A0A087XZK6_POEFO Loading...

Huntingtin interacting protein K

AlphaFold DB , UniProt , Accession A0A087XZK6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 121 aa.

						>A0A087XZK6_POEFO|A0A087XZK6
MAAEGDVDLDLEAEENCTGKPVEKPRKHDSGAADLERVTDYAEEKEISSSDLETAMSVIGDRRSREQKAKQEREKELAKVTIKKEDVELIMSEMEISRSMAERSLREHMGNVVEALVTLTN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.7	Very low	43.9	Very low	241 Å²	241	144.7 Å²	144.7	100%	1.187	84%	0.837	S	S	*	*				0	118.1	0	-171.8	166.3	-175.1	0	0	106.3
2	A	43.7	Very low	43.2	Very low	101 Å²	101	145.5 Å²	145.5	84%	0.835	83%	0.827	S	S	*	*			trans	64.4	145.4	178.6	0	0	0	0	0	116.9
3	A	45.5	Very low	43.5	Very low	82 Å²	82	141.4 Å²	141.4	68%	0.678	82%	0.822	S	S	*	*			cis	-178.4	115	-24.8	0	0	0	0	0	102.1
4	E	44.8	Very low	43.3	Very low	202 Å²	202	142.8 Å²	142.8	94%	0.944	82%	0.817	S	S	*	*				62	123.9	104.8	-43	-133.3	142.1	0	0	114.4
5	G	42.8	Very low	43.3	Very low	68 Å²	68	144.7 Å²	144.7	70%	0.701	82%	0.816	S	S	*	*			trans	158.2	60.8	165.4	0	0	0	0	0	115.4	V7	G5-V7 PolarHBondContact O-N 2.79Å
6	D	50.9	Low	42.6	Very low	164 Å²	164	143.9 Å²	143.9	88%	0.877	81%	0.809	S	S	*	*			trans	-50.8	128.2	151	-87.6	-87.5	0	0	0	109.4
7	V	46.2	Very low	42.5	Very low	134 Å²	134	141.5 Å²	141.5	81%	0.812	80%	0.802	S	S	*	*			trans	-139.1	108.9	163.1	-162.6	0	0	0	0	107.6	G5	G5-V7 PolarHBondContact O-N 2.79Å
8	D	40.3	Very low	42.4	Very low	145 Å²	145	139 Å²	139	78%	0.775	79%	0.791	S	S	*	*			trans	-39.9	131	179.1	-74.3	-99.3	0	0	0	114.7	D10	D8-D10 PolarHBondContact O-N 3.18Å
9	L	44	Very low	42.5	Very low	165 Å²	165	136.3 Å²	136.3	86%	0.864	80%	0.796	S	S	*	*			trans	-71.1	95.5	154.7	-89.1	103.1	0	0	0	107.8
10	D	36.8	Very low	42.7	Very low	134 Å²	134	138.4 Å²	138.4	72%	0.717	80%	0.795	S	S	*	*			trans	-95.4	108.5	164.6	-135.7	-19.3	0	0	0	109.8	D8 E12	D8-D10 PolarHBondContact O-N 3.18Å; D10-E12 PolarHBondContact O-N 3.24Å
11	L	46.1	Very low	43.1	Very low	156 Å²	156	138 Å²	138	82%	0.817	80%	0.797	S	S	*	*			trans	-98.4	72.3	-178	-157.6	112.9	0	0	0	107.4	A13	L11-A13 PolarHBondContact O-N 2.92Å
12	E	36	Very low	43.7	Very low	154 Å²	154	132.5 Å²	132.5	72%	0.72	78%	0.777	S	S	*	*			trans	-93.1	98.2	174.5	-65.8	-156.8	117.6	0	0	110.3	D10 E14	D10-E12 PolarHBondContact O-N 3.24Å; E12-E14 PolarHBondContact O-N 3.25Å
13	A	47.3	Very low	44.5	Very low	92 Å²	92	135 Å²	135	76%	0.76	77%	0.772	S	S	*	*			trans	-68.7	104.1	153.2	0	0	0	0	0	107.8	L11	L11-A13 PolarHBondContact O-N 2.92Å
14	E	39.5	Very low	45.6	Very low	161 Å²	161	139.4 Å²	139.4	75%	0.752	78%	0.776	S	S	*	*			trans	-127	109.5	165.4	-78.5	-71.7	115.7	0	0	109.3	E12 N16	E12-E14 PolarHBondContact O-N 3.25Å; E14-N16 PolarHBondContact O-N 3.47Å
15	E	43.3	Very low	46.3	Very low	172 Å²	172	135 Å²	135	80%	0.804	76%	0.764	S	S	*	*			trans	-55.5	114.5	162.3	-177.4	-173.9	141.4	0	0	109.2
16	N	33.3	Very low	47.6	Very low	132 Å²	132	142.1 Å²	142.1	71%	0.706	77%	0.77	S	S	*	*			trans	-133.4	91.8	163.8	-171.6	14.7	0	0	0	111.2	E14 T18	E14-N16 PolarHBondContact O-N 3.47Å; N16-T18 PolarHBondContact O-N 3.17Å; N16-T18 PolarHBondContact OD1-OG1 2.9Å
17	C	41.1	Very low	48.7	Very low	102 Å²	102	142.9 Å²	142.9	69%	0.689	77%	0.766	S	S	*	*			trans	-68.4	82.1	168.5	-52.9	0	0	0	0	110.8
18	T	39.7	Very low	50.2	Low	97 Å²	97	144.4 Å²	144.4	60%	0.595	76%	0.764	S	S	*	*			trans	-141.3	79.2	160.1	44.9	0	0	0	0	111	N16 K20	N16-T18 PolarHBondContact O-N 3.17Å; N16-T18 PolarHBondContact OD1-OG1 2.9Å; T18-K20 PolarHBondContact O-N 3.39Å
19	G	45.4	Very low	52.1	Low	87 Å²	87	141.7 Å²	141.7	90%	0.897	75%	0.749	S	S	*	*			trans	-63.3	94.6	173.4	0	0	0	0	0	112.1
20	K	46.7	Very low	53.8	Low	179 Å²	179	138.4 Å²	138.4	78%	0.778	74%	0.74	S	S	*	*			trans	-109.7	126	158.9	-66	-176.2	-179.8	177.7	0	107.3	T18 V22	T18-K20 PolarHBondContact O-N 3.39Å; K20-V22 PolarHBondContact O-N 3.35Å; K20-V22 VanDerWaalsContact O-N 3.1Å
21	P	49.3	Very low	56.1	Low	129 Å²	129	133.7 Å²	133.7	84%	0.838	72%	0.723	S	S	*	*			trans	-68.1	115.6	-179.9	26.6	-30.2	0	0	0	108.8	E23	P21-E23 PolarHBondContact O-N 3.48Å
22	V	55.8	Low	58	Low	126 Å²	126	128.8 Å²	128.8	76%	0.764	71%	0.705	S	S	*	*			trans	-63.6	113.4	169.4	173	0	0	0	0	107.3	K20 K24	K20-V22 PolarHBondContact O-N 3.35Å; K20-V22 VanDerWaalsContact O-N 3.1Å; V22-K24 PolarHBondContact O-N 3.43Å
23	E	59.9	Low	60.3	Low	154 Å²	154	123.7 Å²	123.7	72%	0.72	69%	0.689	S	S	*	*			trans	-62.8	102	172.1	-91.9	-151	137.7	0	0	108.9	P21 R26	P21-E23 PolarHBondContact O-N 3.48Å; E23-R26 IonicContact OE1-CZ 3.14Å; E23-R26 IonicContact OE1-NE 2.67Å; E23-R26 IonicContact OE1-NH2 3.96Å; E23-R26 PolarHBondContact OE1-NH2 3.14Å
24	K	67.8	Low	62.3	Low	174 Å²	174	124.6 Å²	124.6	76%	0.757	68%	0.681	S	S	*	*			trans	-69.8	147.1	169.2	-65.4	178.4	-175.4	173.1	0	109.1	V22 R26	V22-K24 PolarHBondContact O-N 3.43Å; K24-R26 PolarHBondContact O-N 3.07Å
25	P	61.1	Low	64.7	Low	109 Å²	109	122.7 Å²	122.7	71%	0.708	68%	0.676	S	S	*	*			trans	-55.2	127.3	178.7	22.6	-33.2	0	0	0	110.1	K27	P25-K27 VanDerWaalsContact C-N 3.31Å; P25-K27 PolarHBondContact O-N 3.44Å
26	R	69.6	Low	66.8	Low	219 Å²	219	120.8 Å²	120.8	83%	0.826	67%	0.667	S	S	*	*			trans	-63.2	87	-174.4	-66.2	-175.4	178.5	167.6	3.7	111.2	E23 K24	E23-R26 IonicContact OE1-CZ 3.14Å; E23-R26 IonicContact OE1-NE 2.67Å; E23-R26 IonicContact OE1-NH2 3.96Å; E23-R26 PolarHBondContact OE1-NH2 3.14Å; K24-R26 PolarHBondContact O-N 3.07Å
27	K	73.8	Confident	69.5	Low	179 Å²	179	123.1 Å²	123.1	78%	0.778	67%	0.666	S	S	*	*			trans	-84.3	151.2	161.2	-62.9	-177.3	-178.1	-176.5	0	107.9	P25 D29	P25-K27 VanDerWaalsContact C-N 3.31Å; P25-K27 PolarHBondContact O-N 3.44Å; K27-D29 PolarHBondContact O-N 3.13Å
28	H	77.4	Confident	71.9	Confident	167 Å²	167	123.8 Å²	123.8	77%	0.773	67%	0.666	S	S	*	*			trans	-62.7	104.3	172.9	-174.4	-90.5	0	0	0	108.7	S30	H28-S30 PolarHBondContact CE1-OG 2.91Å; H28-S30 VanDerWaalsContact CE1-OG 3.29Å; H28-S30 PolarHBondContact ND1-N 3.38Å; H28-S30 PolarHBondContact ND1-OG 3.04Å; H28-S30 PolarHBondContact O-N 2.72Å
29	D	80.1	Confident	74.3	Confident	88 Å²	88	124.7 Å²	124.7	47%	0.471	67%	0.672	S	S	.	*			trans	-77.5	-2.3	-178.6	-172.6	45.7	0	0	0	112.4	K27 G31 A32 A33	K27-D29 PolarHBondContact O-N 3.13Å; D29-G31 PolarHBondContact O-N 3.06Å; D29-A32 WeakPolarHBondContact O-CB 3.23Å; D29-A32 PolarHBondContact O-N 3.07Å; D29-A33 WeakPolarHBondContact OD2-CB 3.46Å; D29-A33 PolarHBondContact OD2-N 3.46Å
30	S	80.6	Confident	76.6	Confident	95 Å²	95	125.2 Å²	125.2	66%	0.664	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	50.1	23.1	178.3	-56.6	0	0	0	0	114.4	H28	H28-S30 PolarHBondContact CE1-OG 2.91Å; H28-S30 VanDerWaalsContact CE1-OG 3.29Å; H28-S30 PolarHBondContact ND1-N 3.38Å; H28-S30 PolarHBondContact ND1-OG 3.04Å; H28-S30 PolarHBondContact O-N 2.72Å
31	G	83.8	Confident	78.7	Confident	35 Å²	35	126.8 Å²	126.8	36%	0.361	66%	0.656	S	S	.	*	T	Hydrogen-bonded Turn	trans	79.5	11.7	-176.5	0	0	0	0	0	115.3	D29 A33 D34 L35	D29-G31 PolarHBondContact O-N 3.06Å; G31-A33 VanDerWaalsContact C-N 3.34Å; G31-A33 PolarHBondContact O-N 3.23Å; G31-D34 WeakPolarHBondContact O-CB 3.29Å; G31-D34 PolarHBondContact O-N 3.47Å; G31-L35 PolarHBondContact O-N 2.94Å
32	A	86.1	Confident	80.7	Confident	54 Å²	54	124.5 Å²	124.5	45%	0.446	65%	0.648	S	S	.	*	H	α-helix	trans	-60	-41.8	180	0	0	0	0	0	112.4	D29 D34 L35 E36	D29-A32 WeakPolarHBondContact O-CB 3.23Å; D29-A32 PolarHBondContact O-N 3.07Å; A32-D34 VanDerWaalsContact C-N 3.27Å; A32-D34 PolarHBondContact O-N 3.4Å; A32-L35 PolarHBondContact O-N 3.27Å; A32-E36 PolarHBondContact O-N 2.77Å
33	A	85.4	Confident	82.4	Confident	46 Å²	46	126.5 Å²	126.5	38%	0.38	65%	0.649	S	S	.	*	H	α-helix	trans	-68.5	-23.2	173.9	0	0	0	0	0	113.6	D29 G31 R37	D29-A33 WeakPolarHBondContact OD2-CB 3.46Å; D29-A33 PolarHBondContact OD2-N 3.46Å; G31-A33 VanDerWaalsContact C-N 3.34Å; G31-A33 PolarHBondContact O-N 3.23Å; A33-R37 WeakPolarHBondContact O-CD 3.43Å; A33-R37 VanDerWaalsContact O-CG 3.25Å; A33-R37 WeakPolarHBondContact O-CG 3.19Å
34	D	89.6	Confident	83.6	Confident	112 Å²	112	127.9 Å²	127.9	60%	0.599	66%	0.656	S	S	*	*	H	α-helix	trans	-76.1	-39.8	175.5	-167	62.8	0	0	0	110.8	G31 A32 E36 R37 V38	G31-D34 WeakPolarHBondContact O-CB 3.29Å; G31-D34 PolarHBondContact O-N 3.47Å; A32-D34 VanDerWaalsContact C-N 3.27Å; A32-D34 PolarHBondContact O-N 3.4Å; D34-E36 VanDerWaalsContact C-N 3.34Å; D34-E36 PolarHBondContact O-N 3.45Å; D34-R37 PolarHBondContact O-N 3.08Å; D34-V38 PolarHBondContact O-N 3.46Å
35	L	90.1	Very high	84.6	Confident	121 Å²	121	129.1 Å²	129.1	63%	0.634	66%	0.661	S	S	*	*	H	α-helix	trans	-64.6	-35.7	175.2	-66	176.5	0	0	0	112.8	G31 A32 R37 V38	G31-L35 PolarHBondContact O-N 2.94Å; A32-L35 PolarHBondContact O-N 3.27Å; L35-R37 VanDerWaalsContact C-N 3.32Å; L35-V38 PolarHBondContact O-N 3.05Å
36	E	85.7	Confident	85.7	Confident	132 Å²	132	132.6 Å²	132.6	62%	0.617	67%	0.668	S	S	*	*	H	α-helix	trans	-61.4	-43.2	174.7	-172.2	174.4	-170.1	0	0	111	A32 D34 V38 T39	A32-E36 PolarHBondContact O-N 2.77Å; D34-E36 VanDerWaalsContact C-N 3.34Å; D34-E36 PolarHBondContact O-N 3.45Å; E36-V38 VanDerWaalsContact C-N 3.28Å; E36-V38 PolarHBondContact O-N 3.09Å; E36-T39 PolarHBondContact O-N 3.2Å; E36-T39 PolarHBondContact O-OG1 2.92Å
37	R	89.9	Confident	86.3	Confident	181 Å²	181	128.9 Å²	128.9	68%	0.683	66%	0.663	S	S	*	*	H	α-helix	trans	-67.6	-22.7	-178.5	-67	173.3	104.6	141.8	9.5	114.4	A33 D34 L35 T39 D40	A33-R37 WeakPolarHBondContact O-CD 3.43Å; A33-R37 VanDerWaalsContact O-CG 3.25Å; A33-R37 WeakPolarHBondContact O-CG 3.19Å; D34-R37 PolarHBondContact O-N 3.08Å; L35-R37 VanDerWaalsContact C-N 3.32Å; R37-T39 PolarHBondContact O-N 2.96Å; R37-D40 WeakPolarHBondContact CA-OD2 3.33Å; R37-D40 PolarHBondContact O-N 3.39Å
38	V	91.8	Very high	86.6	Confident	115 Å²	115	124.6 Å²	124.6	70%	0.697	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.4	-21.6	174.3	172.3	0	0	0	0	111.8	D34 L35 E36	D34-V38 PolarHBondContact O-N 3.46Å; L35-V38 PolarHBondContact O-N 3.05Å; E36-V38 VanDerWaalsContact C-N 3.28Å; E36-V38 PolarHBondContact O-N 3.09Å
39	T	91.1	Very high	86.6	Confident	117 Å²	117	121.5 Å²	121.5	72%	0.718	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.2	-2	179.4	63	0	0	0	0	114.2	E36 R37	E36-T39 PolarHBondContact O-N 3.2Å; E36-T39 PolarHBondContact O-OG1 2.92Å; R37-T39 PolarHBondContact O-N 2.96Å
40	D	93.4	Very high	86.4	Confident	97 Å²	97	121.4 Å²	121.4	52%	0.519	66%	0.659	S	S	.	*	S	Bend	trans	-62.8	148.7	178.4	-77.7	-21.8	0	0	0	111.2	R37 A42	R37-D40 WeakPolarHBondContact CA-OD2 3.33Å; R37-D40 PolarHBondContact O-N 3.39Å; D40-A42 PolarHBondContact O-N 2.96Å
41	Y	91.4	Very high	85.8	Confident	213 Å²	213	122.3 Å²	122.3	84%	0.835	66%	0.656	S	S	*	*			trans	-65.7	124.2	176.7	178.5	-98.2	0	0	0	110.9
42	A	91	Very high	85.5	Confident	81 Å²	81	124.5 Å²	124.5	67%	0.669	66%	0.66	S	S	*	*			trans	-134.1	134.3	172	0	0	0	0	0	109.8	D40	D40-A42 PolarHBondContact O-N 2.96Å
43	E	90.8	Very high	85.1	Confident	168 Å²	168	129.5 Å²	129.5	79%	0.785	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-71.2	133.3	174.8	-172.4	175.7	-167.1	0	0	110.3
44	E	85.6	Confident	84.7	Confident	183 Å²	183	132 Å²	132	86%	0.855	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-68.4	136	176.8	-66.8	-166	112.7	0	0	110.6
45	K	88.9	Confident	84	Confident	199 Å²	199	129 Å²	129	87%	0.865	68%	0.675	S	S	*	*	P	Polyproline II helix	trans	-79.4	126.7	-177.3	-162.8	172.1	-174.1	174.5	0	110.8
46	E	84.9	Confident	83.6	Confident	182 Å²	182	129.1 Å²	129.1	85%	0.85	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-70.1	144.4	175.1	-61.8	-174.3	171	0	0	112
47	I	81	Confident	83.2	Confident	142 Å²	142	125.8 Å²	125.8	73%	0.728	67%	0.665	S	S	*	*			trans	-109.1	141.8	175.1	-54.9	175.2	0	0	0	108.5	S49	I47-S49 PolarHBondContact O-N 2.98Å
48	S	79.9	Confident	82.8	Confident	88 Å²	88	121.8 Å²	121.8	62%	0.615	66%	0.661	S	S	*	*			trans	-60.3	134.5	176.8	56.2	0	0	0	0	112	S50	S48-S50 PolarHBondContact O-N 3.47Å
49	S	77.1	Confident	82.2	Confident	103 Å²	103	121.9 Å²	121.9	72%	0.72	66%	0.656	S	S	*	*	G	3₁₀ helix	trans	-73.8	-4.3	-174.3	54.7	0	0	0	0	115.7	I47 D51	I47-S49 PolarHBondContact O-N 2.98Å; S49-D51 VanDerWaalsContact C-N 3.25Å; S49-D51 PolarHBondContact O-N 3.37Å; S49-D51 VanDerWaalsContact O-N 3.1Å
50	S	76.6	Confident	81.7	Confident	86 Å²	86	117.9 Å²	117.9	60%	0.601	64%	0.638	S	S	*	*	G	3₁₀ helix	trans	-61	-25.1	-166.1	54.2	0	0	0	0	115.4	S48	S48-S50 PolarHBondContact O-N 3.47Å
51	D	66.9	Low	80.9	Confident	113 Å²	113	117.9 Å²	117.9	60%	0.604	64%	0.638	S	S	*	*	G	3₁₀ helix	trans	-133.3	9.1	-175.1	-58.9	-73.5	0	0	0	114	S49 A55	S49-D51 VanDerWaalsContact C-N 3.25Å; S49-D51 PolarHBondContact O-N 3.37Å; S49-D51 VanDerWaalsContact O-N 3.1Å; D51-A55 PolarHBondContact O-N 2.96Å
52	L	78.4	Confident	80.1	Confident	82 Å²	82	116 Å²	116	43%	0.429	63%	0.63	S	S	.	*	H	α-helix	trans	-65.8	-43.6	-175.3	-113.3	164	0	0	0	112	T54 A55 M56	L52-T54 PolarHBondContact O-N 3.43Å; L52-A55 PolarHBondContact O-N 3.25Å; L52-M56 HydrophobicContact CD2-CG 4.08Å; L52-M56 HydrophobicContact CD2-SD 3.83Å; L52-M56 VanDerWaalsContact O-CB 3.3Å; L52-M56 WeakPolarHBondContact O-CB 3.45Å; L52-M56 WeakPolarHBondContact O-CG 3.4Å; L52-M56 PolarHBondContact O-N 2.93Å
53	E	78.6	Confident	79.3	Confident	158 Å²	158	120 Å²	120	74%	0.738	63%	0.627	S	S	*	*	H	α-helix	trans	-64.8	-41.1	-176	-173.6	172.4	-170.6	0	0	112.7	S57	E53-S57 WeakPolarHBondContact O-CB 3.45Å; E53-S57 PolarHBondContact O-N 3.45Å; E53-S57 PolarHBondContact O-OG 3.47Å
54	T	76	Confident	78.5	Confident	98 Å²	98	114 Å²	114	60%	0.601	60%	0.604	S	S	*	*	H	α-helix	trans	-66	-45.9	176.5	-54.9	0	0	0	0	111	L52 S57 V58	L52-T54 PolarHBondContact O-N 3.43Å; T54-S57 PolarHBondContact O-N 3.16Å; T54-V58 WeakPolarHBondContact O-CG2 3.42Å; T54-V58 PolarHBondContact O-N 2.73Å; T54-V58 VanDerWaalsContact O-N 3.14Å
55	A	75.9	Confident	77.8	Confident	50 Å²	50	114.3 Å²	114.3	41%	0.413	60%	0.597	S	S	.	*	H	α-helix	trans	-64.7	-42.4	177.6	0	0	0	0	0	112.1	D51 L52 S57 V58 I59	D51-A55 PolarHBondContact O-N 2.96Å; L52-A55 PolarHBondContact O-N 3.25Å; A55-S57 VanDerWaalsContact C-N 3.33Å; A55-S57 PolarHBondContact O-N 3.3Å; A55-V58 PolarHBondContact O-N 2.95Å; A55-I59 WeakPolarHBondContact O-CG1 3.47Å; A55-I59 PolarHBondContact O-N 3.36Å; A55-I59 VanDerWaalsContact O-N 3.12Å
56	M	80.5	Confident	76.8	Confident	123 Å²	123	110.1 Å²	110.1	61%	0.606	58%	0.581	S	S	*	*	H	α-helix	trans	-63.6	-37.8	176.1	-73.8	177.9	76.1	0	0	112	L52 I59 G60	L52-M56 HydrophobicContact CD2-CG 4.08Å; L52-M56 HydrophobicContact CD2-SD 3.83Å; L52-M56 VanDerWaalsContact O-CB 3.3Å; L52-M56 WeakPolarHBondContact O-CB 3.45Å; L52-M56 WeakPolarHBondContact O-CG 3.4Å; L52-M56 PolarHBondContact O-N 2.93Å; M56-I59 PolarHBondContact O-N 3.03Å; M56-G60 PolarHBondContact O-N 2.99Å
57	S	78.2	Confident	76	Confident	62 Å²	62	105.6 Å²	105.6	43%	0.434	56%	0.56	S	S	.	*	H	α-helix	trans	-65.1	-43	176.8	-61.9	0	0	0	0	111.9	E53 T54 A55 I59 G60 D61	E53-S57 WeakPolarHBondContact O-CB 3.45Å; E53-S57 PolarHBondContact O-N 3.45Å; E53-S57 PolarHBondContact O-OG 3.47Å; T54-S57 PolarHBondContact O-N 3.16Å; A55-S57 VanDerWaalsContact C-N 3.33Å; A55-S57 PolarHBondContact O-N 3.3Å; S57-I59 PolarHBondContact O-N 3.31Å; S57-G60 PolarHBondContact O-N 3.43Å; S57-D61 WeakPolarHBondContact O-CB 3.24Å; S57-D61 PolarHBondContact O-N 3.29Å
58	V	80.3	Confident	75.5	Confident	98 Å²	98	104.5 Å²	104.5	59%	0.594	55%	0.55	S	S	*	*	H	α-helix	trans	-63.2	-41.5	176.4	173.4	0	0	0	0	111.9	T54 A55 R62	T54-V58 WeakPolarHBondContact O-CG2 3.42Å; T54-V58 PolarHBondContact O-N 2.73Å; T54-V58 VanDerWaalsContact O-N 3.14Å; A55-V58 PolarHBondContact O-N 2.95Å; V58-R62 PolarHBondContact O-N 3.35Å; V58-R62 VanDerWaalsContact O-N 3.14Å
59	I	80.4	Confident	74.9	Confident	116 Å²	116	103.1 Å²	103.1	60%	0.595	54%	0.544	S	S	*	.	H	α-helix	trans	-67.6	-42.8	175.8	-65	168.1	0	0	0	110.6	A55 M56 S57 R62 R63	A55-I59 WeakPolarHBondContact O-CG1 3.47Å; A55-I59 PolarHBondContact O-N 3.36Å; A55-I59 VanDerWaalsContact O-N 3.12Å; M56-I59 PolarHBondContact O-N 3.03Å; S57-I59 PolarHBondContact O-N 3.31Å; I59-R62 PolarHBondContact O-N 3.25Å; I59-R63 WeakPolarHBondContact O-CB 3.32Å; I59-R63 PolarHBondContact O-N 3.49Å
60	G	80.5	Confident	74.5	Confident	33 Å²	33	104.6 Å²	104.6	34%	0.34	54%	0.537	S	S	.	.	H	α-helix	trans	-60.4	-45.5	177.5	0	0	0	0	0	112.3	M56 S57 R63 S64	M56-G60 PolarHBondContact O-N 2.99Å; S57-G60 PolarHBondContact O-N 3.43Å; G60-R63 PolarHBondContact O-N 3.46Å; G60-S64 WeakPolarHBondContact O-CB 3.19Å; G60-S64 PolarHBondContact O-N 3.16Å
61	D	76.4	Confident	73.9	Confident	97 Å²	97	104.8 Å²	104.8	52%	0.519	53%	0.529	S	S	.	.	H	α-helix	trans	-65.5	-42	178.6	-79.2	-17.4	0	0	0	112.2	S57 S64 R65	S57-D61 WeakPolarHBondContact O-CB 3.24Å; S57-D61 PolarHBondContact O-N 3.29Å; D61-S64 PolarHBondContact O-N 2.92Å; D61-R65 WeakPolarHBondContact O-CB 3.38Å; D61-R65 VanDerWaalsContact O-CG 3.27Å; D61-R65 WeakPolarHBondContact O-CG 3.44Å; D61-R65 PolarHBondContact O-N 3.4Å
62	R	74.1	Confident	73.8	Confident	175 Å²	175	105.1 Å²	105.1	66%	0.66	53%	0.526	S	S	*	.	H	α-helix	trans	-62	-50	174.4	-177	176.1	178.8	170.6	2.8	111.3	V58 I59 S64 R65 E66	V58-R62 PolarHBondContact O-N 3.35Å; V58-R62 VanDerWaalsContact O-N 3.14Å; I59-R62 PolarHBondContact O-N 3.25Å; R62-S64 VanDerWaalsContact C-N 3.32Å; R62-S64 PolarHBondContact O-N 3.49Å; R62-R65 PolarHBondContact O-N 3.43Å; R62-E66 WeakPolarHBondContact CG-OE1 3.42Å; R62-E66 IonicContact NE-OE1 3.94Å; R62-E66 PolarHBondContact NE-OE1 3.21Å; R62-E66 VanDerWaalsContact NE-OE1 3.17Å; R62-E66 WeakPolarHBondContact O-CG 3.47Å; R62-E66 PolarHBondContact O-N 3.3Å
63	R	74.9	Confident	73.2	Confident	163 Å²	163	108.8 Å²	108.8	62%	0.615	53%	0.534	S	S	*	.	H	α-helix	trans	-60.6	-42	178.3	-174.3	-178.9	-175.9	-168.8	2	111.6	I59 G60 E66 Q67	I59-R63 WeakPolarHBondContact O-CB 3.32Å; I59-R63 PolarHBondContact O-N 3.49Å; G60-R63 PolarHBondContact O-N 3.46Å; R63-E66 PolarHBondContact O-N 3.44Å; R63-Q67 HydrophobicContact CG-CG 4.46Å; R63-Q67 VanDerWaalsContact O-CB 3.31Å; R63-Q67 WeakPolarHBondContact O-CB 3.28Å; R63-Q67 VanDerWaalsContact O-CG 3.23Å; R63-Q67 WeakPolarHBondContact O-CG 3.44Å; R63-Q67 PolarHBondContact O-N 3.5Å
64	S	73.2	Confident	72.5	Confident	44 Å²	44	106 Å²	106	31%	0.308	52%	0.522	S	S	.	.	H	α-helix	trans	-64.9	-42.1	179	-178	0	0	0	0	111.8	G60 D61 R62 Q67 K68	G60-S64 WeakPolarHBondContact O-CB 3.19Å; G60-S64 PolarHBondContact O-N 3.16Å; D61-S64 PolarHBondContact O-N 2.92Å; R62-S64 VanDerWaalsContact C-N 3.32Å; R62-S64 PolarHBondContact O-N 3.49Å; S64-Q67 PolarHBondContact O-N 2.97Å; S64-K68 WeakPolarHBondContact O-CB 3.4Å; S64-K68 VanDerWaalsContact O-CG 3.27Å; S64-K68 WeakPolarHBondContact O-CG 3.39Å; S64-K68 PolarHBondContact O-N 3.25Å
65	R	70.3	Confident	71.9	Confident	188 Å²	188	107.5 Å²	107.5	71%	0.709	52%	0.52	S	S	*	.	H	α-helix	trans	-64.3	-45.8	175.6	-73.3	174.2	-175.8	-166.9	2.7	112.1	D61 R62 K68 A69	D61-R65 WeakPolarHBondContact O-CB 3.38Å; D61-R65 VanDerWaalsContact O-CG 3.27Å; D61-R65 WeakPolarHBondContact O-CG 3.44Å; D61-R65 PolarHBondContact O-N 3.4Å; R62-R65 PolarHBondContact O-N 3.43Å; R65-K68 PolarHBondContact O-N 3.3Å; R65-A69 WeakPolarHBondContact O-CB 3.47Å; R65-A69 PolarHBondContact O-N 2.88Å
66	E	68.5	Low	71.2	Confident	111 Å²	111	111.6 Å²	111.6	52%	0.519	53%	0.53	S	S	.	.	H	α-helix	trans	-63.2	-41.7	176.9	-71.3	173	-167	0	0	111.6	R62 R63 K70	R62-E66 WeakPolarHBondContact CG-OE1 3.42Å; R62-E66 IonicContact NE-OE1 3.94Å; R62-E66 PolarHBondContact NE-OE1 3.21Å; R62-E66 VanDerWaalsContact NE-OE1 3.17Å; R62-E66 WeakPolarHBondContact O-CG 3.47Å; R62-E66 PolarHBondContact O-N 3.3Å; R63-E66 PolarHBondContact O-N 3.44Å; E66-K70 WeakPolarHBondContact O-CB 3.35Å; E66-K70 PolarHBondContact O-N 3.43Å
67	Q	68.9	Low	70.3	Confident	87 Å²	87	107.2 Å²	107.2	41%	0.407	51%	0.509	S	S	.	.	H	α-helix	trans	-65.7	-42.9	175.8	-76.3	179.8	-1.1	0	0	112.5	R63 S64 K70 Q71	R63-Q67 HydrophobicContact CG-CG 4.46Å; R63-Q67 VanDerWaalsContact O-CB 3.31Å; R63-Q67 WeakPolarHBondContact O-CB 3.28Å; R63-Q67 VanDerWaalsContact O-CG 3.23Å; R63-Q67 WeakPolarHBondContact O-CG 3.44Å; R63-Q67 PolarHBondContact O-N 3.5Å; S64-Q67 PolarHBondContact O-N 2.97Å; Q67-K70 PolarHBondContact O-N 3.33Å; Q67-Q71 WeakPolarHBondContact O-CB 3.41Å; Q67-Q71 WeakPolarHBondContact O-CG 3.32Å; Q67-Q71 PolarHBondContact O-N 3.38Å
68	K	69.1	Low	69.6	Low	120 Å²	120	107.6 Å²	107.6	52%	0.522	52%	0.516	S	S	.	.	H	α-helix	trans	-63.3	-45.9	177.1	-77.1	176.7	-177.9	-177.9	0	111.6	S64 R65 K70 Q71 E72	S64-K68 WeakPolarHBondContact O-CB 3.4Å; S64-K68 VanDerWaalsContact O-CG 3.27Å; S64-K68 WeakPolarHBondContact O-CG 3.39Å; S64-K68 PolarHBondContact O-N 3.25Å; R65-K68 PolarHBondContact O-N 3.3Å; K68-K70 VanDerWaalsContact C-N 3.31Å; K68-K70 PolarHBondContact O-N 3.05Å; K68-Q71 PolarHBondContact O-N 3.19Å; K68-E72 WeakPolarHBondContact O-CB 3.21Å; K68-E72 WeakPolarHBondContact O-CG 3.17Å; K68-E72 PolarHBondContact O-N 3.36Å
69	A	67.6	Low	69	Low	58 Å²	58	110.8 Å²	110.8	48%	0.479	52%	0.522	S	S	.	.	H	α-helix	trans	-61.1	-40.5	176.5	0	0	0	0	0	111.9	R65 R73	R65-A69 WeakPolarHBondContact O-CB 3.47Å; R65-A69 PolarHBondContact O-N 2.88Å; A69-R73 PolarHBondContact O-N 3.26Å
70	K	68.6	Low	68.7	Low	134 Å²	134	106.7 Å²	106.7	58%	0.583	50%	0.502	S	S	*	.	H	α-helix	trans	-66.8	-42	175.7	-168	178.7	178.8	-174.2	0	112	E66 Q67 K68 R73 E74	E66-K70 WeakPolarHBondContact O-CB 3.35Å; E66-K70 PolarHBondContact O-N 3.43Å; Q67-K70 PolarHBondContact O-N 3.33Å; K68-K70 VanDerWaalsContact C-N 3.31Å; K68-K70 PolarHBondContact O-N 3.05Å; K70-R73 PolarHBondContact O-N 3.15Å; K70-E74 VanDerWaalsContact CE-OE1 3.28Å; K70-E74 WeakPolarHBondContact CE-OE1 3.34Å; K70-E74 WeakPolarHBondContact O-CB 3.12Å; K70-E74 VanDerWaalsContact O-CG 3.32Å; K70-E74 WeakPolarHBondContact O-CG 3.29Å; K70-E74 PolarHBondContact O-N 2.95Å
71	Q	65.4	Low	68.5	Low	91 Å²	91	111.5 Å²	111.5	43%	0.425	53%	0.525	S	S	.	.	H	α-helix	trans	-66.3	-37	177.2	-74.9	172	23.7	0	0	112.4	Q67 K68 E74 K75	Q67-Q71 WeakPolarHBondContact O-CB 3.41Å; Q67-Q71 WeakPolarHBondContact O-CG 3.32Å; Q67-Q71 PolarHBondContact O-N 3.38Å; K68-Q71 PolarHBondContact O-N 3.19Å; Q71-E74 PolarHBondContact O-N 2.82Å; Q71-K75 WeakPolarHBondContact O-CB 3.49Å; Q71-K75 WeakPolarHBondContact O-CG 3.36Å; Q71-K75 PolarHBondContact O-N 2.93Å
72	E	64.6	Low	68.9	Low	119 Å²	119	108.9 Å²	108.9	56%	0.556	51%	0.511	S	S	*	.	H	α-helix	trans	-66.3	-45.4	175	-76.4	173.2	176.6	0	0	110.8	K68 E74 K75 E76	K68-E72 WeakPolarHBondContact O-CB 3.21Å; K68-E72 WeakPolarHBondContact O-CG 3.17Å; K68-E72 PolarHBondContact O-N 3.36Å; E72-E74 VanDerWaalsContact C-N 3.33Å; E72-E74 PolarHBondContact O-N 3.35Å; E72-K75 PolarHBondContact O-N 2.97Å; E72-K75 VanDerWaalsContact O-N 3.15Å; E72-E76 WeakPolarHBondContact O-CG 3.46Å; E72-E76 PolarHBondContact O-N 2.89Å
73	R	66.3	Low	69.5	Low	159 Å²	159	106.8 Å²	106.8	60%	0.6	51%	0.506	S	S	*	.	H	α-helix	trans	-55.7	-49.1	171.2	-173	-164.3	-90.6	-132.3	-0.7	110.7	A69 K70 K75 E76 L77	A69-R73 PolarHBondContact O-N 3.26Å; K70-R73 PolarHBondContact O-N 3.15Å; R73-K75 VanDerWaalsContact C-N 3.32Å; R73-K75 PolarHBondContact O-N 2.67Å; R73-E76 PolarHBondContact O-N 3.18Å; R73-L77 HydrophobicContact CG-CD1 3.91Å; R73-L77 HydrophobicContact CG-CG 4.41Å; R73-L77 WeakPolarHBondContact O-CB 3.41Å; R73-L77 WeakPolarHBondContact O-CG 3.44Å; R73-L77 PolarHBondContact O-N 3.05Å
74	E	63.8	Low	70.1	Confident	101 Å²	101	105.6 Å²	105.6	47%	0.472	51%	0.506	S	S	.	.	H	α-helix	trans	-62.8	-35.7	178.6	-74.7	173.2	-173.6	0	0	112.7	K70 Q71 E72 L77 A78	K70-E74 VanDerWaalsContact CE-OE1 3.28Å; K70-E74 WeakPolarHBondContact CE-OE1 3.34Å; K70-E74 WeakPolarHBondContact O-CB 3.12Å; K70-E74 VanDerWaalsContact O-CG 3.32Å; K70-E74 WeakPolarHBondContact O-CG 3.29Å; K70-E74 PolarHBondContact O-N 2.95Å; Q71-E74 PolarHBondContact O-N 2.82Å; E72-E74 VanDerWaalsContact C-N 3.33Å; E72-E74 PolarHBondContact O-N 3.35Å; E74-L77 PolarHBondContact O-N 3.41Å; E74-A78 VanDerWaalsContact O-CB 3.25Å; E74-A78 WeakPolarHBondContact O-CB 3.44Å; E74-A78 PolarHBondContact O-N 3.28Å
75	K	62.7	Low	70.9	Confident	128 Å²	128	110.4 Å²	110.4	56%	0.557	52%	0.523	S	S	*	.	H	α-helix	trans	-68.8	-37.5	176	-79.1	170.5	-176.5	175.3	0	112.7	Q71 E72 R73 A78 K79	Q71-K75 WeakPolarHBondContact O-CB 3.49Å; Q71-K75 WeakPolarHBondContact O-CG 3.36Å; Q71-K75 PolarHBondContact O-N 2.93Å; E72-K75 PolarHBondContact O-N 2.97Å; E72-K75 VanDerWaalsContact O-N 3.15Å; R73-K75 VanDerWaalsContact C-N 3.32Å; R73-K75 PolarHBondContact O-N 2.67Å; K75-A78 PolarHBondContact O-N 3.38Å; K75-K79 WeakPolarHBondContact O-CG 3.26Å; K75-K79 PolarHBondContact O-N 3.4Å
76	E	61.3	Low	71.7	Confident	137 Å²	137	102.8 Å²	102.8	64%	0.64	50%	0.496	S	S	*	.	H	α-helix	trans	-69.1	-43.3	174.9	-69.8	-176.2	162.1	0	0	110.8	E72 R73 A78 K79	E72-E76 WeakPolarHBondContact O-CG 3.46Å; E72-E76 PolarHBondContact O-N 2.89Å; R73-E76 PolarHBondContact O-N 3.18Å; E76-A78 VanDerWaalsContact C-N 3.29Å; E76-A78 PolarHBondContact O-N 2.99Å; E76-K79 PolarHBondContact O-N 3.4Å
77	L	61.9	Low	72.7	Confident	31 Å²	31	97.9 Å²	97.9	16%	0.162	47%	0.474	C	S	.	.	H	α-helix	trans	-61.1	-35.6	173.4	-68	174.1	0	0	0	112.3	R73 E74 K79 V80 R106 E107	R73-L77 HydrophobicContact CG-CD1 3.91Å; R73-L77 HydrophobicContact CG-CG 4.41Å; R73-L77 WeakPolarHBondContact O-CB 3.41Å; R73-L77 WeakPolarHBondContact O-CG 3.44Å; R73-L77 PolarHBondContact O-N 3.05Å; E74-L77 PolarHBondContact O-N 3.41Å; L77-K79 VanDerWaalsContact C-N 3.32Å; L77-K79 PolarHBondContact O-N 3.42Å; L77-V80 WeakPolarHBondContact O-CB 3.38Å; L77-V80 PolarHBondContact O-N 2.87Å; L77-R106 HydrophobicContact CB-CB 3.93Å; L77-R106 HydrophobicContact CD2-CB 4.05Å; L77-R106 WeakPolarHBondContact CD2-O 3.27Å; L77-R106 VanDerWaalsContact O-CD 3.29Å; L77-R106 WeakPolarHBondContact O-CD 3.24Å; L77-R106 VanDerWaalsContact O-CG 3.26Å; L77-R106 WeakPolarHBondContact O-CG 3.29Å; L77-E107 HydrophobicContact CD1-CG 4.22Å; L77-E107 VanDerWaalsContact CD2-CA 3.47Å; L77-E107 HydrophobicContact CD2-CB 4.26Å; L77-E107 HydrophobicContact CD2-CG 3.79Å
78	A	62	Low	73.7	Confident	69 Å²	69	97.9 Å²	97.9	57%	0.57	47%	0.474	S	S	*	.	H	α-helix	trans	-72.1	-21.2	179.9	0	0	0	0	0	114.1	E74 K75 E76	E74-A78 VanDerWaalsContact O-CB 3.25Å; E74-A78 WeakPolarHBondContact O-CB 3.44Å; E74-A78 PolarHBondContact O-N 3.28Å; K75-A78 PolarHBondContact O-N 3.38Å; E76-A78 VanDerWaalsContact C-N 3.29Å; E76-A78 PolarHBondContact O-N 2.99Å
79	K	69	Low	74.8	Confident	165 Å²	165	95.8 Å²	95.8	72%	0.717	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76	-16.1	175	-69	170.5	-172.4	174.3	0	112.5	K75 E76 L77 T81	K75-K79 WeakPolarHBondContact O-CG 3.26Å; K75-K79 PolarHBondContact O-N 3.4Å; E76-K79 PolarHBondContact O-N 3.4Å; L77-K79 VanDerWaalsContact C-N 3.32Å; L77-K79 PolarHBondContact O-N 3.42Å; K79-T81 PolarHBondContact O-N 3.15Å
80	V	74.4	Confident	75.9	Confident	31 Å²	31	93 Å²	93	19%	0.188	45%	0.445	C	S	.	.	S	Bend	trans	-71.4	116.1	178.8	-179.8	0	0	0	0	109.1	L77 I82	L77-V80 WeakPolarHBondContact O-CB 3.38Å; L77-V80 PolarHBondContact O-N 2.87Å; V80-I82 HydrophobicContact CG1-CG2 4.07Å; V80-I82 PolarHBondContact O-N 2.94Å
81	T	75.9	Confident	77.1	Confident	133 Å²	133	89.3 Å²	89.3	82%	0.816	43%	0.431	S	S	*	.			trans	-72.7	106.7	172.8	51.6	0	0	0	0	109.3	K79	K79-T81 PolarHBondContact O-N 3.15Å
82	I	83.8	Confident	78.3	Confident	42 Å²	42	88.6 Å²	88.6	22%	0.215	44%	0.436	C	S	.	.			trans	-98.6	144.3	175.8	61.5	175.6	0	0	0	110.4	V80 V87 E102 L105 R106	V80-I82 HydrophobicContact CG1-CG2 4.07Å; V80-I82 PolarHBondContact O-N 2.94Å; I82-V87 HydrophobicContact CD1-CG2 4.01Å; I82-E102 HydrophobicContact CD1-CB 3.97Å; I82-E102 HydrophobicContact CD1-CG 3.75Å; I82-L105 HydrophobicContact CG2-CB 3.88Å; I82-R106 HydrophobicContact CG2-CG 3.99Å
83	K	87.6	Confident	79.6	Confident	132 Å²	132	89.3 Å²	89.3	57%	0.574	44%	0.439	S	S	*	.			trans	-87.6	144.9	174.1	-58	178	-174.7	168.9	0	110.2	E85 D86 V87	K83-E85 VanDerWaalsContact C-N 3.32Å; K83-E85 PolarHBondContact O-N 2.84Å; K83-D86 HydrophobicContact CB-CB 4.38Å; K83-D86 WeakPolarHBondContact CB-OD2 3.46Å; K83-D86 PolarHBondContact O-N 2.84Å; K83-V87 WeakPolarHBondContact O-CG2 3.29Å; K83-V87 PolarHBondContact O-N 2.85Å
84	K	86.9	Confident	80.7	Confident	138 Å²	138	84.8 Å²	84.8	60%	0.6	43%	0.426	S	S	*	.	H	α-helix	trans	-66.1	-36.2	177.9	-169	179.5	-179.8	-104.5	0	112.2	D86 V87 E88	K84-D86 VanDerWaalsContact C-N 3.34Å; K84-D86 PolarHBondContact O-N 3.49Å; K84-V87 PolarHBondContact O-N 3.17Å; K84-E88 VanDerWaalsContact CE-OE1 3.29Å; K84-E88 WeakPolarHBondContact CE-OE1 3.34Å; K84-E88 IonicContact NZ-OE1 2.82Å; K84-E88 PolarHBondContact NZ-OE1 3.05Å; K84-E88 WeakPolarHBondContact O-CG 3.35Å; K84-E88 PolarHBondContact O-N 2.89Å
85	E	90	Very high	82	Confident	145 Å²	145	88.5 Å²	88.5	68%	0.678	44%	0.443	S	S	*	.	H	α-helix	trans	-58.6	-45.8	177	-67	159.5	-166.9	0	0	111.3	K83 V87 E88 L89	K83-E85 VanDerWaalsContact C-N 3.32Å; K83-E85 PolarHBondContact O-N 2.84Å; E85-V87 VanDerWaalsContact C-N 3.33Å; E85-V87 PolarHBondContact O-N 3.17Å; E85-E88 PolarHBondContact O-N 3.45Å; E85-L89 WeakPolarHBondContact O-CB 3.32Å; E85-L89 PolarHBondContact O-N 3.47Å
86	D	88	Confident	83.3	Confident	27 Å²	27	84.3 Å²	84.3	14%	0.144	43%	0.426	C	S	.	.	H	α-helix	trans	-65.1	-36.8	179.7	-60.2	-18.9	0	0	0	112	K83 K84 I90 L105 V112	K83-D86 HydrophobicContact CB-CB 4.38Å; K83-D86 WeakPolarHBondContact CB-OD2 3.46Å; K83-D86 PolarHBondContact O-N 2.84Å; K84-D86 VanDerWaalsContact C-N 3.34Å; K84-D86 PolarHBondContact O-N 3.49Å; D86-I90 WeakPolarHBondContact O-CG1 3.42Å; D86-I90 PolarHBondContact O-N 2.96Å; D86-I90 VanDerWaalsContact O-N 3.16Å; D86-L105 HydrophobicContact CB-CD1 3.95Å; D86-L105 HydrophobicContact CB-CD2 4.31Å; D86-V112 HydrophobicContact CB-CG2 3.61Å; D86-V112 WeakPolarHBondContact OD1-CG2 3.23Å; D86-V112 WeakPolarHBondContact OD2-CG2 3.31Å
87	V	88.5	Confident	84.7	Confident	8 Å²	8	80.9 Å²	80.9	5%	0.048	42%	0.417	C	S	.	.	H	α-helix	trans	-66.7	-44.8	175	176.6	0	0	0	0	110.6	I82 K83 K84 E85 L89 I90 M91 R98 A101 E102 L105	I82-V87 HydrophobicContact CD1-CG2 4.01Å; K83-V87 WeakPolarHBondContact O-CG2 3.29Å; K83-V87 PolarHBondContact O-N 2.85Å; K84-V87 PolarHBondContact O-N 3.17Å; E85-V87 VanDerWaalsContact C-N 3.33Å; E85-V87 PolarHBondContact O-N 3.17Å; V87-L89 VanDerWaalsContact C-N 3.35Å; V87-I90 PolarHBondContact O-N 3.37Å; V87-M91 HydrophobicContact CG1-CG 4.41Å; V87-M91 HydrophobicContact CG1-SD 4.02Å; V87-M91 WeakPolarHBondContact O-CB 3.44Å; V87-M91 VanDerWaalsContact O-CG 3.24Å; V87-M91 WeakPolarHBondContact O-CG 3.47Å; V87-M91 PolarHBondContact O-N 3.31Å; V87-R98 HydrophobicContact CG1-CG 3.99Å; V87-A101 HydrophobicContact CG1-CB 4.17Å; V87-E102 HydrophobicContact CG1-CG 3.98Å; V87-E102 HydrophobicContact CG2-CG 3.93Å; V87-L105 HydrophobicContact CB-CD1 4.29Å; V87-L105 HydrophobicContact CG2-CD1 3.54Å
88	E	91	Very high	86	Confident	88 Å²	88	85.7 Å²	85.7	41%	0.411	43%	0.433	S	S	.	.	H	α-helix	trans	-63.9	-40.4	179.1	-75	177.2	-175.7	0	0	111.7	K84 E85 M91 S92	K84-E88 VanDerWaalsContact CE-OE1 3.29Å; K84-E88 WeakPolarHBondContact CE-OE1 3.34Å; K84-E88 IonicContact NZ-OE1 2.82Å; K84-E88 PolarHBondContact NZ-OE1 3.05Å; K84-E88 WeakPolarHBondContact O-CG 3.35Å; K84-E88 PolarHBondContact O-N 2.89Å; E85-E88 PolarHBondContact O-N 3.45Å; E88-M91 PolarHBondContact O-N 2.86Å; E88-S92 PolarHBondContact O-N 3.22Å; E88-S92 PolarHBondContact O-OG 3.12Å
89	L	92.8	Very high	87.3	Confident	75 Å²	75	85.8 Å²	85.8	39%	0.393	43%	0.43	S	S	.	.	H	α-helix	trans	-60.8	-48.3	175.7	-179.2	66.9	0	0	0	112	E85 V87 M91 S92 E93 V112	E85-L89 WeakPolarHBondContact O-CB 3.32Å; E85-L89 PolarHBondContact O-N 3.47Å; V87-L89 VanDerWaalsContact C-N 3.35Å; L89-M91 VanDerWaalsContact C-N 3.33Å; L89-M91 PolarHBondContact O-N 2.84Å; L89-S92 PolarHBondContact O-N 2.97Å; L89-S92 PolarHBondContact O-OG 3.44Å; L89-E93 HydrophobicContact CD1-CG 3.96Å; L89-E93 HydrophobicContact CG-CG 4.44Å; L89-E93 WeakPolarHBondContact O-CB 3.2Å; L89-E93 WeakPolarHBondContact O-CG 3.34Å; L89-E93 PolarHBondContact O-N 3.46Å; L89-V112 HydrophobicContact CD2-CG1 4.07Å
90	I	89.6	Confident	88.1	Confident	0 Å²	0	82.5 Å²	82.5	0%	0	42%	0.418	C	S	.	.	H	α-helix	trans	-66.6	-38.5	179.2	-66.7	173.5	0	0	0	110.9	D86 V87 S92 M94 I96 A101 L105 A115 L116 L119	D86-I90 WeakPolarHBondContact O-CG1 3.42Å; D86-I90 PolarHBondContact O-N 2.96Å; D86-I90 VanDerWaalsContact O-N 3.16Å; V87-I90 PolarHBondContact O-N 3.37Å; I90-S92 VanDerWaalsContact C-N 3.33Å; I90-S92 PolarHBondContact O-N 3.42Å; I90-M94 HydrophobicContact CG2-CB 4.45Å; I90-M94 HydrophobicContact CG2-CG 4.29Å; I90-M94 VanDerWaalsContact O-CB 3.32Å; I90-M94 WeakPolarHBondContact O-CB 3.25Å; I90-M94 PolarHBondContact O-N 2.93Å; I90-I96 HydrophobicContact CG2-CD1 3.67Å; I90-I96 HydrophobicContact CG2-CG1 4.11Å; I90-A101 HydrophobicContact CB-CB 4.17Å; I90-A101 HydrophobicContact CG2-CB 3.84Å; I90-L105 HydrophobicContact CD1-CD1 3.88Å; I90-L105 HydrophobicContact CD1-CD2 3.68Å; I90-L105 HydrophobicContact CD1-CG 3.59Å; I90-A115 HydrophobicContact CD1-CB 4.06Å; I90-L116 HydrophobicContact CG1-CD2 3.95Å; I90-L116 HydrophobicContact CG1-CG 4.27Å; I90-L119 HydrophobicContact CG2-CD1 3.66Å
91	M	93.3	Very high	88.8	Confident	57 Å²	57	81 Å²	81	28%	0.281	41%	0.409	S	S	.	.	H	α-helix	trans	-61.6	-40.2	175.5	-75.6	179.5	61	0	0	112.3	V87 E88 L89 E95 R98 A101	V87-M91 HydrophobicContact CG1-CG 4.41Å; V87-M91 HydrophobicContact CG1-SD 4.02Å; V87-M91 WeakPolarHBondContact O-CB 3.44Å; V87-M91 VanDerWaalsContact O-CG 3.24Å; V87-M91 WeakPolarHBondContact O-CG 3.47Å; V87-M91 PolarHBondContact O-N 3.31Å; E88-M91 PolarHBondContact O-N 2.86Å; L89-M91 VanDerWaalsContact C-N 3.33Å; L89-M91 PolarHBondContact O-N 2.84Å; M91-E95 VanDerWaalsContact O-CA 3.29Å; M91-E95 WeakPolarHBondContact O-CA 3.4Å; M91-E95 PolarHBondContact O-N 3.43Å; M91-R98 HydrophobicContact CE-CB 4.05Å; M91-R98 VanDerWaalsContact SD-CA 3.6Å; M91-R98 HydrophobicContact SD-CB 3.55Å; M91-R98 VanDerWaalsContact SD-CB 3.55Å; M91-R98 HydrophobicContact SD-CG 3.85Å; M91-A101 HydrophobicContact CG-CB 3.9Å
92	S	92.1	Very high	89.2	Confident	75 Å²	75	76.9 Å²	76.9	52%	0.524	38%	0.381	S	S	.	.	H	α-helix	trans	-75.5	-41.7	-179.3	61.1	0	0	0	0	112.9	E88 L89 I90	E88-S92 PolarHBondContact O-N 3.22Å; E88-S92 PolarHBondContact O-OG 3.12Å; L89-S92 PolarHBondContact O-N 2.97Å; L89-S92 PolarHBondContact O-OG 3.44Å; I90-S92 VanDerWaalsContact C-N 3.33Å; I90-S92 PolarHBondContact O-N 3.42Å
93	E	90.8	Very high	89.4	Confident	135 Å²	135	81.1 Å²	81.1	63%	0.631	39%	0.394	S	S	*	.	H	α-helix	trans	-80	-40.4	-175.6	-63.9	-61.6	138.4	0	0	112.5	L89	L89-E93 HydrophobicContact CD1-CG 3.96Å; L89-E93 HydrophobicContact CG-CG 4.44Å; L89-E93 WeakPolarHBondContact O-CB 3.2Å; L89-E93 WeakPolarHBondContact O-CG 3.34Å; L89-E93 PolarHBondContact O-N 3.46Å
94	M	90	Very high	89.3	Confident	64 Å²	64	75.2 Å²	75.2	32%	0.315	37%	0.369	S	S	.	.	H	α-helix	trans	-96.2	-3.9	-177.4	-60.5	-58.7	-67.5	0	0	113.5	I90 I96 L116 L119	I90-M94 HydrophobicContact CG2-CB 4.45Å; I90-M94 HydrophobicContact CG2-CG 4.29Å; I90-M94 VanDerWaalsContact O-CB 3.32Å; I90-M94 WeakPolarHBondContact O-CB 3.25Å; I90-M94 PolarHBondContact O-N 2.93Å; M94-I96 HydrophobicContact CB-CD1 4.47Å; M94-I96 HydrophobicContact CB-CG1 4.23Å; M94-I96 HydrophobicContact CB-CG2 4.13Å; M94-I96 WeakPolarHBondContact O-CG2 3.47Å; M94-I96 PolarHBondContact O-N 3.4Å; M94-I96 VanDerWaalsContact O-N 3.09Å; M94-L116 HydrophobicContact CG-CD2 4.03Å; M94-L116 HydrophobicContact SD-CD2 4.47Å; M94-L119 HydrophobicContact CE-CB 3.73Å; M94-L119 WeakPolarHBondContact CE-O 3.43Å; M94-L119 HydrophobicContact CG-CD1 4.18Å
95	E	90.3	Very high	89.4	Confident	178 Å²	178	68.7 Å²	68.7	83%	0.832	34%	0.341	S	S	*	.			trans	52.1	30.9	-177.2	-59.5	-168.3	143.6	0	0	114.2	M91	M91-E95 VanDerWaalsContact O-CA 3.29Å; M91-E95 WeakPolarHBondContact O-CA 3.4Å; M91-E95 PolarHBondContact O-N 3.43Å
96	I	90.6	Very high	89.2	Confident	41 Å²	41	65.3 Å²	65.3	21%	0.21	32%	0.322	C	S	.	.			trans	-94.9	156	179.6	64	176.4	0	0	0	112.5	I90 M94 M100 A101 L119	I90-I96 HydrophobicContact CG2-CD1 3.67Å; I90-I96 HydrophobicContact CG2-CG1 4.11Å; M94-I96 HydrophobicContact CB-CD1 4.47Å; M94-I96 HydrophobicContact CB-CG1 4.23Å; M94-I96 HydrophobicContact CB-CG2 4.13Å; M94-I96 WeakPolarHBondContact O-CG2 3.47Å; M94-I96 PolarHBondContact O-N 3.4Å; M94-I96 VanDerWaalsContact O-N 3.09Å; I96-M100 HydrophobicContact CB-CB 4.42Å; I96-M100 HydrophobicContact CD1-CB 4.1Å; I96-A101 HydrophobicContact CD1-CB 4.04Å; I96-A101 HydrophobicContact CG1-CB 4.15Å; I96-L119 HydrophobicContact CD1-CD1 3.96Å; I96-L119 HydrophobicContact CD1-CD2 4.23Å
97	S	91.4	Very high	89.1	Confident	65 Å²	65	68.3 Å²	68.3	46%	0.455	34%	0.335	S	S	.	.			trans	-61.5	148.8	173.8	69.3	0	0	0	0	111.9	S99 M100 A101	S97-S99 PolarHBondContact O-N 2.8Å; S97-S99 VanDerWaalsContact O-N 3.15Å; S97-S99 PolarHBondContact OG-OG 3.46Å; S97-M100 PolarHBondContact O-N 3.14Å; S97-A101 PolarHBondContact O-N 2.79Å
98	R	87.9	Confident	89	Confident	131 Å²	131	69.6 Å²	69.6	49%	0.494	34%	0.34	S	S	.	.	H	α-helix	trans	-51.2	-41	178.5	-175.4	179.3	-69	-163.3	0.1	113	V87 M91 M100 A101 E102	V87-R98 HydrophobicContact CG1-CG 3.99Å; M91-R98 HydrophobicContact CE-CB 4.05Å; M91-R98 VanDerWaalsContact SD-CA 3.6Å; M91-R98 HydrophobicContact SD-CB 3.55Å; M91-R98 VanDerWaalsContact SD-CB 3.55Å; M91-R98 HydrophobicContact SD-CG 3.85Å; R98-M100 VanDerWaalsContact C-N 3.27Å; R98-M100 PolarHBondContact O-N 2.82Å; R98-A101 PolarHBondContact O-N 3.27Å; R98-E102 WeakPolarHBondContact CD-OE1 3.28Å; R98-E102 HydrophobicContact CG-CG 4.21Å; R98-E102 WeakPolarHBondContact CG-OE1 3.5Å; R98-E102 WeakPolarHBondContact O-CB 3.48Å; R98-E102 WeakPolarHBondContact O-CG 3.49Å; R98-E102 PolarHBondContact O-N 3.29Å
99	S	88.9	Confident	88.5	Confident	72 Å²	72	72.8 Å²	72.8	50%	0.503	36%	0.357	S	S	.	.	H	α-helix	trans	-64.3	-32.2	-179.3	55.3	0	0	0	0	112.7	S97 R103	S97-S99 PolarHBondContact O-N 2.8Å; S97-S99 VanDerWaalsContact O-N 3.15Å; S97-S99 PolarHBondContact OG-OG 3.46Å; S99-R103 WeakPolarHBondContact O-CB 3.19Å; S99-R103 PolarHBondContact O-N 3.1Å
100	M	86.4	Confident	87.9	Confident	95 Å²	95	70.1 Å²	70.1	47%	0.468	35%	0.348	S	S	.	.	H	α-helix	trans	-78.8	-41	174.9	-68.1	-150.9	72.7	0	0	112.2	I96 S97 R98 R103 S104	I96-M100 HydrophobicContact CB-CB 4.42Å; I96-M100 HydrophobicContact CD1-CB 4.1Å; S97-M100 PolarHBondContact O-N 3.14Å; R98-M100 VanDerWaalsContact C-N 3.27Å; R98-M100 PolarHBondContact O-N 2.82Å; M100-R103 PolarHBondContact O-N 3.37Å; M100-S104 PolarHBondContact O-N 3.47Å; M100-S104 PolarHBondContact O-OG 3.29Å
101	A	88.4	Confident	87.7	Confident	0 Å²	0	73.5 Å²	73.5	0%	0	37%	0.366	C	S	.	.	H	α-helix	trans	-58.9	-48.7	174.1	0	0	0	0	0	111.4	V87 I90 M91 I96 S97 R98 R103 S104 L105	V87-A101 HydrophobicContact CG1-CB 4.17Å; I90-A101 HydrophobicContact CB-CB 4.17Å; I90-A101 HydrophobicContact CG2-CB 3.84Å; M91-A101 HydrophobicContact CG-CB 3.9Å; I96-A101 HydrophobicContact CD1-CB 4.04Å; I96-A101 HydrophobicContact CG1-CB 4.15Å; S97-A101 PolarHBondContact O-N 2.79Å; R98-A101 PolarHBondContact O-N 3.27Å; A101-R103 VanDerWaalsContact C-N 3.3Å; A101-R103 PolarHBondContact O-N 3.14Å; A101-S104 PolarHBondContact O-N 2.85Å; A101-S104 PolarHBondContact O-OG 2.86Å; A101-L105 PolarHBondContact O-N 3.36Å
102	E	85.8	Confident	87.4	Confident	47 Å²	47	72 Å²	72	22%	0.22	36%	0.36	C	S	.	.	H	α-helix	trans	-63.2	-35.5	176	-69.7	-176.7	-162.8	0	0	112.8	I82 V87 R98 R106	I82-E102 HydrophobicContact CD1-CB 3.97Å; I82-E102 HydrophobicContact CD1-CG 3.75Å; V87-E102 HydrophobicContact CG1-CG 3.98Å; V87-E102 HydrophobicContact CG2-CG 3.93Å; R98-E102 WeakPolarHBondContact CD-OE1 3.28Å; R98-E102 HydrophobicContact CG-CG 4.21Å; R98-E102 WeakPolarHBondContact CG-OE1 3.5Å; R98-E102 WeakPolarHBondContact O-CB 3.48Å; R98-E102 WeakPolarHBondContact O-CG 3.49Å; R98-E102 PolarHBondContact O-N 3.29Å; E102-R106 WeakPolarHBondContact O-CB 3.37Å; E102-R106 WeakPolarHBondContact O-CG 3.47Å; E102-R106 PolarHBondContact O-N 3.03Å; E102-R106 IonicContact OE2-CZ 3.17Å; E102-R106 IonicContact OE2-NH1 2.96Å; E102-R106 PolarHBondContact OE2-NH1 3.34Å; E102-R106 IonicContact OE2-NH2 3.87Å; E102-R106 PolarHBondContact OE2-NH2 2.92Å
103	R	87.3	Confident	87.3	Confident	131 Å²	131	73.4 Å²	73.4	49%	0.494	37%	0.365	S	S	.	.	H	α-helix	trans	-63.7	-49.6	176	-179.3	-179	-64.7	146.8	2.4	110.8	S99 M100 A101 L105 R106 E107	S99-R103 WeakPolarHBondContact O-CB 3.19Å; S99-R103 PolarHBondContact O-N 3.1Å; M100-R103 PolarHBondContact O-N 3.37Å; A101-R103 VanDerWaalsContact C-N 3.3Å; A101-R103 PolarHBondContact O-N 3.14Å; R103-L105 VanDerWaalsContact C-N 3.32Å; R103-L105 PolarHBondContact O-N 3.38Å; R103-R106 PolarHBondContact O-N 3.02Å; R103-R106 VanDerWaalsContact O-N 3.16Å; R103-E107 HydrophobicContact CG-CG 4.35Å; R103-E107 WeakPolarHBondContact CG-OE1 3.35Å; R103-E107 WeakPolarHBondContact O-CB 3.47Å; R103-E107 WeakPolarHBondContact O-CG 3.27Å; R103-E107 PolarHBondContact O-N 3.47Å
104	S	86.6	Confident	87.1	Confident	7 Å²	7	71.5 Å²	71.5	5%	0.049	36%	0.356	C	S	.	.	H	α-helix	trans	-58.7	-44.1	178.8	66.1	0	0	0	0	111.6	M100 A101 R106 E107 H108	M100-S104 PolarHBondContact O-N 3.47Å; M100-S104 PolarHBondContact O-OG 3.29Å; A101-S104 PolarHBondContact O-N 2.85Å; A101-S104 PolarHBondContact O-OG 2.86Å; S104-R106 PolarHBondContact O-N 3.21Å; S104-E107 PolarHBondContact O-N 2.77Å; S104-H108 PolarHBondContact O-CD2 2.85Å; S104-H108 VanDerWaalsContact O-CD2 3.23Å; S104-H108 PolarHBondContact O-N 3.5Å; S104-H108 VanDerWaalsContact O-N 3.08Å
105	L	87.9	Confident	86.9	Confident	1 Å²	1	68.4 Å²	68.4	1%	0.005	34%	0.341	C	S	.	.	H	α-helix	trans	-65.6	-39.2	176.3	-75.4	169.1	0	0	0	112.7	I82 D86 V87 I90 A101 R103 E107 H108 M109 G110 V112 A115	I82-L105 HydrophobicContact CG2-CB 3.88Å; D86-L105 HydrophobicContact CB-CD1 3.95Å; D86-L105 HydrophobicContact CB-CD2 4.31Å; V87-L105 HydrophobicContact CB-CD1 4.29Å; V87-L105 HydrophobicContact CG2-CD1 3.54Å; I90-L105 HydrophobicContact CD1-CD1 3.88Å; I90-L105 HydrophobicContact CD1-CD2 3.68Å; I90-L105 HydrophobicContact CD1-CG 3.59Å; A101-L105 PolarHBondContact O-N 3.36Å; R103-L105 VanDerWaalsContact C-N 3.32Å; R103-L105 PolarHBondContact O-N 3.38Å; L105-E107 VanDerWaalsContact C-N 3.35Å; L105-H108 CarbonylContact O-C 3.52Å; L105-H108 PolarHBondContact O-N 2.96Å; L105-M109 PolarHBondContact O-N 3.34Å; L105-G110 WeakPolarHBondContact O-CA 3.35Å; L105-G110 PolarHBondContact O-N 2.87Å; L105-V112 HydrophobicContact CD2-CG2 4.37Å; L105-A115 HydrophobicContact CD2-CB 4.07Å
106	R	85.6	Confident	86.9	Confident	75 Å²	75	62.2 Å²	62.2	28%	0.283	31%	0.313	S	S	.	.	H	α-helix	trans	-67.2	-37.3	176.3	-73.5	178.3	-178.2	116.3	7.9	111.8	L77 I82 E102 R103 S104 H108 M109	L77-R106 HydrophobicContact CB-CB 3.93Å; L77-R106 HydrophobicContact CD2-CB 4.05Å; L77-R106 WeakPolarHBondContact CD2-O 3.27Å; L77-R106 VanDerWaalsContact O-CD 3.29Å; L77-R106 WeakPolarHBondContact O-CD 3.24Å; L77-R106 VanDerWaalsContact O-CG 3.26Å; L77-R106 WeakPolarHBondContact O-CG 3.29Å; I82-R106 HydrophobicContact CG2-CG 3.99Å; E102-R106 WeakPolarHBondContact O-CB 3.37Å; E102-R106 WeakPolarHBondContact O-CG 3.47Å; E102-R106 PolarHBondContact O-N 3.03Å; E102-R106 IonicContact OE2-CZ 3.17Å; E102-R106 IonicContact OE2-NH1 2.96Å; E102-R106 PolarHBondContact OE2-NH1 3.34Å; E102-R106 IonicContact OE2-NH2 3.87Å; E102-R106 PolarHBondContact OE2-NH2 2.92Å; R103-R106 PolarHBondContact O-N 3.02Å; R103-R106 VanDerWaalsContact O-N 3.16Å; S104-R106 PolarHBondContact O-N 3.21Å; R106-H108 VanDerWaalsContact C-N 3.28Å; R106-H108 PolarHBondContact O-N 2.85Å; R106-M109 PolarHBondContact O-N 3.38Å
107	E	85.4	Confident	86.9	Confident	90 Å²	90	63.7 Å²	63.7	42%	0.421	32%	0.324	S	S	.	.	H	α-helix	trans	-65.8	-33	177.4	-73.7	173.6	177.1	0	0	112.1	L77 R103 S104 L105	L77-E107 HydrophobicContact CD1-CG 4.22Å; L77-E107 VanDerWaalsContact CD2-CA 3.47Å; L77-E107 HydrophobicContact CD2-CB 4.26Å; L77-E107 HydrophobicContact CD2-CG 3.79Å; R103-E107 HydrophobicContact CG-CG 4.35Å; R103-E107 WeakPolarHBondContact CG-OE1 3.35Å; R103-E107 WeakPolarHBondContact O-CB 3.47Å; R103-E107 WeakPolarHBondContact O-CG 3.27Å; R103-E107 PolarHBondContact O-N 3.47Å; S104-E107 PolarHBondContact O-N 2.77Å; L105-E107 VanDerWaalsContact C-N 3.35Å
108	H	86.6	Confident	86.7	Confident	34 Å²	34	63.7 Å²	63.7	16%	0.157	32%	0.321	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99.6	24.8	178.7	-69.3	-73.2	0	0	0	114	S104 L105 R106 G110 N111 E114 A115 T118	S104-H108 PolarHBondContact O-CD2 2.85Å; S104-H108 VanDerWaalsContact O-CD2 3.23Å; S104-H108 PolarHBondContact O-N 3.5Å; S104-H108 VanDerWaalsContact O-N 3.08Å; L105-H108 CarbonylContact O-C 3.52Å; L105-H108 PolarHBondContact O-N 2.96Å; R106-H108 VanDerWaalsContact C-N 3.28Å; R106-H108 PolarHBondContact O-N 2.85Å; H108-G110 PolarHBondContact O-N 3.41Å; H108-N111 VanDerWaalsContact O-CB 3.29Å; H108-N111 WeakPolarHBondContact O-CB 3.32Å; H108-N111 PolarHBondContact O-N 3.4Å; H108-E114 HydrophobicContact CB-CB 4.1Å; H108-E114 IonicContact CG-OE2 2.95Å; H108-E114 IonicContact ND1-OE2 3.32Å; H108-E114 PolarHBondContact ND1-OE2 2.86Å; H108-E114 VanDerWaalsContact ND1-OE2 3.14Å; H108-A115 HydrophobicContact CB-CB 4.33Å; H108-T118 WeakPolarHBondContact CE1-CG2 3.39Å; H108-T118 WeakPolarHBondContact NE2-CG2 3.1Å; H108-T118 PolarHBondContact NE2-OG1 3.44Å
109	M	80.2	Confident	86.6	Confident	155 Å²	155	60.1 Å²	60.1	76%	0.764	31%	0.312	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.9	30.2	176	-61.6	178.3	-79.7	0	0	114.4	L105 R106	L105-M109 PolarHBondContact O-N 3.34Å; R106-M109 PolarHBondContact O-N 3.38Å
110	G	80.1	Confident	86.5	Confident	20 Å²	20	61.6 Å²	61.6	21%	0.206	32%	0.318	C	S	.	.	T	Hydrogen-bonded Turn	trans	81	12.7	-178.8	0	0	0	0	0	114.5	L105 H108 V112	L105-G110 WeakPolarHBondContact O-CA 3.35Å; L105-G110 PolarHBondContact O-N 2.87Å; H108-G110 PolarHBondContact O-N 3.41Å; G110-V112 PolarHBondContact O-N 3.19Å
111	N	87.1	Confident	86	Confident	71 Å²	71	65.8 Å²	65.8	38%	0.38	34%	0.343	S	S	.	.			trans	-84.7	108.2	175.2	-171.6	-18	0	0	0	111.2	H108 V113 E114 A115	H108-N111 VanDerWaalsContact O-CB 3.29Å; H108-N111 WeakPolarHBondContact O-CB 3.32Å; H108-N111 PolarHBondContact O-N 3.4Å; N111-V113 VanDerWaalsContact C-N 3.33Å; N111-V113 PolarHBondContact O-N 3.46Å; N111-V113 PolarHBondContact OD1-N 3.35Å; N111-E114 HydrophobicContact CB-CB 4.24Å; N111-E114 PolarHBondContact OD1-N 3.06Å; N111-A115 WeakPolarHBondContact O-CB 3.45Å; N111-A115 PolarHBondContact O-N 2.77Å; N111-A115 VanDerWaalsContact O-N 3.07Å
112	V	86.5	Confident	85.8	Confident	26 Å²	26	69.1 Å²	69.1	16%	0.158	36%	0.36	C	S	.	.	H	α-helix	trans	-61.2	-40.3	-179.6	-168.7	0	0	0	0	112.4	D86 L89 L105 G110 A115 L116	D86-V112 HydrophobicContact CB-CG2 3.61Å; D86-V112 WeakPolarHBondContact OD1-CG2 3.23Å; D86-V112 WeakPolarHBondContact OD2-CG2 3.31Å; L89-V112 HydrophobicContact CD2-CG1 4.07Å; L105-V112 HydrophobicContact CD2-CG2 4.37Å; G110-V112 PolarHBondContact O-N 3.19Å; V112-A115 PolarHBondContact O-N 3.24Å; V112-L116 HydrophobicContact CG1-CD1 3.94Å; V112-L116 HydrophobicContact CG1-CG 4.43Å; V112-L116 WeakPolarHBondContact O-CB 3.35Å; V112-L116 WeakPolarHBondContact O-CG 3.35Å; V112-L116 PolarHBondContact O-N 2.96Å
113	V	88.6	Confident	85.8	Confident	103 Å²	103	70.3 Å²	70.3	62%	0.624	37%	0.367	S	S	*	.	H	α-helix	trans	-69.1	-47.5	-175.6	179.4	0	0	0	0	110.1	N111 A115 L116 V117	N111-V113 VanDerWaalsContact C-N 3.33Å; N111-V113 PolarHBondContact O-N 3.46Å; N111-V113 PolarHBondContact OD1-N 3.35Å; V113-A115 VanDerWaalsContact C-N 3.34Å; V113-A115 PolarHBondContact O-N 3.25Å; V113-L116 PolarHBondContact O-N 3.35Å; V113-V117 HydrophobicContact CG1-CG2 4.41Å; V113-V117 WeakPolarHBondContact O-CB 3.17Å; V113-V117 WeakPolarHBondContact O-CG2 3.3Å; V113-V117 PolarHBondContact O-N 2.93Å
114	E	86.8	Confident	85.8	Confident	95 Å²	95	66.9 Å²	66.9	44%	0.444	36%	0.36	S	S	.	.	H	α-helix	trans	-62.4	-42.1	176.2	-83.9	-164.4	173.3	0	0	112.3	H108 N111 L116 V117 T118	H108-E114 HydrophobicContact CB-CB 4.1Å; H108-E114 IonicContact CG-OE2 2.95Å; H108-E114 IonicContact ND1-OE2 3.32Å; H108-E114 PolarHBondContact ND1-OE2 2.86Å; H108-E114 VanDerWaalsContact ND1-OE2 3.14Å; N111-E114 HydrophobicContact CB-CB 4.24Å; N111-E114 PolarHBondContact OD1-N 3.06Å; E114-L116 PolarHBondContact O-N 3.27Å; E114-V117 PolarHBondContact O-N 3.2Å; E114-T118 PolarHBondContact O-N 3.42Å; E114-T118 PolarHBondContact O-OG1 3.41Å
115	A	87.6	Confident	85.7	Confident	0 Å²	0	70.4 Å²	70.4	0%	0	38%	0.378	C	S	.	.	H	α-helix	trans	-61.7	-42	177.4	0	0	0	0	0	112.2	I90 L105 H108 N111 V112 V113 T118 L119	I90-A115 HydrophobicContact CD1-CB 4.06Å; L105-A115 HydrophobicContact CD2-CB 4.07Å; H108-A115 HydrophobicContact CB-CB 4.33Å; N111-A115 WeakPolarHBondContact O-CB 3.45Å; N111-A115 PolarHBondContact O-N 2.77Å; N111-A115 VanDerWaalsContact O-N 3.07Å; V112-A115 PolarHBondContact O-N 3.24Å; V113-A115 VanDerWaalsContact C-N 3.34Å; V113-A115 PolarHBondContact O-N 3.25Å; A115-T118 PolarHBondContact O-N 3.03Å; A115-T118 PolarHBondContact O-OG1 3.33Å; A115-T118 VanDerWaalsContact O-OG1 3.06Å; A115-L119 WeakPolarHBondContact O-CB 3.34Å; A115-L119 WeakPolarHBondContact O-CD1 3.15Å; A115-L119 WeakPolarHBondContact O-CG 3.38Å; A115-L119 PolarHBondContact O-N 3.48Å
116	L	89.1	Confident	85.6	Confident	47 Å²	47	74.8 Å²	74.8	25%	0.246	40%	0.402	C	S	.	.	H	α-helix	trans	-67	-39.3	175.4	-74.9	171.2	0	0	0	111.9	I90 M94 V112 V113 E114 L119 T120	I90-L116 HydrophobicContact CG1-CD2 3.95Å; I90-L116 HydrophobicContact CG1-CG 4.27Å; M94-L116 HydrophobicContact CG-CD2 4.03Å; M94-L116 HydrophobicContact SD-CD2 4.47Å; V112-L116 HydrophobicContact CG1-CD1 3.94Å; V112-L116 HydrophobicContact CG1-CG 4.43Å; V112-L116 WeakPolarHBondContact O-CB 3.35Å; V112-L116 WeakPolarHBondContact O-CG 3.35Å; V112-L116 PolarHBondContact O-N 2.96Å; V113-L116 PolarHBondContact O-N 3.35Å; E114-L116 PolarHBondContact O-N 3.27Å; L116-L119 PolarHBondContact O-N 3.31Å; L116-T120 WeakPolarHBondContact O-CB 3.25Å; L116-T120 PolarHBondContact O-N 3.32Å; L116-T120 VanDerWaalsContact O-N 3.13Å; L116-T120 PolarHBondContact O-OG1 3.49Å
117	V	90.1	Very high	85.6	Confident	72 Å²	72	74.7 Å²	74.7	44%	0.436	41%	0.41	S	S	.	.	H	α-helix	trans	-62.9	-43.5	176.3	169.5	0	0	0	0	110.8	V113 E114 T120 N121	V113-V117 HydrophobicContact CG1-CG2 4.41Å; V113-V117 WeakPolarHBondContact O-CB 3.17Å; V113-V117 WeakPolarHBondContact O-CG2 3.3Å; V113-V117 PolarHBondContact O-N 2.93Å; E114-V117 PolarHBondContact O-N 3.2Å; V117-T120 PolarHBondContact O-N 3.1Å; V117-N121 WeakPolarHBondContact CG1-ND2 3.46Å; V117-N121 PolarHBondContact O-N 2.93Å; V117-N121 PolarHBondContact O-ND2 3.17Å
118	T	87.8	Confident	85.6	Confident	65 Å²	65	73.6 Å²	73.6	40%	0.399	41%	0.409	S	S	.	.	H	α-helix	trans	-71.8	-29.6	178.3	52.9	0	0	0	0	113.8	H108 E114 A115 T120	H108-T118 WeakPolarHBondContact CE1-CG2 3.39Å; H108-T118 WeakPolarHBondContact NE2-CG2 3.1Å; H108-T118 PolarHBondContact NE2-OG1 3.44Å; E114-T118 PolarHBondContact O-N 3.42Å; E114-T118 PolarHBondContact O-OG1 3.41Å; A115-T118 PolarHBondContact O-N 3.03Å; A115-T118 PolarHBondContact O-OG1 3.33Å; A115-T118 VanDerWaalsContact O-OG1 3.06Å; T118-T120 PolarHBondContact O-N 3.43Å
119	L	85.9	Confident	85.5	Confident	57 Å²	57	76.7 Å²	76.7	30%	0.298	43%	0.428	S	S	.	.	H	α-helix	trans	-73.1	-16.6	172.9	-69.2	167.8	0	0	0	113	I90 M94 I96 A115 L116	I90-L119 HydrophobicContact CG2-CD1 3.66Å; M94-L119 HydrophobicContact CE-CB 3.73Å; M94-L119 WeakPolarHBondContact CE-O 3.43Å; M94-L119 HydrophobicContact CG-CD1 4.18Å; I96-L119 HydrophobicContact CD1-CD1 3.96Å; I96-L119 HydrophobicContact CD1-CD2 4.23Å; A115-L119 WeakPolarHBondContact O-CB 3.34Å; A115-L119 WeakPolarHBondContact O-CD1 3.15Å; A115-L119 WeakPolarHBondContact O-CG 3.38Å; A115-L119 PolarHBondContact O-N 3.48Å; L116-L119 PolarHBondContact O-N 3.31Å
120	T	87.7	Confident	86	Confident	103 Å²	103	70.2 Å²	70.2	63%	0.632	40%	0.4	S	S	*	.	H	α-helix	trans	-96.1	-23.8	-179.6	-52.3	0	0	0	0	113.2	L116 V117 T118	L116-T120 WeakPolarHBondContact O-CB 3.25Å; L116-T120 PolarHBondContact O-N 3.32Å; L116-T120 VanDerWaalsContact O-N 3.13Å; L116-T120 PolarHBondContact O-OG1 3.49Å; V117-T120 PolarHBondContact O-N 3.1Å; T118-T120 PolarHBondContact O-N 3.43Å
121	N	74.2	Confident	86.5	Confident	183 Å²	183	74.7 Å²	74.7	98%	0.979	42%	0.418	S	S	*	.			trans	-91.7	0	-175.5	-72.5	-57	0	0	0	114.2	V117	V117-N121 WeakPolarHBondContact CG1-ND2 3.46Å; V117-N121 PolarHBondContact O-N 2.93Å; V117-N121 PolarHBondContact O-ND2 3.17Å

Retrieved 121 of 121 residues in 120.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).