	102	94.1 Å²	94.1	52%	0.523	48%	0.48	S	S	.	.	H	α-helix	trans	-60.8	-44.2	177.3	-67	166.6	0	0	0	110.6	L61 T62 W68 G69	L61-I65 HydrophobicContact CD1-CD1 4.27Å; L61-I65 HydrophobicContact CG-CD1 4.04Å; L61-I65 WeakPolarHBondContact O-CG1 3.19Å; L61-I65 PolarHBondContact O-N 3.34Å; T62-I65 PolarHBondContact O-N 3.49Å; I65-W68 PolarHBondContact O-N 3.09Å; I65-G69 PolarHBondContact O-N 2.94Å
66	Y	98.4	Very high	97.6	Very high	151 Å²	151	93.1 Å²	93.1	59%	0.592	49%	0.488	S	S	*	.	H	α-helix	trans	-59.3	-49.2	177	169.9	-100.9	0	0	0	112.2	T62 Y63 L64 G69 N70	T62-Y66 WeakPolarHBondContact O-CB 3.39Å; T62-Y66 PolarHBondContact O-N 2.96Å; Y63-Y66 PolarHBondContact O-N 3.34Å; L64-Y66 VanDerWaalsContact C-N 3.33Å; L64-Y66 PolarHBondContact O-N 3.43Å; Y66-G69 PolarHBondContact O-N 3.38Å; Y66-N70 WeakPolarHBondContact CE1-ND2 3Å; Y66-N70 WeakPolarHBondContact CE2-ND2 3.22Å; Y66-N70 PolarHBondContact O-N 3.47Å; Y66-N70 VanDerWaalsContact O-N 3.09Å; Y66-N70 PolarHBondContact O-ND2 3.41Å; Y66-N70 PolarHBondContact OH-ND2 2.98Å
67	S	98.3	Very high	97.4	Very high	50 Å²	50	98.2 Å²	98.2	35%	0.35	51%	0.507	S	S	.	.	H	α-helix	trans	-63.1	-45.9	-179.9	-175.1	0	0	0	0	111.8	Y63 L64 N70 M71	Y63-S67 WeakPolarHBondContact O-CB 3.49Å; Y63-S67 PolarHBondContact O-N 2.94Å; L64-S67 PolarHBondContact O-N 3.46Å; S67-N70 PolarHBondContact O-N 3.04Å; S67-M71 WeakPolarHBondContact O-CB 3.41Å; S67-M71 PolarHBondContact O-N 3.34Å
68	W	98.3	Very high	97.2	Very high	172 Å²	172	102.6 Å²	102.6	65%	0.652	52%	0.52	S	S	*	.	H	α-helix	trans	-60.9	-48.7	176.4	173.1	79.3	0	0	0	111.8	L64 I65 N70 M71 T72	L64-W68 WeakPolarHBondContact O-CB 3.46Å; L64-W68 PolarHBondContact O-N 3.49Å; I65-W68 PolarHBondContact O-N 3.09Å; W68-N70 VanDerWaalsContact C-N 3.32Å; W68-N70 PolarHBondContact O-N 2.79Å; W68-M71 PolarHBondContact O-N 3.34Å; W68-M71 VanDerWaalsContact O-N 3.12Å; W68-T72 PolarHBondContact NE1-OG1 3.36Å; W68-T72 PolarHBondContact O-N 3.35Å; W68-T72 PolarHBondContact O-OG1 3.42Å
69	G	98.2	Very high	96.8	Very high	28 Å²	28	107.2 Å²	107.2	29%	0.289	53%	0.533	S	S	.	.	H	α-helix	trans	-58.5	-43.4	-178.9	0	0	0	0	0	112.3	I65 Y66 H73	I65-G69 PolarHBondContact O-N 2.94Å; Y66-G69 PolarHBondContact O-N 3.38Å; G69-H73 WeakPolarHBondContact O-CB 3.45Å; G69-H73 PolarHBondContact O-N 2.86Å
70	N	98	Very high	96.4	Very high	73 Å²	73	104.7 Å²	104.7	39%	0.39	52%	0.522	S	S	.	.	H	α-helix	trans	-64.6	-44	175.6	-71.3	-22.8	0	0	0	112.2	Y66 S67 W68 H73 E74	Y66-N70 WeakPolarHBondContact CE1-ND2 3Å; Y66-N70 WeakPolarHBondContact CE2-ND2 3.22Å; Y66-N70 PolarHBondContact O-N 3.47Å; Y66-N70 VanDerWaalsContact O-N 3.09Å; Y66-N70 PolarHBondContact O-ND2 3.41Å; Y66-N70 PolarHBondContact OH-ND2 2.98Å; S67-N70 PolarHBondContact O-N 3.04Å; W68-N70 VanDerWaalsContact C-N 3.32Å; W68-N70 PolarHBondContact O-N 2.79Å; N70-H73 PolarHBondContact O-N 2.93Å; N70-E74 WeakPolarHBondContact O-CG 3.48Å; N70-E74 PolarHBondContact O-N 3.41Å
71	M	97.8	Very high	95.9	Very high	110 Å²	110	105.4 Å²	105.4	54%	0.542	53%	0.533	S	S	.	.	H	α-helix	trans	-63.6	-46.7	179.7	-174	179.9	-62.4	0	0	111.8	S67 W68 E74 Q75	S67-M71 WeakPolarHBondContact O-CB 3.41Å; S67-M71 PolarHBondContact O-N 3.34Å; W68-M71 PolarHBondContact O-N 3.34Å; W68-M71 VanDerWaalsContact O-N 3.12Å; M71-E74 PolarHBondContact O-N 3.38Å; M71-Q75 WeakPolarHBondContact O-CB 3.35Å; M71-Q75 VanDerWaalsContact O-CG 3.26Å; M71-Q75 WeakPolarHBondContact O-CG 3.26Å; M71-Q75 PolarHBondContact O-N 3.22Å
72	T	97.3	Very high	95.5	Very high	58 Å²	58	103.8 Å²	103.8	36%	0.356	53%	0.534	S	S	.	.	H	α-helix	trans	-66	-39	178.2	-60.3	0	0	0	0	111.5	W68 Q75 G76	W68-T72 PolarHBondContact NE1-OG1 3.36Å; W68-T72 PolarHBondContact O-N 3.35Å; W68-T72 PolarHBondContact O-OG1 3.42Å; T72-Q75 PolarHBondContact O-N 2.86Å; T72-G76 PolarHBondContact O-N 3.05Å
73	H	97	Very high	94.9	Very high	110 Å²	110	104.5 Å²	104.5	51%	0.509	53%	0.534	S	S	.	.	H	α-helix	trans	-62.2	-45.2	175.9	-177.6	63.4	0	0	0	112	G69 N70 G76 K77	G69-H73 WeakPolarHBondContact O-CB 3.45Å; G69-H73 PolarHBondContact O-N 2.86Å; N70-H73 PolarHBondContact O-N 2.93Å; H73-G76 PolarHBondContact O-N 2.93Å; H73-K77 PolarHBondContact CD2-NZ 3Å; H73-K77 VanDerWaalsContact CD2-NZ 3.34Å; H73-K77 WeakPolarHBondContact NE2-CE 3.44Å; H73-K77 PolarHBondContact NE2-NZ 3.03Å; H73-K77 PolarHBondContact O-N 3.5Å
74	E	96.8	Very high	94.3	Very high	98 Å²	98	103 Å²	103	46%	0.458	53%	0.528	S	S	.	.	H	α-helix	trans	-68.6	-35	177	-71.5	-56	124.9	0	0	112.8	N70 M71 K77	N70-E74 WeakPolarHBondContact O-CG 3.48Å; N70-E74 PolarHBondContact O-N 3.41Å; M71-E74 PolarHBondContact O-N 3.38Å; E74-K77 PolarHBondContact O-N 3.24Å; E74-K77 IonicContact OE1-NZ 2.79Å; E74-K77 PolarHBondContact OE1-NZ 3.28Å
75	Q	94.6	Very high	93.5	Very high	113 Å²	113	101.7 Å²	101.7	53%	0.528	53%	0.532	S	S	.	.	H	α-helix	trans	-64.8	-43	171.9	-74.6	170.4	-5.4	0	0	111.8	M71 T72 K77 K78	M71-Q75 WeakPolarHBondContact O-CB 3.35Å; M71-Q75 VanDerWaalsContact O-CG 3.26Å; M71-Q75 WeakPolarHBondContact O-CG 3.26Å; M71-Q75 PolarHBondContact O-N 3.22Å; T72-Q75 PolarHBondContact O-N 2.86Å; Q75-K77 PolarHBondContact O-N 2.88Å; Q75-K78 WeakPolarHBondContact O-CB 3.42Å; Q75-K78 PolarHBondContact O-N 3.12Å
76	G	93.4	Very high	92.8	Very high	68 Å²	68	104.5 Å²	104.5	70%	0.701	55%	0.548	S	S	*	.	H	α-helix	trans	-66.3	-20.6	179.7	0	0	0	0	0	114.4	T72 H73 K78	T72-G76 PolarHBondContact O-N 3.05Å; H73-G76 PolarHBondContact O-N 2.93Å; G76-K78 VanDerWaalsContact C-N 3.33Å
77	K	94.1	Very high	91.5	Very high	122 Å²	122	103.4 Å²	103.4	53%	0.53	55%	0.552	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.7	-20	171.8	-72.1	175.9	-173.9	162.4	0	113.3	H73 E74 Q75	H73-K77 PolarHBondContact CD2-NZ 3Å; H73-K77 VanDerWaalsContact CD2-NZ 3.34Å; H73-K77 WeakPolarHBondContact NE2-CE 3.44Å; H73-K77 PolarHBondContact NE2-NZ 3.03Å; H73-K77 PolarHBondContact O-N 3.5Å; E74-K77 PolarHBondContact O-N 3.24Å; E74-K77 IonicContact OE1-NZ 2.79Å; E74-K77 PolarHBondContact OE1-NZ 3.28Å; Q75-K77 PolarHBondContact O-N 2.88Å
78	K	92.5	Very high	89.8	Confident	156 Å²	156	113.7 Å²	113.7	68%	0.678	60%	0.595	S	S	*	*	S	Bend	trans	-77.8	134.4	-178.4	-63.4	179.8	-175.9	-176.9	0	109.2	Q75 G76	Q75-K78 WeakPolarHBondContact O-CB 3.42Å; Q75-K78 PolarHBondContact O-N 3.12Å; G76-K78 VanDerWaalsContact C-N 3.33Å
79	K	90	Very high	89.4	Confident	166 Å²	166	110.8 Å²	110.8	72%	0.722	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-62.7	135.4	173.2	-63.9	-173.3	-179.7	-174.2	0	109.6	P81 Y84	K79-P81 WeakPolarHBondContact O-CD 3.43Å; K79-Y84 HydrophobicContact CB-CE2 4.08Å; K79-Y84 HydrophobicContact CD-CE2 4.37Å
80	N	90.1	Very high	88.9	Confident	78 Å²	78	115.1 Å²	115.1	42%	0.417	61%	0.608	S	S	.	*	P	Polyproline II helix	trans	-84.4	117.2	172.9	177.9	23.9	0	0	0	109.4	A82 D83 Y84	N80-A82 PolarHBondContact O-N 2.81Å; N80-A82 PolarHBondContact OD1-N 3.4Å; N80-D83 WeakPolarHBondContact CB-OD2 3.4Å; N80-D83 PolarHBondContact ND2-OD1 3.15Å; N80-D83 PolarHBondContact O-N 3.36Å; N80-D83 VanDerWaalsContact O-N 3.15Å; N80-Y84 WeakPolarHBondContact O-CD2 3.42Å; N80-Y84 WeakPolarHBondContact O-CE2 3.46Å
81	P	87.6	Confident	88.4	Confident	110 Å²	110	117.4 Å²	117.4	71%	0.714	62%	0.62	S	S	*	*	G	3₁₀ helix	trans	-60.1	-27.4	-179.9	-24.1	34.8	0	0	0	113.7	K79 D83 Y84	K79-P81 WeakPolarHBondContact O-CD 3.43Å; P81-D83 PolarHBondContact O-N 3.35Å; P81-Y84 PolarHBondContact O-N 3.36Å
82	A	88.8	Confident	87.9	Confident	68 Å²	68	117.9 Å²	117.9	56%	0.562	63%	0.625	S	S	*	*	G	3₁₀ helix	trans	-68.7	-21.7	180	0	0	0	0	0	113.3	N80 Y84 A85	N80-A82 PolarHBondContact O-N 2.81Å; N80-A82 PolarHBondContact OD1-N 3.4Å; A82-Y84 PolarHBondContact O-N 3.18Å; A82-A85 PolarHBondContact O-N 3.44Å
83	D	85.7	Confident	87.3	Confident	108 Å²	108	121.6 Å²	121.6	58%	0.578	64%	0.641	S	S	*	*	G	3₁₀ helix	trans	-73.3	-19.2	-180	-62.1	-9.5	0	0	0	112.1	N80 P81	N80-D83 WeakPolarHBondContact CB-OD2 3.4Å; N80-D83 PolarHBondContact ND2-OD1 3.15Å; N80-D83 PolarHBondContact O-N 3.36Å; N80-D83 VanDerWaalsContact O-N 3.15Å; P81-D83 PolarHBondContact O-N 3.35Å
84	Y	85.6	Confident	86.7	Confident	122 Å²	122	122.4 Å²	122.4	48%	0.478	65%	0.65	S	S	.	*	G	3₁₀ helix	trans	-108	7.8	-179.1	-49.2	-75	0	0	0	113	K79 N80 P81 A82 N86	K79-Y84 HydrophobicContact CB-CE2 4.08Å; K79-Y84 HydrophobicContact CD-CE2 4.37Å; N80-Y84 WeakPolarHBondContact O-CD2 3.42Å; N80-Y84 WeakPolarHBondContact O-CE2 3.46Å; P81-Y84 PolarHBondContact O-N 3.36Å; A82-Y84 PolarHBondContact O-N 3.18Å; Y84-N86 VanDerWaalsContact C-N 3.32Å; Y84-N86 PolarHBondContact O-N 3.5Å
85	A	83.2	Confident	85.9	Confident	73 Å²	73	124.1 Å²	124.1	60%	0.603	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74	-21.1	-173.1	0	0	0	0	0	113.9	A82	A82-A85 PolarHBondContact O-N 3.44Å
86	N	83.9	Confident	85.3	Confident	160 Å²	160	125 Å²	125	86%	0.856	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-124.1	18.7	-179.7	-59.1	-47.5	0	0	0	112.4	Y84	Y84-N86 VanDerWaalsContact C-N 3.32Å; Y84-N86 PolarHBondContact O-N 3.5Å
87	D	71.1	Confident	84.6	Confident	128 Å²	128	129.8 Å²	129.8	68%	0.684	67%	0.672	S	S	*	*			trans	-84.5	115.2	173.3	-121.1	-1.4	0	0	0	107.3
88	E	62.6	Low	83.7	Confident	266 Å²	266	130.5 Å²	130.5	100%	1.243	69%	0.685	S	S	*	*			trans	-84.8	0	171.3	-76.5	-166.6	162.5	0	0	112

Retrieved 88 of 88 residues in 41.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).