A0A087Y003_POEFO Loading...

60S ribosomal protein L29

AlphaFold DB , UniProt , Accession A0A087Y003, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 61 aa.

						>A0A087Y003_POEFO|A0A087Y003
MAKSKNHTTHNQSRKWHRNGIKKPRSNRYESLKGVDPKFLRNMRFAKKHNKKGLKAARKAA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	75.3	Confident	92.6	Very high	243 Å²	243	135.2 Å²	135.2	100%	1.197	71%	0.714	S	S	*	*				0	121	0	-78.2	-158	-65.6	0	0	109.2
2	A	84.1	Confident	93	Very high	103 Å²	103	128.6 Å²	128.6	85%	0.851	68%	0.676	S	S	*	*	P	Polyproline II helix	trans	-81.5	135.9	174.9	0	0	0	0	0	109.8
3	K	92.8	Very high	93.4	Very high	209 Å²	209	123.7 Å²	123.7	91%	0.909	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-73.2	131.1	177.4	-63.4	-159.6	-62	-177.1	0	110.3
4	S	93.8	Very high	93.7	Very high	98 Å²	98	125.2 Å²	125.2	69%	0.685	65%	0.651	S	S	*	*	P	Polyproline II helix	trans	-93	171.1	172.8	58.1	0	0	0	0	111.9	N6	S4-N6 PolarHBondContact O-OD1 3.3Å
5	K	94.9	Very high	94	Very high	171 Å²	171	122.6 Å²	122.6	74%	0.743	63%	0.633	S	S	*	*	P	Polyproline II helix	trans	-70.4	131.7	173.7	-172.4	176.2	-174.3	107	0	110.2	H7	K5-H7 WeakPolarHBondContact CE-O 3.49Å
6	N	93.4	Very high	94.2	Very high	160 Å²	160	124.3 Å²	124.3	86%	0.856	63%	0.629	S	S	*	*			trans	-89.3	-23.4	-174.2	-60.9	-34.3	0	0	0	114.3	S4	S4-N6 PolarHBondContact O-OD1 3.3Å
7	H	96.8	Very high	94.4	Very high	144 Å²	144	123.3 Å²	123.3	67%	0.667	62%	0.621	S	S	*	*			trans	-153.2	142.4	-177.6	178.3	70.3	0	0	0	112.8	K5 T9	K5-H7 WeakPolarHBondContact CE-O 3.49Å; H7-T9 PolarHBondContact NE2-OG1 3.47Å
8	T	96.1	Very high	94.6	Very high	76 Å²	76	126.4 Å²	126.4	47%	0.466	62%	0.624	S	S	.	*			trans	-154.6	132.6	170.2	-171.5	0	0	0	0	112.5	H10	T8-H10 VanDerWaalsContact C-N 3.3Å; T8-H10 WeakPolarHBondContact OG1-CB 3.46Å; T8-H10 PolarHBondContact OG1-N 2.97Å
9	T	97.3	Very high	94.6	Very high	86 Å²	86	126.9 Å²	126.9	53%	0.528	63%	0.63	S	S	.	*			trans	-94.8	9.2	167.3	-50.6	0	0	0	0	111.1	H7 N11 Q12	H7-T9 PolarHBondContact NE2-OG1 3.47Å; T9-N11 PolarHBondContact O-N 3.19Å; T9-Q12 HydrophobicContact CG2-CB 3.85Å; T9-Q12 HydrophobicContact CG2-CG 3.79Å; T9-Q12 WeakPolarHBondContact O-CB 3.4Å; T9-Q12 WeakPolarHBondContact O-CG 3.46Å; T9-Q12 PolarHBondContact O-N 2.93Å; T9-Q12 VanDerWaalsContact O-N 3.16Å
10	H	97.4	Very high	94.7	Very high	139 Å²	139	122 Å²	122	64%	0.644	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.5	136.9	176.7	-172.1	-108.1	0	0	0	110.5	T8 Q12	T8-H10 VanDerWaalsContact C-N 3.3Å; T8-H10 WeakPolarHBondContact OG1-CB 3.46Å; T8-H10 PolarHBondContact OG1-N 2.97Å; H10-Q12 PolarHBondContact O-N 3.12Å; H10-Q12 VanDerWaalsContact O-N 3.13Å
11	N	97.3	Very high	94.8	Very high	58 Å²	58	121.7 Å²	121.7	31%	0.31	61%	0.612	S	S	.	*	T	Hydrogen-bonded Turn	trans	66.3	-3.1	-176.5	-164.5	45.7	0	0	0	116.4	T9 R14 K15	T9-N11 PolarHBondContact O-N 3.19Å; N11-R14 PolarHBondContact O-N 3.2Å; N11-R14 WeakPolarHBondContact OD1-CB 3.38Å; N11-R14 WeakPolarHBondContact OD1-CD 3.35Å; N11-R14 PolarHBondContact OD1-NH1 3.48Å; N11-K15 WeakPolarHBondContact O-CG 3.4Å; N11-K15 PolarHBondContact O-N 3.19Å; N11-K15 VanDerWaalsContact O-N 3.09Å
12	Q	97.5	Very high	95.8	Very high	56 Å²	56	118.3 Å²	118.3	26%	0.262	59%	0.59	S	S	.	*	H	α-helix	trans	-64.8	-49.8	178.4	-58.4	-57.7	-26.1	0	0	111.3	T9 H10 R14 K15 W16	T9-Q12 HydrophobicContact CG2-CB 3.85Å; T9-Q12 HydrophobicContact CG2-CG 3.79Å; T9-Q12 WeakPolarHBondContact O-CB 3.4Å; T9-Q12 WeakPolarHBondContact O-CG 3.46Å; T9-Q12 PolarHBondContact O-N 2.93Å; T9-Q12 VanDerWaalsContact O-N 3.16Å; H10-Q12 PolarHBondContact O-N 3.12Å; H10-Q12 VanDerWaalsContact O-N 3.13Å; Q12-R14 VanDerWaalsContact C-N 3.33Å; Q12-R14 PolarHBondContact O-N 3.19Å; Q12-K15 PolarHBondContact O-N 3.39Å; Q12-K15 VanDerWaalsContact O-N 3.13Å; Q12-W16 HydrophobicContact CB-CH2 4.12Å; Q12-W16 HydrophobicContact CB-CZ2 3.84Å; Q12-W16 VanDerWaalsContact O-CG 3.25Å; Q12-W16 PolarHBondContact O-N 3.06Å
13	S	97.6	Very high	96.4	Very high	65 Å²	65	122.6 Å²	122.6	46%	0.455	59%	0.59	S	S	.	*	H	α-helix	trans	-56.9	-45.2	176.4	179.2	0	0	0	0	112	K15 W16 H17	S13-K15 VanDerWaalsContact C-N 3.32Å; S13-K15 PolarHBondContact O-N 3.33Å; S13-W16 PolarHBondContact O-N 3.15Å; S13-H17 WeakPolarHBondContact O-CB 3.41Å; S13-H17 PolarHBondContact O-N 3.11Å; S13-H17 PolarHBondContact O-ND1 3.27Å; S13-H17 PolarHBondContact OG-CE1 3.21Å; S13-H17 PolarHBondContact OG-ND1 2.98Å; S13-H17 VanDerWaalsContact OG-ND1 3.16Å
14	R	97.7	Very high	96.5	Very high	145 Å²	145	118.6 Å²	118.6	55%	0.547	59%	0.585	S	S	.	*	H	α-helix	trans	-60.3	-40.3	178.3	-172.1	-177.8	-61.5	103.7	-3.3	112.4	N11 Q12 R18	N11-R14 PolarHBondContact O-N 3.2Å; N11-R14 WeakPolarHBondContact OD1-CB 3.38Å; N11-R14 WeakPolarHBondContact OD1-CD 3.35Å; N11-R14 PolarHBondContact OD1-NH1 3.48Å; Q12-R14 VanDerWaalsContact C-N 3.33Å; Q12-R14 PolarHBondContact O-N 3.19Å; R14-R18 PolarHBondContact O-N 3.2Å
15	K	97.4	Very high	96.6	Very high	86 Å²	86	124.9 Å²	124.9	37%	0.374	59%	0.594	S	S	.	*	H	α-helix	trans	-66.2	-44.5	175.5	-71.6	-177.1	-61.4	169.4	0	112	N11 Q12 S13 H17 R18	N11-K15 WeakPolarHBondContact O-CG 3.4Å; N11-K15 PolarHBondContact O-N 3.19Å; N11-K15 VanDerWaalsContact O-N 3.09Å; Q12-K15 PolarHBondContact O-N 3.39Å; Q12-K15 VanDerWaalsContact O-N 3.13Å; S13-K15 VanDerWaalsContact C-N 3.32Å; S13-K15 PolarHBondContact O-N 3.33Å; K15-H17 VanDerWaalsContact C-N 3.3Å; K15-H17 PolarHBondContact O-N 2.98Å; K15-R18 WeakPolarHBondContact O-CB 3.37Å; K15-R18 PolarHBondContact O-N 3Å
16	W	97.3	Very high	96.6	Very high	149 Å²	149	122 Å²	122	56%	0.564	60%	0.595	S	S	*	*	H	α-helix	trans	-62.6	-38.4	178	-57.5	-26.5	0	0	0	112	Q12 S13 G20 I21	Q12-W16 HydrophobicContact CB-CH2 4.12Å; Q12-W16 HydrophobicContact CB-CZ2 3.84Å; Q12-W16 VanDerWaalsContact O-CG 3.25Å; Q12-W16 PolarHBondContact O-N 3.06Å; S13-W16 PolarHBondContact O-N 3.15Å; W16-G20 CarbonylContact O-C 3.58Å; W16-G20 PolarHBondContact O-N 3.46Å; W16-I21 HydrophobicContact CB-CD1 4.31Å; W16-I21 HydrophobicContact CB-CG1 4.24Å
17	H	97.9	Very high	96.7	Very high	108 Å²	108	119.3 Å²	119.3	50%	0.5	58%	0.581	S	S	.	*	H	α-helix	trans	-81.8	-17.4	179.6	-67.6	90.4	0	0	0	114.1	S13 K15 N19 G20	S13-H17 WeakPolarHBondContact O-CB 3.41Å; S13-H17 PolarHBondContact O-N 3.11Å; S13-H17 PolarHBondContact O-ND1 3.27Å; S13-H17 PolarHBondContact OG-CE1 3.21Å; S13-H17 PolarHBondContact OG-ND1 2.98Å; S13-H17 VanDerWaalsContact OG-ND1 3.16Å; K15-H17 VanDerWaalsContact C-N 3.3Å; K15-H17 PolarHBondContact O-N 2.98Å; H17-N19 VanDerWaalsContact C-N 3.25Å; H17-N19 PolarHBondContact O-N 3.16Å; H17-G20 PolarHBondContact O-N 2.98Å
18	R	97.5	Very high	96.7	Very high	179 Å²	179	122.8 Å²	122.8	68%	0.675	59%	0.588	S	S	*	*	H	α-helix	trans	-55.9	-40.9	175.1	-174.3	-177.3	-68.1	146.2	-5.9	112.2	R14 K15	R14-R18 PolarHBondContact O-N 3.2Å; K15-R18 WeakPolarHBondContact O-CB 3.37Å; K15-R18 PolarHBondContact O-N 3Å
19	N	94.5	Very high	96.7	Very high	137 Å²	137	128.1 Å²	128.1	73%	0.733	60%	0.601	S	S	*	*	S	Bend	trans	-97.7	-6.1	175	-63.1	-16.6	0	0	0	112.5	H17	H17-N19 VanDerWaalsContact C-N 3.25Å; H17-N19 PolarHBondContact O-N 3.16Å
20	G	96.8	Very high	96.6	Very high	28 Å²	28	129.9 Å²	129.9	29%	0.289	60%	0.603	S	S	.	*			trans	75.4	140.5	-174.9	0	0	0	0	0	113.4	W16 H17 K22	W16-G20 CarbonylContact O-C 3.58Å; W16-G20 PolarHBondContact O-N 3.46Å; H17-G20 PolarHBondContact O-N 2.98Å; G20-K22 PolarHBondContact O-N 3.47Å; G20-K22 VanDerWaalsContact O-N 3.17Å
21	I	97.1	Very high	96.5	Very high	116 Å²	116	127.7 Å²	127.7	60%	0.595	60%	0.604	S	S	*	*			trans	-80.8	97.6	172.6	-56.3	176.5	0	0	0	107.8	W16	W16-I21 HydrophobicContact CB-CD1 4.31Å; W16-I21 HydrophobicContact CB-CG1 4.24Å
22	K	96.9	Very high	96.5	Very high	171 Å²	171	129 Å²	129	74%	0.743	61%	0.611	S	S	*	*	P	Polyproline II helix	trans	-82.7	135.5	-179.9	-54.2	-58.1	-178.8	178.6	0	110.4	G20	G20-K22 PolarHBondContact O-N 3.47Å; G20-K22 VanDerWaalsContact O-N 3.17Å
23	K	96.3	Very high	96.5	Very high	193 Å²	193	135.8 Å²	135.8	84%	0.839	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-68.3	149.6	171.4	-65.1	-176	-178.7	-179	0	109.8
24	P	95.9	Very high	96.4	Very high	125 Å²	125	136.6 Å²	136.6	81%	0.812	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-58.3	146.8	170.4	26.5	-34.1	0	0	0	109.8	S26	P24-S26 PolarHBondContact O-N 2.92Å
25	R	95.1	Very high	96.4	Very high	230 Å²	230	132.2 Å²	132.2	87%	0.868	65%	0.647	S	S	*	*	P	Polyproline II helix	trans	-72.4	128.2	175.8	-69.9	-176.5	167.6	-169.1	-4.1	109.1
26	S	94.9	Very high	96.5	Very high	111 Å²	111	132.4 Å²	132.4	78%	0.776	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-83.4	130.5	167.4	51.4	0	0	0	0	109.6	P24	P24-S26 PolarHBondContact O-N 2.92Å
27	N	95.3	Very high	96.5	Very high	104 Å²	104	130.2 Å²	130.2	56%	0.556	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-103	154.3	172.1	-61.5	-59.3	0	0	0	109.7	Y29 E30	N27-Y29 PolarHBondContact O-N 3.11Å; N27-E30 PolarHBondContact N-OE1 3.1Å; N27-E30 VanDerWaalsContact N-OE1 3.11Å
28	R	96.7	Very high	96.5	Very high	216 Å²	216	132.3 Å²	132.3	82%	0.815	67%	0.665	S	S	*	*	S	Bend	trans	-61.9	-34.2	176.4	-175.7	-177.5	-72.9	179.1	-2.2	112
29	Y	95.8	Very high	96.5	Very high	188 Å²	188	128.8 Å²	128.8	74%	0.737	65%	0.654	S	S	*	*	S	Bend	trans	-128.2	108.3	-178.7	-53.3	-62.4	0	0	0	109.7	N27	N27-Y29 PolarHBondContact O-N 3.11Å
30	E	95.8	Very high	96.7	Very high	123 Å²	123	123.4 Å²	123.4	58%	0.575	63%	0.625	S	S	*	*			trans	-82.8	163.4	176.9	-67.3	-60.6	155.1	0	0	112.1	N27	N27-E30 PolarHBondContact N-OE1 3.1Å; N27-E30 VanDerWaalsContact N-OE1 3.11Å
31	S	95.7	Very high	96.7	Very high	94 Å²	94	129.6 Å²	129.6	66%	0.657	64%	0.64	S	S	*	*			trans	-70.5	145.4	177.6	85.2	0	0	0	0	111.8	K33	S31-K33 VanDerWaalsContact C-N 3.29Å; S31-K33 PolarHBondContact O-N 2.96Å
32	L	96.6	Very high	96.7	Very high	86 Å²	86	129 Å²	129	45%	0.45	64%	0.638	S	S	.	*			trans	-92.8	24.6	175.7	-59.3	175.3	0	0	0	113	G34 V35 L40 M43	L32-G34 PolarHBondContact O-N 3.29Å; L32-V35 HydrophobicContact CB-CG2 4.2Å; L32-V35 HydrophobicContact CD2-CG2 4.33Å; L32-V35 PolarHBondContact O-N 3.34Å; L32-L40 HydrophobicContact CB-CD2 4Å; L32-L40 HydrophobicContact CD1-CD2 4.08Å; L32-M43 HydrophobicContact CD1-CE 3.35Å; L32-M43 HydrophobicContact CD1-SD 4.11Å
33	K	96.8	Very high	96.7	Very high	197 Å²	197	122.6 Å²	122.6	86%	0.857	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.1	129.6	179.2	-176	178	177.7	-178	0	109.5	S31	S31-K33 VanDerWaalsContact C-N 3.29Å; S31-K33 PolarHBondContact O-N 2.96Å
34	G	97.1	Very high	96.7	Very high	82 Å²	82	121.9 Å²	121.9	85%	0.845	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	86.9	-0.6	179.8	0	0	0	0	0	115.3	L32	L32-G34 PolarHBondContact O-N 3.29Å
35	V	97.7	Very high	96.7	Very high	54 Å²	54	120.9 Å²	120.9	33%	0.327	59%	0.586	S	S	.	*	S	Bend	trans	-72.4	150.6	171	179.5	0	0	0	0	110	L32 F39 L40	L32-V35 HydrophobicContact CB-CG2 4.2Å; L32-V35 HydrophobicContact CD2-CG2 4.33Å; L32-V35 PolarHBondContact O-N 3.34Å; V35-F39 HydrophobicContact CG1-CD1 3.72Å; V35-F39 HydrophobicContact CG1-CE1 4.28Å; V35-L40 HydrophobicContact CB-CD1 4.15Å; V35-L40 HydrophobicContact CB-CD2 4.06Å; V35-L40 HydrophobicContact CB-CG 4.08Å; V35-L40 HydrophobicContact CG1-CD2 4.04Å; V35-L40 HydrophobicContact CG1-CG 4.12Å; V35-L40 WeakPolarHBondContact O-CD1 3.3Å
36	D	97.9	Very high	96.7	Very high	89 Å²	89	112 Å²	112	48%	0.476	56%	0.563	S	S	.	*			trans	-44.5	121.2	-179.6	168.4	45.4	0	0	0	112.7	K38 F39 L40	D36-K38 VanDerWaalsContact C-N 3.26Å; D36-K38 PolarHBondContact O-N 3.36Å; D36-K38 PolarHBondContact OD1-N 3.38Å; D36-K38 WeakPolarHBondContact OD2-CB 3.44Å; D36-K38 PolarHBondContact OD2-N 3.21Å; D36-F39 HydrophobicContact CB-CB 4.13Å; D36-F39 PolarHBondContact O-N 3.46Å; D36-F39 WeakPolarHBondContact OD2-CB 3.11Å; D36-F39 PolarHBondContact OD2-N 3.08Å; D36-L40 WeakPolarHBondContact O-CG 3.2Å; D36-L40 PolarHBondContact O-N 3.45Å
37	P	97.9	Very high	96.6	Very high	103 Å²	103	113 Å²	113	67%	0.669	55%	0.553	S	S	*	*	H	α-helix	trans	-57.9	-33.8	-179.9	-26.7	35.1	0	0	0	113.9	L40 R41	P37-L40 PolarHBondContact O-N 2.88Å; P37-R41 VanDerWaalsContact O-CB 3.3Å; P37-R41 WeakPolarHBondContact O-CB 3.42Å; P37-R41 PolarHBondContact O-N 3.36Å
38	K	98.2	Very high	96.5	Very high	153 Å²	153	114.7 Å²	114.7	67%	0.665	56%	0.555	S	S	*	*	H	α-helix	trans	-67.9	-46.2	-179.9	-179	-178.9	-179.2	179	0	110.6	D36 R41 N42	D36-K38 VanDerWaalsContact C-N 3.26Å; D36-K38 PolarHBondContact O-N 3.36Å; D36-K38 PolarHBondContact OD1-N 3.38Å; D36-K38 WeakPolarHBondContact OD2-CB 3.44Å; D36-K38 PolarHBondContact OD2-N 3.21Å; K38-R41 PolarHBondContact O-N 3.43Å; K38-N42 PolarHBondContact O-N 2.92Å; K38-N42 VanDerWaalsContact O-N 3.08Å
39	F	97.9	Very high	96.4	Very high	104 Å²	104	109.5 Å²	109.5	46%	0.456	54%	0.54	S	S	.	.	H	α-helix	trans	-59.7	-47.6	172.8	174.6	-101.1	0	0	0	112.1	V35 D36 R41 N42 M43	V35-F39 HydrophobicContact CG1-CD1 3.72Å; V35-F39 HydrophobicContact CG1-CE1 4.28Å; D36-F39 HydrophobicContact CB-CB 4.13Å; D36-F39 PolarHBondContact O-N 3.46Å; D36-F39 WeakPolarHBondContact OD2-CB 3.11Å; D36-F39 PolarHBondContact OD2-N 3.08Å; F39-R41 VanDerWaalsContact C-N 3.3Å; F39-R41 PolarHBondContact O-N 3.47Å; F39-N42 PolarHBondContact O-N 3.43Å; F39-M43 PolarHBondContact O-N 3.11Å
40	L	97.5	Very high	95.9	Very high	24 Å²	24	105.7 Å²	105.7	13%	0.126	53%	0.532	C	S	.	.	H	α-helix	trans	-60.9	-40	178.9	-71.6	-177.4	0	0	0	112.1	L32 V35 D36 P37 M43 R44	L32-L40 HydrophobicContact CB-CD2 4Å; L32-L40 HydrophobicContact CD1-CD2 4.08Å; V35-L40 HydrophobicContact CB-CD1 4.15Å; V35-L40 HydrophobicContact CB-CD2 4.06Å; V35-L40 HydrophobicContact CB-CG 4.08Å; V35-L40 HydrophobicContact CG1-CD2 4.04Å; V35-L40 HydrophobicContact CG1-CG 4.12Å; V35-L40 WeakPolarHBondContact O-CD1 3.3Å; D36-L40 WeakPolarHBondContact O-CG 3.2Å; D36-L40 PolarHBondContact O-N 3.45Å; P37-L40 PolarHBondContact O-N 2.88Å; L40-M43 HydrophobicContact CD2-CE 3.74Å; L40-M43 PolarHBondContact O-N 2.94Å; L40-R44 WeakPolarHBondContact O-CB 3.42Å; L40-R44 WeakPolarHBondContact O-CG 3.38Å; L40-R44 PolarHBondContact O-N 3.27Å
41	R	97.7	Very high	95.3	Very high	158 Å²	158	108.1 Å²	108.1	60%	0.596	54%	0.541	S	S	*	.	H	α-helix	trans	-62	-47.3	176.3	-174	171.7	69.6	117.9	0.5	111	P37 K38 F39 R44 F45	P37-R41 VanDerWaalsContact O-CB 3.3Å; P37-R41 WeakPolarHBondContact O-CB 3.42Å; P37-R41 PolarHBondContact O-N 3.36Å; K38-R41 PolarHBondContact O-N 3.43Å; F39-R41 VanDerWaalsContact C-N 3.3Å; F39-R41 PolarHBondContact O-N 3.47Å; R41-R44 PolarHBondContact O-N 3.24Å; R41-F45 HydrophobicContact CG-CD2 3.93Å; R41-F45 HydrophobicContact CG-CE2 3.54Å; R41-F45 WeakPolarHBondContact O-CD2 3.38Å; R41-F45 PolarHBondContact O-N 2.8Å; R41-F45 VanDerWaalsContact O-N 3.11Å
42	N	97.6	Very high	94.6	Very high	103 Å²	103	112.8 Å²	112.8	55%	0.551	55%	0.55	S	S	*	.	H	α-helix	trans	-59.8	-49.9	175.6	177	56.9	0	0	0	112.3	K38 F39 R44 F45 A46	K38-N42 PolarHBondContact O-N 2.92Å; K38-N42 VanDerWaalsContact O-N 3.08Å; F39-N42 PolarHBondContact O-N 3.43Å; N42-R44 VanDerWaalsContact C-N 3.27Å; N42-R44 PolarHBondContact O-N 3.48Å; N42-F45 PolarHBondContact O-N 3.41Å; N42-F45 VanDerWaalsContact O-N 3.1Å; N42-A46 PolarHBondContact O-N 3.25Å
43	M	97	Very high	93.5	Very high	38 Å²	38	110.7 Å²	110.7	19%	0.187	55%	0.548	C	S	.	.	H	α-helix	trans	-59.5	-38.4	179.6	-178.1	-169.7	55.8	0	0	111.8	L32 F39 L40 A46 K47	L32-M43 HydrophobicContact CD1-CE 3.35Å; L32-M43 HydrophobicContact CD1-SD 4.11Å; F39-M43 PolarHBondContact O-N 3.11Å; L40-M43 HydrophobicContact CD2-CE 3.74Å; L40-M43 PolarHBondContact O-N 2.94Å; M43-A46 PolarHBondContact O-N 3.3Å; M43-K47 HydrophobicContact CG-CD 4.16Å; M43-K47 WeakPolarHBondContact O-CB 3.49Å; M43-K47 WeakPolarHBondContact O-CG 3.48Å; M43-K47 PolarHBondContact O-N 3.02Å; M43-K47 PolarHBondContact SD-NZ 2.98Å
44	R	96.2	Very high	92.6	Very high	178 Å²	178	104.9 Å²	104.9	67%	0.672	53%	0.526	S	S	*	.	H	α-helix	trans	-62.9	-44.4	175.1	-74.9	171.1	-178.8	-172.3	2	111.7	L40 R41 N42 K48	L40-R44 WeakPolarHBondContact O-CB 3.42Å; L40-R44 WeakPolarHBondContact O-CG 3.38Å; L40-R44 PolarHBondContact O-N 3.27Å; R41-R44 PolarHBondContact O-N 3.24Å; N42-R44 VanDerWaalsContact C-N 3.27Å; N42-R44 PolarHBondContact O-N 3.48Å; R44-K48 WeakPolarHBondContact O-CB 3.36Å; R44-K48 PolarHBondContact O-N 3.33Å
45	F	96.1	Very high	91.5	Very high	103 Å²	103	109.7 Å²	109.7	45%	0.452	52%	0.524	S	S	.	.	H	α-helix	trans	-63.8	-44.4	175.8	-76.7	-62	0	0	0	112.3	R41 N42 K48 H49	R41-F45 HydrophobicContact CG-CD2 3.93Å; R41-F45 HydrophobicContact CG-CE2 3.54Å; R41-F45 WeakPolarHBondContact O-CD2 3.38Å; R41-F45 PolarHBondContact O-N 2.8Å; R41-F45 VanDerWaalsContact O-N 3.11Å; N42-F45 PolarHBondContact O-N 3.41Å; N42-F45 VanDerWaalsContact O-N 3.1Å; F45-K48 WeakPolarHBondContact O-CB 3.39Å; F45-K48 PolarHBondContact O-N 2.98Å; F45-H49 PolarHBondContact O-CD2 3.16Å; F45-H49 PolarHBondContact O-N 3.44Å; F45-H49 VanDerWaalsContact O-N 3.11Å
46	A	94.3	Very high	90.4	Very high	45 Å²	45	110.5 Å²	110.5	37%	0.372	54%	0.536	S	S	.	.	H	α-helix	trans	-58.4	-51.5	176.2	0	0	0	0	0	111.6	N42 M43 K48 H49 N50	N42-A46 PolarHBondContact O-N 3.25Å; M43-A46 PolarHBondContact O-N 3.3Å; A46-K48 VanDerWaalsContact C-N 3.26Å; A46-K48 PolarHBondContact O-N 3.22Å; A46-H49 PolarHBondContact O-N 3.34Å; A46-H49 VanDerWaalsContact O-N 3.15Å; A46-N50 PolarHBondContact O-N 3.17Å; A46-N50 PolarHBondContact O-OD1 3.38Å
47	K	93.4	Very high	89.4	Confident	130 Å²	130	109.3 Å²	109.3	57%	0.565	54%	0.539	S	S	*	.	H	α-helix	trans	-59	-36.3	177	-74	177.7	178.1	177.7	0	112.6	M43	M43-K47 HydrophobicContact CG-CD 4.16Å; M43-K47 WeakPolarHBondContact O-CB 3.49Å; M43-K47 WeakPolarHBondContact O-CG 3.48Å; M43-K47 PolarHBondContact O-N 3.02Å; M43-K47 PolarHBondContact SD-NZ 2.98Å
48	K	93.6	Very high	88.4	Confident	141 Å²	141	113.4 Å²	113.4	61%	0.613	54%	0.541	S	S	*	.	H	α-helix	trans	-62.7	-43.2	176.7	-177	-178.3	179.7	-178.3	0	111.9	R44 F45 A46	R44-K48 WeakPolarHBondContact O-CB 3.36Å; R44-K48 PolarHBondContact O-N 3.33Å; F45-K48 WeakPolarHBondContact O-CB 3.39Å; F45-K48 PolarHBondContact O-N 2.98Å; A46-K48 VanDerWaalsContact C-N 3.26Å; A46-K48 PolarHBondContact O-N 3.22Å
49	H	93.1	Very high	87.1	Confident	106 Å²	106	115 Å²	115	49%	0.491	55%	0.548	S	S	.	.	H	α-helix	trans	-94.6	-11.8	-172	-64.4	-63.3	0	0	0	115.1	F45 A46 K51 K52	F45-H49 PolarHBondContact O-CD2 3.16Å; F45-H49 PolarHBondContact O-N 3.44Å; F45-H49 VanDerWaalsContact O-N 3.11Å; A46-H49 PolarHBondContact O-N 3.34Å; A46-H49 VanDerWaalsContact O-N 3.15Å; H49-K51 PolarHBondContact O-N 2.75Å; H49-K52 WeakPolarHBondContact O-CB 3.39Å; H49-K52 PolarHBondContact O-N 2.92Å
50	N	87.1	Confident	85.7	Confident	108 Å²	108	114.5 Å²	114.5	58%	0.578	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.9	-29.3	176.7	-80.6	-9.3	0	0	0	114	A46 K52	A46-N50 PolarHBondContact O-N 3.17Å; A46-N50 PolarHBondContact O-OD1 3.38Å; N50-K52 VanDerWaalsContact C-N 3.27Å; N50-K52 PolarHBondContact O-N 2.76Å
51	K	82.4	Confident	83.8	Confident	174 Å²	174	119.7 Å²	119.7	76%	0.757	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67	-24.6	178.3	-61.6	-176.8	-178.2	-178.5	0	113.6	H49	H49-K51 PolarHBondContact O-N 2.75Å
52	K	80.6	Confident	83.1	Confident	193 Å²	193	117.8 Å²	117.8	84%	0.839	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.7	-35.1	-176.9	-168.6	-179.6	178.7	-177	0	112.1	H49 N50	H49-K52 WeakPolarHBondContact O-CB 3.39Å; H49-K52 PolarHBondContact O-N 2.92Å; N50-K52 VanDerWaalsContact C-N 3.27Å; N50-K52 PolarHBondContact O-N 2.76Å
53	G	74.1	Confident	82.3	Confident	41 Å²	41	118.6 Å²	118.6	42%	0.423	61%	0.613	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87.1	-3.6	-179.6	0	0	0	0	0	114.7	K55 A56 A57	G53-K55 VanDerWaalsContact C-N 3.34Å; G53-K55 PolarHBondContact O-N 3.13Å; G53-A56 PolarHBondContact O-N 3.09Å; G53-A57 WeakPolarHBondContact O-CB 3.44Å; G53-A57 PolarHBondContact O-N 3.35Å
54	L	78.1	Confident	81.5	Confident	75 Å²	75	123.1 Å²	123.1	39%	0.393	64%	0.637	S	S	.	*	H	α-helix	trans	-64.8	-34.9	-167.6	-130.1	107	0	0	0	113.5	R58	L54-R58 WeakPolarHBondContact O-CB 3.33Å; L54-R58 WeakPolarHBondContact O-CG 3.11Å; L54-R58 PolarHBondContact O-N 3.42Å
55	K	73.4	Confident	80.7	Confident	184 Å²	184	119.8 Å²	119.8	80%	0.8	64%	0.635	S	S	*	*	H	α-helix	trans	-68.7	-40.1	176.9	-74.7	-172.8	177.1	-177	0	112.1	G53 K59	G53-K55 VanDerWaalsContact C-N 3.34Å; G53-K55 PolarHBondContact O-N 3.13Å; K55-K59 WeakPolarHBondContact O-CB 2.96Å; K55-K59 PolarHBondContact O-N 3.16Å
56	A	74.7	Confident	79.7	Confident	71 Å²	71	120.9 Å²	120.9	59%	0.587	65%	0.646	S	S	*	*	H	α-helix	trans	-69.2	-43.2	176.3	0	0	0	0	0	111.1	G53 R58 K59 A60	G53-A56 PolarHBondContact O-N 3.09Å; A56-R58 PolarHBondContact O-N 3.13Å; A56-K59 PolarHBondContact O-N 3.06Å; A56-A60 PolarHBondContact O-N 3.35Å; A56-A60 VanDerWaalsContact O-N 3.12Å
57	A	76.8	Confident	78.7	Confident	64 Å²	64	125.9 Å²	125.9	53%	0.529	67%	0.665	S	S	.	*	H	α-helix	trans	-62.3	-40.5	176.5	0	0	0	0	0	112.8	G53 K59 A60 A61	G53-A57 WeakPolarHBondContact O-CB 3.44Å; G53-A57 PolarHBondContact O-N 3.35Å; A57-K59 VanDerWaalsContact C-N 3.32Å; A57-K59 PolarHBondContact O-N 3.41Å; A57-A60 PolarHBondContact O-N 3.46Å; A57-A61 PolarHBondContact O-N 3.41Å
58	R	77.7	Confident	77.7	Confident	188 Å²	188	125.6 Å²	125.6	71%	0.709	67%	0.672	S	S	*	*	H	α-helix	trans	-69.2	-25.2	174.8	-83.4	-175.8	-179.9	151.2	-0.9	114.5	L54 A56	L54-R58 WeakPolarHBondContact O-CB 3.33Å; L54-R58 WeakPolarHBondContact O-CG 3.11Å; L54-R58 PolarHBondContact O-N 3.42Å; A56-R58 PolarHBondContact O-N 3.13Å
59	K	70.8	Confident	76.5	Confident	188 Å²	188	124.5 Å²	124.5	82%	0.817	68%	0.676	S	S	*	*	H	α-helix	trans	-81.3	-24.5	177.1	-166.8	-178.7	179.6	-173.9	0	111.8	K55 A56 A57	K55-K59 WeakPolarHBondContact O-CB 2.96Å; K55-K59 PolarHBondContact O-N 3.16Å; A56-K59 PolarHBondContact O-N 3.06Å; A57-K59 VanDerWaalsContact C-N 3.32Å; A57-K59 PolarHBondContact O-N 3.41Å
60	A	67.6	Low	75.1	Confident	92 Å²	92	126 Å²	126	76%	0.76	69%	0.692	S	S	*	*	H	α-helix	trans	-89.1	-14.9	178.1	0	0	0	0	0	113.5	A56 A57	A56-A60 PolarHBondContact O-N 3.35Å; A56-A60 VanDerWaalsContact O-N 3.12Å; A57-A60 PolarHBondContact O-N 3.46Å
61	A	57.9	Low	74	Confident	134 Å²	134	127.6 Å²	127.6	100%	1.107	70%	0.702	S	S	*	*			trans	-88.5	0	169.1	0	0	0	0	0	109.9	A57	A57-A61 PolarHBondContact O-N 3.41Å

Retrieved 61 of 61 residues in 89.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).