A0A087Y0T7_POEFO Loading...

Translation machinery associated 7 homolog

AlphaFold DB , UniProt , Accession A0A087Y0T7, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 64 aa.

						>A0A087Y0T7_POEFO|A0A087Y0T7
MSGREGGKKKPLKAPKKQNKEMDDEDVAFKQKQKEEQKAMDALKAKASGKGPLASGGIKKSGKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.1	Very low	62.6	Low	247 Å²	247	156.1 Å²	156.1	100%	1.217	85%	0.845	S	S	*	*				0	124.3	0	-81	-177.7	166.1	0	0	108.5
2	S	65.3	Low	63	Low	121 Å²	121	155.6 Å²	155.6	85%	0.846	84%	0.84	S	S	*	*			trans	-56.6	143.7	179.8	51	0	0	0	0	113.8
3	G	63.1	Low	63.4	Low	67 Å²	67	156.5 Å²	156.5	69%	0.691	83%	0.832	S	S	*	*			trans	88	106.6	139.9	0	0	0	0	0	115.9
4	R	63.4	Low	63.9	Low	243 Å²	243	150.9 Å²	150.9	92%	0.917	82%	0.818	S	S	*	*				-171.7	53.4	123.5	-99.3	165.3	-172.3	-167.6	4.1	111.2	G6	R4-G6 PolarHBondContact O-N 3.27Å
5	E	59.7	Low	64.2	Low	212 Å²	212	149.1 Å²	149.1	99%	0.991	82%	0.817	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.9	30.5	158.8	-67.3	-154.3	123.4	0	0	112.5
6	G	65	Low	64.5	Low	69 Å²	69	150.1 Å²	150.1	71%	0.711	81%	0.811	S	S	*	*	T	Hydrogen-bonded Turn	trans	-131.1	0.8	-167.4	0	0	0	0	0	115.6	R4 K8	R4-G6 PolarHBondContact O-N 3.27Å; G6-K8 PolarHBondContact O-N 3Å
7	G	63.3	Low	64.6	Low	61 Å²	61	152.8 Å²	152.8	63%	0.629	81%	0.813	S	S	*	*			trans	-84.3	99.4	172.1	0	0	0	0	0	108.5	K9	G7-K9 PolarHBondContact O-N 2.67Å
8	K	65.8	Low	64.4	Low	211 Å²	211	154.5 Å²	154.5	92%	0.917	82%	0.816	S	S	*	*			trans	-44.2	95.2	157.6	-105.3	176.6	177.5	174	0	106.5	G6 K10	G6-K8 PolarHBondContact O-N 3Å; K8-K10 PolarHBondContact O-N 3.06Å
9	K	62.5	Low	64.2	Low	177 Å²	177	153.8 Å²	153.8	77%	0.77	81%	0.813	S	S	*	*			trans	-51.6	120.4	169.3	-84.3	178.3	176.9	172.8	0	103	G7	G7-K9 PolarHBondContact O-N 2.67Å
10	K	64.4	Low	64.2	Low	186 Å²	186	154.8 Å²	154.8	81%	0.809	81%	0.81	S	S	*	*			trans	-36.5	125.1	168	-82.1	178.9	175.6	177.8	0	105.4	K8 L12	K8-K10 PolarHBondContact O-N 3.06Å; K10-L12 VanDerWaalsContact C-N 3.27Å; K10-L12 WeakPolarHBondContact O-CA 3.49Å; K10-L12 PolarHBondContact O-N 2.66Å
11	P	67.6	Low	64.1	Low	123 Å²	123	154.6 Å²	154.6	80%	0.799	81%	0.805	S	S	*	*			trans	-49.5	106.3	-179.9	17.4	-28.6	0	0	0	105.5	K13	P11-K13 PolarHBondContact O-N 2.94Å
12	L	66.8	Low	64.6	Low	150 Å²	150	147.5 Å²	147.5	79%	0.785	77%	0.77	S	S	*	*			trans	-57.5	113	-175.6	-90.9	153.4	0	0	0	102.3	K10 A14	K10-L12 VanDerWaalsContact C-N 3.27Å; K10-L12 WeakPolarHBondContact O-CA 3.49Å; K10-L12 PolarHBondContact O-N 2.66Å; L12-A14 PolarHBondContact O-N 2.85Å
13	K	67.9	Low	64.8	Low	168 Å²	168	146.5 Å²	146.5	73%	0.73	76%	0.755	S	S	*	*			trans	-25.1	107.6	-170.5	-173.7	145.7	-178.2	164.7	0	108.9	P11 P15	P11-K13 PolarHBondContact O-N 2.94Å; K13-P15 VanDerWaalsContact O-N 3.16Å
14	A	70.3	Confident	65.1	Low	78 Å²	78	150.2 Å²	150.2	65%	0.645	76%	0.759	S	S	*	*			trans	-42.4	128.5	-174.8	0	0	0	0	0	107.4	L12 K16	L12-A14 PolarHBondContact O-N 2.85Å; A14-K16 PolarHBondContact O-N 2.92Å
15	P	68.9	Low	65.5	Low	123 Å²	123	146.4 Å²	146.4	80%	0.799	75%	0.752	S	S	*	*			trans	-49.1	114.6	-174.9	19.5	-31	0	0	0	105.9	K13 K17	K13-P15 VanDerWaalsContact O-N 3.16Å; P15-K17 PolarHBondContact O-N 2.82Å
16	K	68.5	Low	66.5	Low	166 Å²	166	139.3 Å²	139.3	72%	0.722	72%	0.72	S	S	*	*			trans	-51.6	119	178.1	-79	177.3	176.9	173.5	0	103.6	A14 Q18	A14-K16 PolarHBondContact O-N 2.92Å; K16-Q18 VanDerWaalsContact C-N 3.31Å; K16-Q18 PolarHBondContact O-N 2.84Å
17	K	66.6	Low	67.4	Low	196 Å²	196	138.7 Å²	138.7	85%	0.852	70%	0.703	S	S	*	*			trans	-42.3	107	178.1	-71.7	179.5	179.3	177	0	104.9	P15 N19	P15-K17 PolarHBondContact O-N 2.82Å; K17-N19 PolarHBondContact O-N 2.73Å
18	Q	61.7	Low	68.4	Low	183 Å²	183	137.7 Å²	137.7	86%	0.855	69%	0.688	S	S	*	*			trans	-61.2	107.6	169.4	-82.4	175.9	-47.1	0	0	101.3	K16 K20	K16-Q18 VanDerWaalsContact C-N 3.31Å; K16-Q18 PolarHBondContact O-N 2.84Å; Q18-K20 PolarHBondContact O-N 2.82Å
19	N	60.3	Low	69.3	Low	142 Å²	142	133.2 Å²	133.2	76%	0.759	67%	0.669	S	S	*	*			trans	-57.1	95.7	162.2	-83.9	-17.4	0	0	0	102.4	K17 E21	K17-N19 PolarHBondContact O-N 2.73Å; N19-E21 PolarHBondContact O-N 2.72Å
20	K	64.4	Low	70.5	Confident	173 Å²	173	129.5 Å²	129.5	75%	0.752	65%	0.653	S	S	*	*			trans	-67.8	87.8	166.3	-161.5	167.1	-174.8	178	0	101.2	Q18 M22	Q18-K20 PolarHBondContact O-N 2.82Å; K20-M22 PolarHBondContact O-N 2.86Å
21	E	61	Low	71.6	Confident	150 Å²	150	126.1 Å²	126.1	70%	0.701	64%	0.64	S	S	*	*			trans	-49.6	103.7	164.4	-71.8	172.5	-179.9	0	0	102.7	N19 D23	N19-E21 PolarHBondContact O-N 2.72Å; E21-D23 PolarHBondContact O-N 3.01Å
22	M	60.2	Low	72.6	Confident	99 Å²	99	126.3 Å²	126.3	49%	0.488	63%	0.628	S	S	.	*			trans	-70.6	91.5	169.7	-71.1	-150.6	-49.9	0	0	103.3	K20 D26 K30	K20-M22 PolarHBondContact O-N 2.86Å; M22-D26 HydrophobicContact CB-CB 4.32Å; M22-K30 PolarHBondContact SD-NZ 3.15Å
23	D	69.5	Low	73.8	Confident	99 Å²	99	123.7 Å²	123.7	53%	0.529	61%	0.612	S	S	.	*			trans	-54.4	155.2	176.3	-69.6	-39.5	0	0	0	109.1	E21 E25 D26 V27	E21-D23 PolarHBondContact O-N 3.01Å; D23-E25 PolarHBondContact O-N 2.87Å; D23-D26 WeakPolarHBondContact O-CB 3.34Å; D23-D26 PolarHBondContact O-N 3.15Å; D23-V27 PolarHBondContact O-N 2.96Å
24	D	68.7	Low	74.9	Confident	146 Å²	146	122.3 Å²	122.3	78%	0.781	61%	0.606	S	S	*	*	H	α-helix	trans	-53.8	-25.6	-179.1	-68.6	-46.7	0	0	0	112.5	V27 A28	D24-V27 PolarHBondContact O-N 3.46Å; D24-A28 WeakPolarHBondContact O-CB 3.32Å; D24-A28 PolarHBondContact O-N 3.45Å
25	E	73.6	Confident	75.7	Confident	163 Å²	163	124.7 Å²	124.7	76%	0.762	60%	0.604	S	S	*	*	H	α-helix	trans	-64.5	-39.9	173	-63	-170.4	169.5	0	0	113.5	D23 V27 A28 F29	D23-E25 PolarHBondContact O-N 2.87Å; E25-V27 VanDerWaalsContact C-N 3.33Å; E25-A28 PolarHBondContact O-N 3.4Å; E25-F29 WeakPolarHBondContact O-CB 3.41Å; E25-F29 PolarHBondContact O-N 2.83Å
26	D	79.8	Confident	76.6	Confident	62 Å²	62	124.9 Å²	124.9	33%	0.332	59%	0.594	S	S	.	*	H	α-helix	trans	-69.1	-35.4	178.5	-107.3	-6.1	0	0	0	110.9	M22 D23 K30	M22-D26 HydrophobicContact CB-CB 4.32Å; D23-D26 WeakPolarHBondContact O-CB 3.34Å; D23-D26 PolarHBondContact O-N 3.15Å; D26-K30 WeakPolarHBondContact O-CB 3.37Å; D26-K30 WeakPolarHBondContact O-CG 3.42Å; D26-K30 PolarHBondContact O-N 3.07Å
27	V	84.1	Confident	77.6	Confident	57 Å²	57	122.6 Å²	122.6	35%	0.345	59%	0.586	S	S	.	*	H	α-helix	trans	-67.8	-45.5	173.9	179.3	0	0	0	0	110.2	D23 D24 E25 F29 K30 Q31	D23-V27 PolarHBondContact O-N 2.96Å; D24-V27 PolarHBondContact O-N 3.46Å; E25-V27 VanDerWaalsContact C-N 3.33Å; V27-F29 VanDerWaalsContact C-N 3.34Å; V27-F29 PolarHBondContact O-N 2.97Å; V27-K30 PolarHBondContact O-N 3.29Å; V27-Q31 WeakPolarHBondContact O-CG 3.44Å; V27-Q31 PolarHBondContact O-N 3.35Å
28	A	83.6	Confident	78.8	Confident	39 Å²	39	120.5 Å²	120.5	32%	0.322	58%	0.577	S	S	.	*	H	α-helix	trans	-61.7	-40.6	176.6	0	0	0	0	0	112.1	D24 E25 Q31 K32	D24-A28 WeakPolarHBondContact O-CB 3.32Å; D24-A28 PolarHBondContact O-N 3.45Å; E25-A28 PolarHBondContact O-N 3.4Å; A28-Q31 PolarHBondContact O-N 2.99Å; A28-K32 WeakPolarHBondContact O-CG 3.49Å; A28-K32 PolarHBondContact O-N 3.37Å
29	F	85.7	Confident	80	Confident	118 Å²	118	114.2 Å²	114.2	52%	0.518	56%	0.556	S	S	.	*	H	α-helix	trans	-66.1	-41.5	177.1	-176.3	-111.6	0	0	0	112.3	E25 V27 Q31 K32 Q33	E25-F29 WeakPolarHBondContact O-CB 3.41Å; E25-F29 PolarHBondContact O-N 2.83Å; V27-F29 VanDerWaalsContact C-N 3.34Å; V27-F29 PolarHBondContact O-N 2.97Å; F29-Q31 VanDerWaalsContact C-N 3.31Å; F29-Q31 PolarHBondContact O-N 2.95Å; F29-K32 PolarHBondContact O-N 3.02Å; F29-Q33 HydrophobicContact CE1-CG 4.43Å; F29-Q33 HydrophobicContact CZ-CG 4.37Å; F29-Q33 VanDerWaalsContact CZ-NE2 3.34Å; F29-Q33 PolarHBondContact O-N 3.45Å
30	K	87.8	Confident	81.2	Confident	99 Å²	99	113.5 Å²	113.5	43%	0.43	55%	0.55	S	S	.	.	H	α-helix	trans	-65.5	-34	174.5	-75.3	178	-172.3	175.8	0	112.8	M22 D26 V27 K34	M22-K30 PolarHBondContact SD-NZ 3.15Å; D26-K30 WeakPolarHBondContact O-CB 3.37Å; D26-K30 WeakPolarHBondContact O-CG 3.42Å; D26-K30 PolarHBondContact O-N 3.07Å; V27-K30 PolarHBondContact O-N 3.29Å; K30-K34 WeakPolarHBondContact O-CG 3.42Å; K30-K34 PolarHBondContact O-N 3.48Å; K30-K34 VanDerWaalsContact O-N 3.15Å
31	Q	87.1	Confident	82.3	Confident	114 Å²	114	109.8 Å²	109.8	53%	0.533	54%	0.538	S	S	.	.	H	α-helix	trans	-66.6	-48.2	173.6	-74.2	176.6	-3.3	0	0	110.8	V27 A28 F29 Q33 K34 E35	V27-Q31 WeakPolarHBondContact O-CG 3.44Å; V27-Q31 PolarHBondContact O-N 3.35Å; A28-Q31 PolarHBondContact O-N 2.99Å; F29-Q31 VanDerWaalsContact C-N 3.31Å; F29-Q31 PolarHBondContact O-N 2.95Å; Q31-Q33 PolarHBondContact O-N 2.88Å; Q31-K34 PolarHBondContact O-N 2.86Å; Q31-K34 VanDerWaalsContact O-N 3.15Å; Q31-E35 WeakPolarHBondContact O-CG 3.25Å; Q31-E35 PolarHBondContact O-N 3.34Å
32	K	88.9	Confident	83.5	Confident	128 Å²	128	104.9 Å²	104.9	56%	0.557	52%	0.523	S	S	*	.	H	α-helix	trans	-57.7	-46	175.3	-74.2	-179.5	-179.3	178	0	112.6	A28 F29 K34 E35 E36	A28-K32 WeakPolarHBondContact O-CG 3.49Å; A28-K32 PolarHBondContact O-N 3.37Å; F29-K32 PolarHBondContact O-N 3.02Å; K32-K34 VanDerWaalsContact C-N 3.33Å; K32-K34 PolarHBondContact O-N 3.32Å; K32-E35 PolarHBondContact O-N 3.45Å; K32-E35 VanDerWaalsContact O-N 3.15Å; K32-E36 WeakPolarHBondContact O-CG 3.24Å; K32-E36 PolarHBondContact O-N 3.15Å
33	Q	91	Very high	84.5	Confident	95 Å²	95	105.2 Å²	105.2	44%	0.444	53%	0.526	S	S	.	.	H	α-helix	trans	-58.9	-42.4	175.6	-98.9	-167.3	38	0	0	112.7	F29 Q31 E35 E36 Q37	F29-Q33 HydrophobicContact CE1-CG 4.43Å; F29-Q33 HydrophobicContact CZ-CG 4.37Å; F29-Q33 VanDerWaalsContact CZ-NE2 3.34Å; F29-Q33 PolarHBondContact O-N 3.45Å; Q31-Q33 PolarHBondContact O-N 2.88Å; Q33-E35 VanDerWaalsContact C-N 3.31Å; Q33-E35 PolarHBondContact O-N 2.95Å; Q33-E36 PolarHBondContact O-N 3.43Å; Q33-Q37 VanDerWaalsContact O-CB 3.25Å; Q33-Q37 WeakPolarHBondContact O-CB 3.39Å; Q33-Q37 PolarHBondContact O-N 2.89Å
34	K	90.6	Very high	85.1	Confident	138 Å²	138	107.7 Å²	107.7	60%	0.6	53%	0.533	S	S	*	.	H	α-helix	trans	-65.2	-37	177.5	-76.5	176.1	-178.3	179.2	0	111.8	K30 Q31 K32 K38	K30-K34 WeakPolarHBondContact O-CG 3.42Å; K30-K34 PolarHBondContact O-N 3.48Å; K30-K34 VanDerWaalsContact O-N 3.15Å; Q31-K34 PolarHBondContact O-N 2.86Å; Q31-K34 VanDerWaalsContact O-N 3.15Å; K32-K34 VanDerWaalsContact C-N 3.33Å; K32-K34 PolarHBondContact O-N 3.32Å; K34-K38 WeakPolarHBondContact O-CB 3.42Å; K34-K38 VanDerWaalsContact O-CG 3.24Å; K34-K38 WeakPolarHBondContact O-CG 3.48Å; K34-K38 PolarHBondContact O-N 2.86Å
35	E	86.9	Confident	85.8	Confident	128 Å²	128	103.6 Å²	103.6	60%	0.598	52%	0.519	S	S	*	.	H	α-helix	trans	-68.8	-45.2	176.2	-72.3	178	176	0	0	111.8	Q31 K32 Q33 Q37 K38 A39	Q31-E35 WeakPolarHBondContact O-CG 3.25Å; Q31-E35 PolarHBondContact O-N 3.34Å; K32-E35 PolarHBondContact O-N 3.45Å; K32-E35 VanDerWaalsContact O-N 3.15Å; Q33-E35 VanDerWaalsContact C-N 3.31Å; Q33-E35 PolarHBondContact O-N 2.95Å; E35-Q37 VanDerWaalsContact C-N 3.33Å; E35-Q37 PolarHBondContact O-N 3.32Å; E35-K38 PolarHBondContact O-N 2.97Å; E35-A39 WeakPolarHBondContact O-CB 3.45Å; E35-A39 PolarHBondContact O-N 3.16Å
36	E	88.6	Confident	86.1	Confident	127 Å²	127	103.1 Å²	103.1	59%	0.593	51%	0.514	S	S	*	.	H	α-helix	trans	-59.8	-44	174.7	-74.2	174.6	-173.9	0	0	111.3	K32 Q33 A39 M40	K32-E36 WeakPolarHBondContact O-CG 3.24Å; K32-E36 PolarHBondContact O-N 3.15Å; Q33-E36 PolarHBondContact O-N 3.43Å; E36-A39 PolarHBondContact O-N 3.03Å; E36-M40 WeakPolarHBondContact O-CB 3.24Å; E36-M40 VanDerWaalsContact O-CG 3.29Å; E36-M40 WeakPolarHBondContact O-CG 3.29Å; E36-M40 PolarHBondContact O-N 2.81Å
37	Q	89.9	Confident	85.9	Confident	119 Å²	119	102.5 Å²	102.5	56%	0.556	52%	0.518	S	S	*	.	H	α-helix	trans	-65.5	-41.7	178.6	-163.3	162.8	17.4	0	0	111.6	Q33 E35 A39 M40 D41	Q33-Q37 VanDerWaalsContact O-CB 3.25Å; Q33-Q37 WeakPolarHBondContact O-CB 3.39Å; Q33-Q37 PolarHBondContact O-N 2.89Å; E35-Q37 VanDerWaalsContact C-N 3.33Å; E35-Q37 PolarHBondContact O-N 3.32Å; Q37-A39 VanDerWaalsContact C-N 3.34Å; Q37-A39 PolarHBondContact O-N 3.41Å; Q37-M40 PolarHBondContact O-N 2.77Å; Q37-D41 WeakPolarHBondContact O-CB 3.47Å; Q37-D41 VanDerWaalsContact O-CG 3.29Å; Q37-D41 PolarHBondContact O-N 3.34Å
38	K	91.4	Very high	85.3	Confident	151 Å²	151	104.1 Å²	104.1	66%	0.657	53%	0.532	S	S	*	.	H	α-helix	trans	-62	-39.9	172.5	-77	174.4	-177.9	179.5	0	112.5	K34 E35 D41 A42	K34-K38 WeakPolarHBondContact O-CB 3.42Å; K34-K38 VanDerWaalsContact O-CG 3.24Å; K34-K38 WeakPolarHBondContact O-CG 3.48Å; K34-K38 PolarHBondContact O-N 2.86Å; E35-K38 PolarHBondContact O-N 2.97Å; K38-D41 PolarHBondContact O-N 2.95Å; K38-A42 VanDerWaalsContact O-CB 3.31Å; K38-A42 WeakPolarHBondContact O-CB 3.29Å; K38-A42 PolarHBondContact O-N 2.89Å
39	A	87.9	Confident	84.7	Confident	51 Å²	51	105.6 Å²	105.6	42%	0.421	55%	0.551	S	S	.	*	H	α-helix	trans	-65.4	-42.7	176.7	0	0	0	0	0	111.1	E35 E36 Q37 A42 L43	E35-A39 WeakPolarHBondContact O-CB 3.45Å; E35-A39 PolarHBondContact O-N 3.16Å; E36-A39 PolarHBondContact O-N 3.03Å; Q37-A39 VanDerWaalsContact C-N 3.34Å; Q37-A39 PolarHBondContact O-N 3.41Å; A39-A42 PolarHBondContact O-N 3.39Å; A39-L43 WeakPolarHBondContact O-CB 3.35Å; A39-L43 VanDerWaalsContact O-CG 3.29Å; A39-L43 WeakPolarHBondContact O-CG 3.37Å; A39-L43 PolarHBondContact O-N 3.49Å
40	M	85.2	Confident	83.6	Confident	127 Å²	127	107.3 Å²	107.3	63%	0.626	56%	0.558	S	S	*	*	H	α-helix	trans	-64.7	-42	175.9	-72.4	-65.2	-77.5	0	0	112.1	E36 Q37 L43 K44	E36-M40 WeakPolarHBondContact O-CB 3.24Å; E36-M40 VanDerWaalsContact O-CG 3.29Å; E36-M40 WeakPolarHBondContact O-CG 3.29Å; E36-M40 PolarHBondContact O-N 2.81Å; Q37-M40 PolarHBondContact O-N 2.77Å; M40-L43 PolarHBondContact O-N 3.28Å; M40-K44 VanDerWaalsContact O-CB 3.24Å; M40-K44 WeakPolarHBondContact O-CB 3.31Å; M40-K44 PolarHBondContact O-N 2.79Å
41	D	87	Confident	82.6	Confident	95 Å²	95	104.9 Å²	104.9	51%	0.508	56%	0.561	S	S	.	*	H	α-helix	trans	-66.3	-39.6	176.5	-72.5	-24.9	0	0	0	111.5	Q37 K38 K44 A45	Q37-D41 WeakPolarHBondContact O-CB 3.47Å; Q37-D41 VanDerWaalsContact O-CG 3.29Å; Q37-D41 PolarHBondContact O-N 3.34Å; K38-D41 PolarHBondContact O-N 2.95Å; D41-K44 PolarHBondContact O-N 3.3Å; D41-A45 VanDerWaalsContact O-CB 3.29Å; D41-A45 WeakPolarHBondContact O-CB 3.29Å; D41-A45 PolarHBondContact O-N 3.23Å
42	A	85.7	Confident	81.9	Confident	47 Å²	47	104.3 Å²	104.3	39%	0.388	57%	0.567	S	S	.	*	H	α-helix	trans	-65.7	-40	174.4	0	0	0	0	0	112.3	K38 A39 K46	K38-A42 VanDerWaalsContact O-CB 3.31Å; K38-A42 WeakPolarHBondContact O-CB 3.29Å; K38-A42 PolarHBondContact O-N 2.89Å; A39-A42 PolarHBondContact O-N 3.39Å; A42-K46 WeakPolarHBondContact O-CB 3.27Å; A42-K46 VanDerWaalsContact O-CG 3.27Å; A42-K46 WeakPolarHBondContact O-CG 3.38Å; A42-K46 PolarHBondContact O-N 2.93Å
43	L	81.9	Confident	80.8	Confident	106 Å²	106	105.3 Å²	105.3	56%	0.555	58%	0.578	S	S	*	*	H	α-helix	trans	-66.1	-41.3	173.7	-74	174.1	0	0	0	111.4	A39 M40 K46 A47	A39-L43 WeakPolarHBondContact O-CB 3.35Å; A39-L43 VanDerWaalsContact O-CG 3.29Å; A39-L43 WeakPolarHBondContact O-CG 3.37Å; A39-L43 PolarHBondContact O-N 3.49Å; M40-L43 PolarHBondContact O-N 3.28Å; L43-K46 PolarHBondContact O-N 2.85Å; L43-A47 VanDerWaalsContact O-CB 3.25Å; L43-A47 WeakPolarHBondContact O-CB 3.44Å; L43-A47 PolarHBondContact O-N 3.42Å
44	K	82.4	Confident	79.5	Confident	152 Å²	152	104.9 Å²	104.9	66%	0.661	59%	0.59	S	S	*	*	H	α-helix	trans	-64.8	-42	176.6	-170.1	175.8	-177.6	179.7	0	111.4	M40 D41 A47 S48	M40-K44 VanDerWaalsContact O-CB 3.24Å; M40-K44 WeakPolarHBondContact O-CB 3.31Å; M40-K44 PolarHBondContact O-N 2.79Å; D41-K44 PolarHBondContact O-N 3.3Å; K44-A47 CarbonylContact O-C 3.57Å; K44-A47 PolarHBondContact O-N 2.88Å; K44-S48 WeakPolarHBondContact O-CB 3.46Å; K44-S48 PolarHBondContact O-N 3.46Å; K44-S48 PolarHBondContact O-OG 3.24Å
45	A	83.4	Confident	78.1	Confident	59 Å²	59	103.1 Å²	103.1	49%	0.488	60%	0.596	S	S	.	*	H	α-helix	trans	-64.8	-41.5	175	0	0	0	0	0	111.9	D41 A47 S48 G49	D41-A45 VanDerWaalsContact O-CB 3.29Å; D41-A45 WeakPolarHBondContact O-CB 3.29Å; D41-A45 PolarHBondContact O-N 3.23Å; A45-A47 VanDerWaalsContact C-N 3.34Å; A45-S48 WeakPolarHBondContact CA-OG 3.25Å; A45-S48 PolarHBondContact O-N 2.87Å; A45-S48 PolarHBondContact O-OG 2.81Å; A45-G49 PolarHBondContact O-N 3.45Å
46	K	79.2	Confident	77.2	Confident	153 Å²	153	100.3 Å²	100.3	67%	0.665	60%	0.601	S	S	*	*	H	α-helix	trans	-63.4	-39.8	172.8	-76.9	175	-179.8	177.8	0	111.9	A42 L43 K50	A42-K46 WeakPolarHBondContact O-CB 3.27Å; A42-K46 VanDerWaalsContact O-CG 3.27Å; A42-K46 WeakPolarHBondContact O-CG 3.38Å; A42-K46 PolarHBondContact O-N 2.93Å; L43-K46 PolarHBondContact O-N 2.85Å; K46-K50 WeakPolarHBondContact O-CB 3.48Å; K46-K50 PolarHBondContact O-N 3.35Å
47	A	75.3	Confident	76.1	Confident	49 Å²	49	97.2 Å²	97.2	41%	0.405	60%	0.603	S	S	.	*	H	α-helix	trans	-73.7	-30.4	177.7	0	0	0	0	0	112.8	L43 K44 A45	L43-A47 VanDerWaalsContact O-CB 3.25Å; L43-A47 WeakPolarHBondContact O-CB 3.44Å; L43-A47 PolarHBondContact O-N 3.42Å; K44-A47 CarbonylContact O-C 3.57Å; K44-A47 PolarHBondContact O-N 2.88Å; A45-A47 VanDerWaalsContact C-N 3.34Å
48	S	72.8	Confident	75	Confident	92 Å²	92	99.4 Å²	99.4	64%	0.643	62%	0.617	S	S	*	*	H	α-helix	trans	-77.8	-31.7	176.6	61.7	0	0	0	0	112.6	K44 A45	K44-S48 WeakPolarHBondContact O-CB 3.46Å; K44-S48 PolarHBondContact O-N 3.46Å; K44-S48 PolarHBondContact O-OG 3.24Å; A45-S48 WeakPolarHBondContact CA-OG 3.25Å; A45-S48 PolarHBondContact O-N 2.87Å; A45-S48 PolarHBondContact O-OG 2.81Å
49	G	69.8	Low	73.8	Confident	70 Å²	70	101.6 Å²	101.6	72%	0.722	63%	0.626	S	S	*	*	H	α-helix	trans	-77.9	-27	176.9	0	0	0	0	0	113.7	A45 G51	A45-G49 PolarHBondContact O-N 3.45Å; G49-G51 PolarHBondContact O-N 3.35Å
50	K	63.1	Low	72.6	Confident	154 Å²	154	108.5 Å²	108.5	67%	0.67	65%	0.647	S	S	*	*	S	Bend	trans	-95.5	88.4	172.6	-147.9	146.5	-178.1	174.4	0	106.5	K46	K46-K50 WeakPolarHBondContact O-CB 3.48Å; K46-K50 PolarHBondContact O-N 3.35Å
51	G	67.5	Low	71.7	Confident	47 Å²	47	108.1 Å²	108.1	49%	0.485	66%	0.656	S	S	.	*			trans	-41.2	155.7	176.9	0	0	0	0	0	111.8	G49 L53	G49-G51 PolarHBondContact O-N 3.35Å; G51-L53 PolarHBondContact O-N 2.76Å
52	P	71.4	Confident	70.4	Confident	103 Å²	103	106.9 Å²	106.9	67%	0.669	67%	0.666	S	S	*	*			trans	-29.5	117.5	-152.1	10.7	-27.8	0	0	0	112.1	A54 S55	P52-A54 CarbonylContact O-C 3.1Å; P52-A54 WeakPolarHBondContact O-CA 3.5Å; P52-A54 PolarHBondContact O-N 3.24Å; P52-S55 WeakPolarHBondContact O-CB 3.5Å; P52-S55 PolarHBondContact O-N 2.79Å
53	L	66.1	Low	69	Low	148 Å²	148	114.5 Å²	114.5	78%	0.775	69%	0.691	S	S	*	*	S	Bend	trans	-51.2	-14.9	-178.1	-73	159.5	0	0	0	113.2	G51	G51-L53 PolarHBondContact O-N 2.76Å
54	A	64.4	Low	67.5	Low	86 Å²	86	122.6 Å²	122.6	71%	0.711	72%	0.721	S	S	*	*			trans	-108.7	71.2	161.4	0	0	0	0	0	111.5	P52	P52-A54 CarbonylContact O-C 3.1Å; P52-A54 WeakPolarHBondContact O-CA 3.5Å; P52-A54 PolarHBondContact O-N 3.24Å
55	S	59.8	Low	66.8	Low	102 Å²	102	121.2 Å²	121.2	71%	0.713	72%	0.724	S	S	*	*			trans	-84.9	3.1	172.7	66.4	0	0	0	0	112.4	P52 G57	P52-S55 WeakPolarHBondContact O-CB 3.5Å; P52-S55 PolarHBondContact O-N 2.79Å; S55-G57 PolarHBondContact O-N 2.93Å
56	G	67.6	Low	65.9	Low	69 Å²	69	124.4 Å²	124.4	71%	0.711	74%	0.737	S	S	*	*	S	Bend	trans	-72.1	82.2	166	0	0	0	0	0	109.6	I58	G56-I58 PolarHBondContact O-N 2.87Å
57	G	65.7	Low	65.2	Low	61 Å²	61	122.8 Å²	122.8	63%	0.629	74%	0.741	S	S	*	*			trans	-45.7	128.3	179.5	0	0	0	0	0	111.4	S55 K59	S55-G57 PolarHBondContact O-N 2.93Å; G57-K59 VanDerWaalsContact C-N 3.26Å; G57-K59 PolarHBondContact O-N 2.78Å
58	I	68	Low	64.6	Low	165 Å²	165	127.2 Å²	127.2	85%	0.846	76%	0.76	S	S	*	*			trans	-53.6	100.7	161.2	-65.6	162.8	0	0	0	105.2	G56 K60	G56-I58 PolarHBondContact O-N 2.87Å; I58-K60 VanDerWaalsContact C-N 3.31Å; I58-K60 PolarHBondContact O-N 3.29Å
59	K	65.3	Low	64.1	Low	197 Å²	197	129.4 Å²	129.4	86%	0.857	77%	0.768	S	S	*	*			trans	-57.8	105.6	166.8	-77.3	-178.1	179.7	177	0	104.2	G57 S61	G57-K59 VanDerWaalsContact C-N 3.26Å; G57-K59 PolarHBondContact O-N 2.78Å; K59-S61 PolarHBondContact O-N 3.11Å
60	K	63.1	Low	63.7	Low	197 Å²	197	133.3 Å²	133.3	86%	0.857	77%	0.771	S	S	*	*			trans	-42.2	109.8	165.2	-91	176.7	173.7	174	0	105.4	I58 G62	I58-K60 VanDerWaalsContact C-N 3.31Å; I58-K60 PolarHBondContact O-N 3.29Å; K60-G62 PolarHBondContact O-N 2.91Å
61	S	65.8	Low	63.8	Low	118 Å²	118	131.9 Å²	131.9	83%	0.825	78%	0.778	S	S	*	*			trans	-51.5	112.3	172.6	39.3	0	0	0	0	106	K59 K63	K59-S61 PolarHBondContact O-N 3.11Å; S61-K63 PolarHBondContact O-N 2.86Å; S61-K63 VanDerWaalsContact O-N 3.11Å
62	G	60.4	Low	63.5	Low	69 Å²	69	138.4 Å²	138.4	71%	0.711	80%	0.801	S	S	*	*			trans	-59.6	117.8	177.8	0	0	0	0	0	107.2	K60 K64	K60-G62 PolarHBondContact O-N 2.91Å; G62-K64 VanDerWaalsContact C-N 3.26Å; G62-K64 PolarHBondContact O-N 2.97Å
63	K	56.2	Low	62.8	Low	208 Å²	208	141.3 Å²	141.3	90%	0.904	81%	0.812	S	S	*	*			trans	-67.5	92.8	163	-175	89.5	179.5	-161.7	0	106.8	S61	S61-K63 PolarHBondContact O-N 2.86Å; S61-K63 VanDerWaalsContact O-N 3.11Å
64	K	51.3	Low	62.5	Low	276 Å²	276	140.7 Å²	140.7	100%	1.2	82%	0.815	S	S	*	*			trans	-163	0	150.8	-102	-179.2	-173	-178.4	0	107.6	G62	G62-K64 VanDerWaalsContact C-N 3.26Å; G62-K64 PolarHBondContact O-N 2.97Å

Retrieved 64 of 64 residues in 16 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).