A0A087Y0U5_POEFO Loading...

TSC22 domain family protein 3

AlphaFold DB , UniProt , Accession A0A087Y0U5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 146 aa.

						>A0A087Y0U5_POEFO|A0A087Y0U5
MSTEMFAKTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIKELAEKNNQLERENYLLKNLASPEQLEKFQSRIPTDVLLDNQNVQATPVPQHQQQSCSHSTGSAV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.7	Very low	55.1	Low	236 Å²	236	138.5 Å²	138.5	100%	1.163	75%	0.752	S	S	*	*				0	85.8	0	-67.9	-75.9	-178.3	0	0	106.4	T3	M1-T3 PolarHBondContact O-N 3.29Å
2	S	36.7	Very low	56	Low	121 Å²	121	134.6 Å²	134.6	85%	0.846	73%	0.725	S	S	*	*			trans	-77.1	109.4	-175.5	-53.1	0	0	0	0	108.8	E4	S2-E4 PolarHBondContact O-N 3.26Å
3	T	46.5	Very low	57.3	Low	123 Å²	123	129.5 Å²	129.5	76%	0.755	70%	0.701	S	S	*	*			trans	-77.8	97.5	171	43.8	0	0	0	0	108.3	M1 M5	M1-T3 PolarHBondContact O-N 3.29Å; T3-M5 PolarHBondContact O-N 3.32Å
4	E	47.3	Very low	58.3	Low	164 Å²	164	124.5 Å²	124.5	77%	0.766	69%	0.686	S	S	*	*			trans	-63.6	105	167.5	-70.8	-175.4	142.5	0	0	108.6	S2 F6	S2-E4 PolarHBondContact O-N 3.26Å; E4-F6 VanDerWaalsContact C-N 3.29Å; E4-F6 PolarHBondContact O-N 2.77Å
5	M	50.1	Low	59.1	Low	174 Å²	174	122.3 Å²	122.3	86%	0.857	68%	0.678	S	S	*	*			trans	-70.4	89.5	168.6	-67	-78.2	-78.3	0	0	107.2	T3 A7	T3-M5 PolarHBondContact O-N 3.32Å; M5-A7 VanDerWaalsContact C-N 3.33Å; M5-A7 PolarHBondContact O-N 2.86Å
6	F	54.9	Low	59.9	Low	186 Å²	186	122.4 Å²	122.4	82%	0.816	67%	0.666	S	S	*	*			trans	-60	98.8	167.9	-101.5	-93.8	0	0	0	108.2	E4 K8	E4-F6 VanDerWaalsContact C-N 3.29Å; E4-F6 PolarHBondContact O-N 2.77Å; F6-K8 VanDerWaalsContact C-N 3.32Å; F6-K8 PolarHBondContact O-N 3.41Å
7	A	57.5	Low	60.8	Low	90 Å²	90	122.4 Å²	122.4	74%	0.744	66%	0.66	S	S	*	*			trans	-68.2	93.7	171.7	0	0	0	0	0	107.9	M5 T9	M5-A7 VanDerWaalsContact C-N 3.33Å; M5-A7 PolarHBondContact O-N 2.86Å; A7-T9 PolarHBondContact O-N 3.28Å
8	K	62.8	Low	61.7	Low	97 Å²	97	121.8 Å²	121.8	42%	0.422	66%	0.656	S	S	.	*			trans	-57.3	123.5	175	-141	171.9	-170.8	177.3	0	108.4	F6 E12 V13 Y16	F6-K8 VanDerWaalsContact C-N 3.32Å; F6-K8 PolarHBondContact O-N 3.41Å; K8-E12 WeakPolarHBondContact CA-OE2 3.48Å; K8-E12 HydrophobicContact CD-CB 4.46Å; K8-E12 HydrophobicContact CG-CB 3.75Å; K8-E12 HydrophobicContact CG-CG 4.48Å; K8-E12 WeakPolarHBondContact CG-OE2 3.41Å; K8-V13 HydrophobicContact CB-CG2 4.33Å; K8-Y16 VanDerWaalsContact CE-CD2 3.49Å; K8-Y16 VanDerWaalsContact NZ-CD2 3.26Å
9	T	71.2	Confident	62.3	Low	70 Å²	70	121.4 Å²	121.4	43%	0.429	65%	0.649	S	S	.	*			trans	-66	153.3	-174.4	63	0	0	0	0	110.3	A7 M11 E12 V13	A7-T9 PolarHBondContact O-N 3.28Å; T9-M11 PolarHBondContact O-N 3.45Å; T9-E12 PolarHBondContact N-OE2 3.5Å; T9-E12 WeakPolarHBondContact O-CB 3.47Å; T9-E12 PolarHBondContact O-N 3.34Å; T9-E12 WeakPolarHBondContact OG1-CG 3.08Å; T9-E12 PolarHBondContact OG1-N 2.94Å; T9-V13 PolarHBondContact O-N 3.03Å
10	P	69.1	Low	62.8	Low	115 Å²	115	119.1 Å²	119.1	75%	0.747	64%	0.637	S	S	*	*	H	α-helix	trans	-53.8	-32.2	178	-25.2	33	0	0	0	113	V13 A14	P10-V13 PolarHBondContact O-N 3.26Å; P10-A14 WeakPolarHBondContact O-CB 3.41Å; P10-A14 PolarHBondContact O-N 3.1Å
11	M	70.8	Confident	63.6	Low	148 Å²	148	119.9 Å²	119.9	73%	0.729	64%	0.635	S	S	*	*	H	α-helix	trans	-67	-44.2	175.4	-175.3	177.7	-77.8	0	0	112	T9 V13 A14 V15	T9-M11 PolarHBondContact O-N 3.45Å; M11-V13 VanDerWaalsContact C-N 3.34Å; M11-V13 PolarHBondContact O-N 3.49Å; M11-A14 PolarHBondContact O-N 3.15Å; M11-V15 WeakPolarHBondContact O-CG2 3.44Å; M11-V15 PolarHBondContact O-N 3.38Å
12	E	65.9	Low	65.4	Low	91 Å²	91	110.7 Å²	110.7	43%	0.425	59%	0.594	S	S	.	*	H	α-helix	trans	-61.8	-44.1	173.7	-74.5	177.7	140.1	0	0	110.8	K8 T9 A14 V15 Y16	K8-E12 WeakPolarHBondContact CA-OE2 3.48Å; K8-E12 HydrophobicContact CD-CB 4.46Å; K8-E12 HydrophobicContact CG-CB 3.75Å; K8-E12 HydrophobicContact CG-CG 4.48Å; K8-E12 WeakPolarHBondContact CG-OE2 3.41Å; T9-E12 PolarHBondContact N-OE2 3.5Å; T9-E12 WeakPolarHBondContact O-CB 3.47Å; T9-E12 PolarHBondContact O-N 3.34Å; T9-E12 WeakPolarHBondContact OG1-CG 3.08Å; T9-E12 PolarHBondContact OG1-N 2.94Å; E12-A14 VanDerWaalsContact C-N 3.31Å; E12-A14 PolarHBondContact O-N 3.2Å; E12-V15 PolarHBondContact O-N 3.02Å; E12-Y16 WeakPolarHBondContact O-CB 3.4Å; E12-Y16 WeakPolarHBondContact O-CD2 3.19Å; E12-Y16 PolarHBondContact O-N 3.48Å
13	V	71.8	Confident	66.9	Low	68 Å²	68	108.7 Å²	108.7	41%	0.412	57%	0.573	S	S	.	*	H	α-helix	trans	-58.8	-43.8	176.5	179	0	0	0	0	111	K8 T9 P10 M11 Y16 Q17	K8-V13 HydrophobicContact CB-CG2 4.33Å; T9-V13 PolarHBondContact O-N 3.03Å; P10-V13 PolarHBondContact O-N 3.26Å; M11-V13 VanDerWaalsContact C-N 3.34Å; M11-V13 PolarHBondContact O-N 3.49Å; V13-Y16 PolarHBondContact O-N 2.88Å; V13-Q17 HydrophobicContact CG1-CG 4.15Å; V13-Q17 WeakPolarHBondContact O-CB 3.49Å; V13-Q17 WeakPolarHBondContact O-CG 3.42Å; V13-Q17 PolarHBondContact O-N 3.05Å
14	A	71.7	Confident	68.1	Low	60 Å²	60	106.2 Å²	106.2	50%	0.496	56%	0.56	S	S	.	*	H	α-helix	trans	-62.4	-43.3	177.2	0	0	0	0	0	112.6	P10 M11 E12 Q17 L18	P10-A14 WeakPolarHBondContact O-CB 3.41Å; P10-A14 PolarHBondContact O-N 3.1Å; M11-A14 PolarHBondContact O-N 3.15Å; E12-A14 VanDerWaalsContact C-N 3.31Å; E12-A14 PolarHBondContact O-N 3.2Å; A14-Q17 PolarHBondContact O-N 3.33Å; A14-L18 VanDerWaalsContact O-CB 3.29Å; A14-L18 WeakPolarHBondContact O-CB 3.3Å; A14-L18 PolarHBondContact O-N 2.88Å
15	V	70.9	Confident	69.6	Low	92 Å²	92	103.8 Å²	103.8	56%	0.558	55%	0.547	S	S	*	.	H	α-helix	trans	-64.1	-44	176.8	173.3	0	0	0	0	111	M11 E12 L18 H19	M11-V15 WeakPolarHBondContact O-CG2 3.44Å; M11-V15 PolarHBondContact O-N 3.38Å; E12-V15 PolarHBondContact O-N 3.02Å; V15-L18 PolarHBondContact O-N 2.92Å; V15-H19 VanDerWaalsContact O-CB 3.23Å; V15-H19 WeakPolarHBondContact O-CB 3.5Å; V15-H19 PolarHBondContact O-N 2.98Å
16	Y	71.9	Confident	70	Confident	124 Å²	124	99.9 Å²	99.9	49%	0.486	53%	0.526	S	S	.	.	H	α-helix	trans	-63.5	-41.9	176.4	-89.4	-86.6	0	0	0	112	K8 E12 V13 H19 N20	K8-Y16 VanDerWaalsContact CE-CD2 3.49Å; K8-Y16 VanDerWaalsContact NZ-CD2 3.26Å; E12-Y16 WeakPolarHBondContact O-CB 3.4Å; E12-Y16 WeakPolarHBondContact O-CD2 3.19Å; E12-Y16 PolarHBondContact O-N 3.48Å; V13-Y16 PolarHBondContact O-N 2.88Å; Y16-H19 PolarHBondContact O-N 3.5Å; Y16-N20 WeakPolarHBondContact O-CB 3.32Å; Y16-N20 PolarHBondContact O-N 3.43Å; Y16-N20 PolarHBondContact O-ND2 3.09Å; Y16-N20 VanDerWaalsContact O-ND2 3.08Å
17	Q	75.1	Confident	70.2	Confident	121 Å²	121	94.4 Å²	94.4	57%	0.565	51%	0.511	S	S	*	.	H	α-helix	trans	-68.5	-40.5	178.5	-68.7	-69.6	75.6	0	0	112	V13 A14 H19 N20 F21	V13-Q17 HydrophobicContact CG1-CG 4.15Å; V13-Q17 WeakPolarHBondContact O-CB 3.49Å; V13-Q17 WeakPolarHBondContact O-CG 3.42Å; V13-Q17 PolarHBondContact O-N 3.05Å; A14-Q17 PolarHBondContact O-N 3.33Å; Q17-H19 VanDerWaalsContact C-N 3.33Å; Q17-N20 PolarHBondContact O-N 3.35Å; Q17-F21 WeakPolarHBondContact O-CB 3.45Å; Q17-F21 PolarHBondContact O-N 2.93Å
18	L	76.9	Confident	70.7	Confident	113 Å²	113	94.7 Å²	94.7	59%	0.592	51%	0.507	S	S	*	.	H	α-helix	trans	-64.5	-40.5	174.8	-171.7	63.8	0	0	0	111.1	A14 V15 F21 S22	A14-L18 VanDerWaalsContact O-CB 3.29Å; A14-L18 WeakPolarHBondContact O-CB 3.3Å; A14-L18 PolarHBondContact O-N 2.88Å; V15-L18 PolarHBondContact O-N 2.92Å; L18-F21 PolarHBondContact O-N 3.1Å; L18-S22 WeakPolarHBondContact O-CB 3.28Å; L18-S22 PolarHBondContact O-N 3.3Å; L18-S22 PolarHBondContact O-OG 3.21Å
19	H	72.1	Confident	70.8	Confident	114 Å²	114	95.2 Å²	95.2	53%	0.528	51%	0.514	S	S	.	.	H	α-helix	trans	-64.6	-43.8	175.5	-171.7	-106.2	0	0	0	111.8	V15 Y16 Q17 S22 I23	V15-H19 VanDerWaalsContact O-CB 3.23Å; V15-H19 WeakPolarHBondContact O-CB 3.5Å; V15-H19 PolarHBondContact O-N 2.98Å; Y16-H19 PolarHBondContact O-N 3.5Å; Q17-H19 VanDerWaalsContact C-N 3.33Å; H19-S22 PolarHBondContact O-N 3.34Å; H19-I23 WeakPolarHBondContact CE1-CD1 3.4Å; H19-I23 WeakPolarHBondContact ND1-CD1 3.44Å; H19-I23 WeakPolarHBondContact O-CB 3.31Å; H19-I23 VanDerWaalsContact O-CG1 3.24Å; H19-I23 WeakPolarHBondContact O-CG1 3.47Å; H19-I23 PolarHBondContact O-N 3.39Å
20	N	73	Confident	70.3	Confident	75 Å²	75	96.8 Å²	96.8	40%	0.401	52%	0.519	S	S	.	.	H	α-helix	trans	-63.8	-40.6	175.5	-73.8	-34.7	0	0	0	112.3	Y16 Q17 S24	Y16-N20 WeakPolarHBondContact O-CB 3.32Å; Y16-N20 PolarHBondContact O-N 3.43Å; Y16-N20 PolarHBondContact O-ND2 3.09Å; Y16-N20 VanDerWaalsContact O-ND2 3.08Å; Q17-N20 PolarHBondContact O-N 3.35Å; N20-S24 VanDerWaalsContact O-CB 3.29Å; N20-S24 WeakPolarHBondContact O-CB 3.19Å; N20-S24 PolarHBondContact O-N 2.98Å; N20-S24 PolarHBondContact O-OG 3.3Å
21	F	79.6	Confident	69.5	Low	136 Å²	136	92.9 Å²	92.9	60%	0.596	50%	0.5	S	S	*	.	H	α-helix	trans	-64.3	-49.6	176	176.2	-100.8	0	0	0	111.2	Q17 L18 I23 S24 F25	Q17-F21 WeakPolarHBondContact O-CB 3.45Å; Q17-F21 PolarHBondContact O-N 2.93Å; L18-F21 PolarHBondContact O-N 3.1Å; F21-I23 PolarHBondContact O-N 2.98Å; F21-S24 PolarHBondContact O-N 3.36Å; F21-F25 VanDerWaalsContact O-CB 3.27Å; F21-F25 WeakPolarHBondContact O-CB 3.05Å; F21-F25 PolarHBondContact O-N 3.01Å
22	S	77.8	Confident	68.6	Low	43 Å²	43	88.9 Å²	88.9	30%	0.301	50%	0.497	S	S	.	.	H	α-helix	trans	-58.7	-47.9	176.3	-71.5	0	0	0	0	111.3	L18 H19 S24 F25 F26	L18-S22 WeakPolarHBondContact O-CB 3.28Å; L18-S22 PolarHBondContact O-N 3.3Å; L18-S22 PolarHBondContact O-OG 3.21Å; H19-S22 PolarHBondContact O-N 3.34Å; S22-S24 PolarHBondContact O-N 2.94Å; S22-F25 PolarHBondContact O-N 3.3Å; S22-F26 WeakPolarHBondContact O-CD2 3.35Å; S22-F26 PolarHBondContact O-N 3.42Å
23	I	67.9	Low	67.8	Low	79 Å²	79	92 Å²	92	41%	0.405	52%	0.516	S	S	.	.	H	α-helix	trans	-58.5	-48.5	176.7	-71.3	170.3	0	0	0	110.8	H19 F21 F25 F26 S27	H19-I23 WeakPolarHBondContact CE1-CD1 3.4Å; H19-I23 WeakPolarHBondContact ND1-CD1 3.44Å; H19-I23 WeakPolarHBondContact O-CB 3.31Å; H19-I23 VanDerWaalsContact O-CG1 3.24Å; H19-I23 WeakPolarHBondContact O-CG1 3.47Å; H19-I23 PolarHBondContact O-N 3.39Å; F21-I23 PolarHBondContact O-N 2.98Å; I23-F25 VanDerWaalsContact C-N 3.29Å; I23-F25 PolarHBondContact O-N 2.8Å; I23-F26 PolarHBondContact O-N 3.38Å; I23-S27 VanDerWaalsContact O-CB 3.28Å; I23-S27 WeakPolarHBondContact O-CB 3.43Å; I23-S27 PolarHBondContact O-N 2.79Å; I23-S27 PolarHBondContact O-OG 3.3Å; I23-S27 VanDerWaalsContact O-OG 3.11Å
24	S	71.3	Confident	66.8	Low	70 Å²	70	92.8 Å²	92.8	49%	0.49	52%	0.521	S	S	.	.	H	α-helix	trans	-63.7	-37	-178.5	-57.5	0	0	0	0	112.1	N20 F21 S22 S28	N20-S24 VanDerWaalsContact O-CB 3.29Å; N20-S24 WeakPolarHBondContact O-CB 3.19Å; N20-S24 PolarHBondContact O-N 2.98Å; N20-S24 PolarHBondContact O-OG 3.3Å; F21-S24 PolarHBondContact O-N 3.36Å; S22-S24 PolarHBondContact O-N 2.94Å; S24-S28 WeakPolarHBondContact O-CB 3.45Å; S24-S28 PolarHBondContact O-N 3.13Å; S24-S28 PolarHBondContact O-OG 3.45Å
25	F	78.5	Confident	65.7	Low	113 Å²	113	96.4 Å²	96.4	50%	0.496	54%	0.537	S	S	.	.	H	α-helix	trans	-65.3	-49	175.6	178.6	-99.3	0	0	0	111.4	F21 S22 I23 S28 L29	F21-F25 VanDerWaalsContact O-CB 3.27Å; F21-F25 WeakPolarHBondContact O-CB 3.05Å; F21-F25 PolarHBondContact O-N 3.01Å; S22-F25 PolarHBondContact O-N 3.3Å; I23-F25 VanDerWaalsContact C-N 3.29Å; I23-F25 PolarHBondContact O-N 2.8Å; F25-S28 PolarHBondContact O-N 2.62Å; F25-L29 PolarHBondContact O-N 3.35Å
26	F	58.6	Low	64.6	Low	92 Å²	92	96.1 Å²	96.1	40%	0.404	54%	0.539	S	S	.	.	H	α-helix	trans	-66.3	-38.8	176.1	-72.9	-66.1	0	0	0	112.3	S22 I23 S28 L29 L30	S22-F26 WeakPolarHBondContact O-CD2 3.35Å; S22-F26 PolarHBondContact O-N 3.42Å; I23-F26 PolarHBondContact O-N 3.38Å; F26-S28 PolarHBondContact O-N 2.74Å; F26-L29 PolarHBondContact O-N 2.99Å; F26-L30 VanDerWaalsContact O-CB 3.3Å; F26-L30 WeakPolarHBondContact O-CB 3.49Å; F26-L30 VanDerWaalsContact O-CG 3.29Å; F26-L30 WeakPolarHBondContact O-CG 3.45Å; F26-L30 PolarHBondContact O-N 3.29Å
27	S	59.5	Low	63.4	Low	71 Å²	71	96 Å²	96	50%	0.497	55%	0.551	S	S	.	*	H	α-helix	trans	-64.5	-27.6	173.3	-70.7	0	0	0	0	112.6	I23 G31	I23-S27 VanDerWaalsContact O-CB 3.28Å; I23-S27 WeakPolarHBondContact O-CB 3.43Å; I23-S27 PolarHBondContact O-N 2.79Å; I23-S27 PolarHBondContact O-OG 3.3Å; I23-S27 VanDerWaalsContact O-OG 3.11Å; S27-G31 WeakPolarHBondContact O-CA 3.44Å; S27-G31 PolarHBondContact O-N 2.91Å
28	S	67.8	Low	61.8	Low	97 Å²	97	96.9 Å²	96.9	68%	0.678	55%	0.553	S	S	*	*	H	α-helix	trans	-77.6	-37.1	173.5	-60.1	0	0	0	0	111.7	S24 F25 F26	S24-S28 WeakPolarHBondContact O-CB 3.45Å; S24-S28 PolarHBondContact O-N 3.13Å; S24-S28 PolarHBondContact O-OG 3.45Å; F25-S28 PolarHBondContact O-N 2.62Å; F26-S28 PolarHBondContact O-N 2.74Å
29	L	65.7	Low	60.5	Low	108 Å²	108	99 Å²	99	57%	0.565	56%	0.564	S	S	*	*	H	α-helix	trans	-70.8	-37	177.9	-160.8	76	0	0	0	112.3	F25 F26 L61	F25-L29 PolarHBondContact O-N 3.35Å; F26-L29 PolarHBondContact O-N 2.99Å; L29-L61 HydrophobicContact CD2-CD2 4.12Å
30	L	60.6	Low	58.9	Low	102 Å²	102	97.9 Å²	97.9	53%	0.534	56%	0.562	S	S	.	*	S	Bend	trans	-92.5	-11.1	177.2	-59.1	173.2	0	0	0	112.4	F26 G32 V34	F26-L30 VanDerWaalsContact O-CB 3.3Å; F26-L30 WeakPolarHBondContact O-CB 3.49Å; F26-L30 VanDerWaalsContact O-CG 3.29Å; F26-L30 WeakPolarHBondContact O-CG 3.45Å; F26-L30 PolarHBondContact O-N 3.29Å; L30-G32 VanDerWaalsContact C-N 3.35Å; L30-G32 PolarHBondContact O-N 3.41Å; L30-V34 WeakPolarHBondContact O-CG1 3.47Å
31	G	51.7	Low	57.9	Low	33 Å²	33	102.1 Å²	102.1	34%	0.34	58%	0.584	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.1	-13.1	-167.8	0	0	0	0	0	116.2	S27 D33	S27-G31 WeakPolarHBondContact O-CA 3.44Å; S27-G31 PolarHBondContact O-N 2.91Å; G31-D33 VanDerWaalsContact C-N 3.32Å; G31-D33 PolarHBondContact O-N 3.19Å
32	G	52.8	Low	56.5	Low	64 Å²	64	100.5 Å²	100.5	66%	0.66	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.8	-27.7	180	0	0	0	0	0	114	L30	L30-G32 VanDerWaalsContact C-N 3.35Å; L30-G32 PolarHBondContact O-N 3.41Å
33	D	48.8	Very low	55.4	Low	157 Å²	157	102 Å²	102	84%	0.84	61%	0.605	S	S	*	*	S	Bend	trans	-126.1	18.8	-172.3	-82.7	-28	0	0	0	113.9	G31	G31-D33 VanDerWaalsContact C-N 3.32Å; G31-D33 PolarHBondContact O-N 3.19Å
34	V	51.7	Low	54.8	Low	85 Å²	85	103.9 Å²	103.9	52%	0.515	63%	0.625	S	S	.	*			trans	-104.4	23.1	176	-62.1	0	0	0	0	113.2	L30 S36	L30-V34 WeakPolarHBondContact O-CG1 3.47Å; V34-S36 PolarHBondContact O-N 3.07Å
35	V	47.8	Very low	54.3	Low	135 Å²	135	103 Å²	103	82%	0.818	63%	0.627	S	S	*	*	S	Bend	trans	-64.5	105.8	168.6	-175.2	0	0	0	0	107.6
36	S	47.4	Very low	53.4	Low	87 Å²	87	101 Å²	101	61%	0.608	63%	0.632	S	S	*	*			trans	81.5	80.8	168.9	-153.8	0	0	0	0	115.3	V34 K38	V34-S36 PolarHBondContact O-N 3.07Å; S36-K38 PolarHBondContact O-N 3.18Å; S36-K38 WeakPolarHBondContact OG-CB 3.31Å; S36-K38 PolarHBondContact OG-N 3.49Å
37	V	46.2	Very low	53.7	Low	121 Å²	121	99.9 Å²	99.9	73%	0.733	64%	0.635	S	S	*	*			trans	-66	72.4	137.3	-172.1	0	0	0	0	106.6	L39	V37-L39 VanDerWaalsContact C-N 3.34Å; V37-L39 HydrophobicContact CG1-CD2 3.51Å; V37-L39 HydrophobicContact CG1-CG 3.87Å; V37-L39 PolarHBondContact O-N 3.11Å; V37-L39 VanDerWaalsContact O-N 3.17Å
38	K	43.3	Very low	54.3	Low	140 Å²	140	100.1 Å²	100.1	61%	0.609	63%	0.634	S	S	*	*			trans	-69.1	109.9	153.9	-169.9	-178.4	171.4	-150.5	0	102.6	S36 D40	S36-K38 PolarHBondContact O-N 3.18Å; S36-K38 WeakPolarHBondContact OG-CB 3.31Å; S36-K38 PolarHBondContact OG-N 3.49Å; K38-D40 WeakPolarHBondContact CB-OD1 3.32Å; K38-D40 VanDerWaalsContact CD-OD1 3.24Å; K38-D40 WeakPolarHBondContact CD-OD1 3.31Å; K38-D40 VanDerWaalsContact CD-OD2 3.32Å; K38-D40 WeakPolarHBondContact CD-OD2 3.41Å; K38-D40 WeakPolarHBondContact CE-OD2 3.46Å; K38-D40 WeakPolarHBondContact CG-OD1 3.37Å; K38-D40 IonicContact NZ-OD2 2.77Å; K38-D40 PolarHBondContact NZ-OD2 2.87Å; K38-D40 PolarHBondContact O-N 3.43Å
39	L	49.1	Very low	54.7	Low	158 Å²	158	99.5 Å²	99.5	83%	0.827	63%	0.625	S	S	*	*			trans	-69.8	65.7	167.7	-65.2	172.1	0	0	0	106.4	V37 N41	V37-L39 VanDerWaalsContact C-N 3.34Å; V37-L39 HydrophobicContact CG1-CD2 3.51Å; V37-L39 HydrophobicContact CG1-CG 3.87Å; V37-L39 PolarHBondContact O-N 3.11Å; V37-L39 VanDerWaalsContact O-N 3.17Å; L39-N41 VanDerWaalsContact C-N 3.32Å; L39-N41 PolarHBondContact O-N 3.03Å
40	D	39.1	Very low	55.5	Low	89 Å²	89	96.6 Å²	96.6	48%	0.476	62%	0.617	S	S	.	*			trans	-64.4	102.6	164.3	-48.9	60.7	0	0	0	105	K38 S42	K38-D40 WeakPolarHBondContact CB-OD1 3.32Å; K38-D40 VanDerWaalsContact CD-OD1 3.24Å; K38-D40 WeakPolarHBondContact CD-OD1 3.31Å; K38-D40 VanDerWaalsContact CD-OD2 3.32Å; K38-D40 WeakPolarHBondContact CD-OD2 3.41Å; K38-D40 WeakPolarHBondContact CE-OD2 3.46Å; K38-D40 WeakPolarHBondContact CG-OD1 3.37Å; K38-D40 IonicContact NZ-OD2 2.77Å; K38-D40 PolarHBondContact NZ-OD2 2.87Å; K38-D40 PolarHBondContact O-N 3.43Å; D40-S42 PolarHBondContact O-N 3.19Å
41	N	50.9	Low	56.6	Low	164 Å²	164	95.9 Å²	95.9	88%	0.877	61%	0.613	S	S	*	*			trans	-63.5	60.5	171.3	-175	85.2	0	0	0	110.6	L39	L39-N41 VanDerWaalsContact C-N 3.32Å; L39-N41 PolarHBondContact O-N 3.03Å
42	S	50.8	Low	58.5	Low	102 Å²	102	98.5 Å²	98.5	71%	0.713	62%	0.619	S	S	*	*			trans	-146.1	110.2	-174.4	-68.8	0	0	0	0	109.7	D40	D40-S42 PolarHBondContact O-N 3.19Å
43	A	53.8	Low	60.2	Low	75 Å²	75	99.2 Å²	99.2	62%	0.62	61%	0.608	S	S	*	*			trans	84.1	73.9	179.5	0	0	0	0	0	116.9	G45 A46	A43-G45 PolarHBondContact O-N 3.46Å; A43-A46 PolarHBondContact O-N 3.46Å
44	S	56.3	Low	62.1	Low	119 Å²	119	97.7 Å²	97.7	83%	0.832	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	11	-179.7	-165.7	0	0	0	0	117.5
45	G	59.2	Low	63.8	Low	51 Å²	51	97.9 Å²	97.9	53%	0.526	59%	0.591	S	S	.	*	T	Hydrogen-bonded Turn	trans	-117.7	-26.4	175.5	0	0	0	0	0	114.5	A43	A43-G45 PolarHBondContact O-N 3.46Å
46	A	61.2	Low	65.9	Low	72 Å²	72	96.8 Å²	96.8	60%	0.595	58%	0.577	S	S	*	*	H	α-helix	trans	-83.3	-31.5	-176.8	0	0	0	0	0	112.9	A43 A50	A43-A46 PolarHBondContact O-N 3.46Å; A46-A50 PolarHBondContact O-N 2.9Å
47	S	63.9	Low	68	Low	68 Å²	68	98.8 Å²	98.8	48%	0.476	58%	0.577	S	S	.	*	H	α-helix	trans	-77.5	-30.5	179	83.5	0	0	0	0	113.3	A50 I51	S47-A50 PolarHBondContact O-N 2.84Å; S47-I51 WeakPolarHBondContact O-CB 2.88Å; S47-I51 WeakPolarHBondContact O-CD1 3.26Å; S47-I51 WeakPolarHBondContact O-CG1 3.34Å; S47-I51 PolarHBondContact O-N 2.95Å
48	V	71.9	Confident	70.1	Confident	76 Å²	76	95.4 Å²	95.4	46%	0.461	56%	0.561	S	S	.	*	H	α-helix	trans	-60.4	-48.1	173.6	157.3	0	0	0	0	110.9	A50 I51 D52	V48-A50 VanDerWaalsContact C-N 3.29Å; V48-A50 PolarHBondContact O-N 3.46Å; V48-I51 WeakPolarHBondContact O-CB 3.31Å; V48-I51 PolarHBondContact O-N 2.96Å; V48-I51 VanDerWaalsContact O-N 3.08Å; V48-D52 PolarHBondContact O-N 3.42Å
49	V	75.9	Confident	72.5	Confident	83 Å²	83	94.3 Å²	94.3	50%	0.503	56%	0.56	S	S	.	*	H	α-helix	trans	-63.7	-36.7	177.2	179.5	0	0	0	0	111.5	I51 D52 N53	V49-I51 VanDerWaalsContact C-N 3.31Å; V49-I51 PolarHBondContact O-N 3.42Å; V49-D52 PolarHBondContact O-N 3.32Å; V49-N53 PolarHBondContact O-N 3.14Å; V49-N53 VanDerWaalsContact O-N 3.15Å; V49-N53 PolarHBondContact O-ND2 3.23Å
50	A	83.2	Confident	74.6	Confident	48 Å²	48	90.3 Å²	90.3	40%	0.397	54%	0.539	S	S	.	.	H	α-helix	trans	-68.7	-30.2	175.3	0	0	0	0	0	112.9	A46 S47 V48 K54	A46-A50 PolarHBondContact O-N 2.9Å; S47-A50 PolarHBondContact O-N 2.84Å; V48-A50 VanDerWaalsContact C-N 3.29Å; V48-A50 PolarHBondContact O-N 3.46Å; A50-K54 WeakPolarHBondContact O-CG 2.91Å; A50-K54 PolarHBondContact O-N 3.03Å
51	I	84.6	Confident	77.2	Confident	86 Å²	86	89.8 Å²	89.8	44%	0.441	54%	0.536	S	S	.	.	H	α-helix	trans	-71.8	-46.5	174.7	-71	161.4	0	0	0	110.1	S47 V48 V49 N53 K54 I55	S47-I51 WeakPolarHBondContact O-CB 2.88Å; S47-I51 WeakPolarHBondContact O-CD1 3.26Å; S47-I51 WeakPolarHBondContact O-CG1 3.34Å; S47-I51 PolarHBondContact O-N 2.95Å; V48-I51 WeakPolarHBondContact O-CB 3.31Å; V48-I51 PolarHBondContact O-N 2.96Å; V48-I51 VanDerWaalsContact O-N 3.08Å; V49-I51 VanDerWaalsContact C-N 3.31Å; V49-I51 PolarHBondContact O-N 3.42Å; I51-N53 VanDerWaalsContact C-N 3.29Å; I51-N53 PolarHBondContact O-N 3.38Å; I51-K54 WeakPolarHBondContact O-CB 3.48Å; I51-K54 PolarHBondContact O-N 3.18Å; I51-I55 HydrophobicContact CG2-CD1 3.78Å; I51-I55 HydrophobicContact CG2-CG1 4.33Å; I51-I55 WeakPolarHBondContact O-CG1 3.07Å; I51-I55 PolarHBondContact O-N 3.34Å
52	D	90.4	Very high	79.2	Confident	89 Å²	89	85.9 Å²	85.9	48%	0.476	52%	0.518	S	S	.	.	H	α-helix	trans	-58.1	-43	178.6	-66.9	-20.5	0	0	0	111.1	V48 V49 K54 I55 E56	V48-D52 PolarHBondContact O-N 3.42Å; V49-D52 PolarHBondContact O-N 3.32Å; D52-K54 VanDerWaalsContact C-N 3.3Å; D52-K54 PolarHBondContact O-N 2.92Å; D52-I55 PolarHBondContact O-N 3.01Å; D52-E56 WeakPolarHBondContact O-CB 3.47Å; D52-E56 PolarHBondContact O-N 3.46Å
53	N	89.3	Confident	81.3	Confident	79 Å²	79	86.4 Å²	86.4	42%	0.422	51%	0.507	S	S	.	.	H	α-helix	trans	-63.9	-31.7	175.2	-71.8	-18.5	0	0	0	113.3	V49 I51 Q57	V49-N53 PolarHBondContact O-N 3.14Å; V49-N53 VanDerWaalsContact O-N 3.15Å; V49-N53 PolarHBondContact O-ND2 3.23Å; I51-N53 VanDerWaalsContact C-N 3.29Å; I51-N53 PolarHBondContact O-N 3.38Å; N53-Q57 WeakPolarHBondContact O-CB 3.26Å; N53-Q57 WeakPolarHBondContact O-CG 3.5Å; N53-Q57 PolarHBondContact O-N 2.94Å; N53-Q57 PolarHBondContact O-NE2 2.93Å
54	K	87.3	Confident	83.2	Confident	125 Å²	125	86.2 Å²	86.2	54%	0.543	50%	0.496	S	S	.	.	H	α-helix	trans	-77	-35.1	176.8	-77.2	175.5	179.7	-73	0	111.7	A50 I51 D52 A58	A50-K54 WeakPolarHBondContact O-CG 2.91Å; A50-K54 PolarHBondContact O-N 3.03Å; I51-K54 WeakPolarHBondContact O-CB 3.48Å; I51-K54 PolarHBondContact O-N 3.18Å; D52-K54 VanDerWaalsContact C-N 3.3Å; D52-K54 PolarHBondContact O-N 2.92Å; K54-A58 PolarHBondContact O-N 3.38Å
55	I	88.9	Confident	85	Confident	89 Å²	89	86.9 Å²	86.9	46%	0.456	49%	0.486	S	S	.	.	H	α-helix	trans	-64.6	-46.2	172.1	-67.8	169.7	0	0	0	109.5	I51 D52 Q57 A58 M59	I51-I55 HydrophobicContact CG2-CD1 3.78Å; I51-I55 HydrophobicContact CG2-CG1 4.33Å; I51-I55 WeakPolarHBondContact O-CG1 3.07Å; I51-I55 PolarHBondContact O-N 3.34Å; D52-I55 PolarHBondContact O-N 3.01Å; I55-Q57 PolarHBondContact O-N 3.44Å; I55-A58 PolarHBondContact O-N 3.36Å; I55-M59 HydrophobicContact CG2-CG 4.39Å; I55-M59 HydrophobicContact CG2-SD 3.89Å; I55-M59 WeakPolarHBondContact O-CB 3.25Å; I55-M59 VanDerWaalsContact O-CG 3.31Å; I55-M59 WeakPolarHBondContact O-CG 3.42Å; I55-M59 PolarHBondContact O-N 3.47Å
56	E	91.4	Very high	86.7	Confident	112 Å²	112	89.1 Å²	89.1	52%	0.523	49%	0.485	S	S	.	.	H	α-helix	trans	-60.1	-44.2	177.2	-170.8	167.5	-149	0	0	111.6	D52 A58 M59 D60	D52-E56 WeakPolarHBondContact O-CB 3.47Å; D52-E56 PolarHBondContact O-N 3.46Å; E56-A58 PolarHBondContact O-N 2.77Å; E56-M59 WeakPolarHBondContact O-CB 3.18Å; E56-M59 PolarHBondContact O-N 2.9Å; E56-D60 WeakPolarHBondContact O-CB 3.46Å; E56-D60 PolarHBondContact O-N 2.97Å
57	Q	90.9	Very high	88.1	Confident	129 Å²	129	91.6 Å²	91.6	60%	0.603	49%	0.486	S	S	*	.	H	α-helix	trans	-60.5	-43.8	174.8	-78.5	168.9	66.4	0	0	113.3	N53 I55 M59 D60 L61	N53-Q57 WeakPolarHBondContact O-CB 3.26Å; N53-Q57 WeakPolarHBondContact O-CG 3.5Å; N53-Q57 PolarHBondContact O-N 2.94Å; N53-Q57 PolarHBondContact O-NE2 2.93Å; I55-Q57 PolarHBondContact O-N 3.44Å; Q57-M59 VanDerWaalsContact C-N 3.33Å; Q57-D60 PolarHBondContact O-N 2.89Å; Q57-L61 WeakPolarHBondContact O-CB 3.18Å; Q57-L61 PolarHBondContact O-N 3.01Å
58	A	90.5	Very high	89.5	Confident	50 Å²	50	94.9 Å²	94.9	41%	0.413	49%	0.489	S	S	.	.	H	α-helix	trans	-65.1	-40.4	176.8	0	0	0	0	0	111.3	K54 I55 E56 L61 V62	K54-A58 PolarHBondContact O-N 3.38Å; I55-A58 PolarHBondContact O-N 3.36Å; E56-A58 PolarHBondContact O-N 2.77Å; A58-L61 PolarHBondContact O-N 3.1Å; A58-V62 VanDerWaalsContact O-CG2 3.31Å; A58-V62 WeakPolarHBondContact O-CG2 3.3Å; A58-V62 PolarHBondContact O-N 3.47Å
59	M	94.2	Very high	90.5	Very high	117 Å²	117	92.9 Å²	92.9	58%	0.576	48%	0.48	S	S	*	.	H	α-helix	trans	-64.4	-44.1	176.1	-75.5	177.9	61.4	0	0	112.2	I55 E56 Q57 L61 V62 K63	I55-M59 HydrophobicContact CG2-CG 4.39Å; I55-M59 HydrophobicContact CG2-SD 3.89Å; I55-M59 WeakPolarHBondContact O-CB 3.25Å; I55-M59 VanDerWaalsContact O-CG 3.31Å; I55-M59 WeakPolarHBondContact O-CG 3.42Å; I55-M59 PolarHBondContact O-N 3.47Å; E56-M59 WeakPolarHBondContact O-CB 3.18Å; E56-M59 PolarHBondContact O-N 2.9Å; Q57-M59 VanDerWaalsContact C-N 3.33Å; M59-L61 VanDerWaalsContact C-N 3.34Å; M59-V62 PolarHBondContact O-N 3.37Å; M59-K63 VanDerWaalsContact O-CB 3.3Å; M59-K63 WeakPolarHBondContact O-CB 3.45Å; M59-K63 PolarHBondContact O-N 3.05Å
60	D	92.8	Very high	91.4	Very high	74 Å²	74	93.1 Å²	93.1	40%	0.396	48%	0.482	S	S	.	.	H	α-helix	trans	-68	-35.1	178.7	-80.2	-19.8	0	0	0	112	E56 Q57 K63 N64	E56-D60 WeakPolarHBondContact O-CB 3.46Å; E56-D60 PolarHBondContact O-N 2.97Å; Q57-D60 PolarHBondContact O-N 2.89Å; D60-K63 PolarHBondContact O-N 3.27Å; D60-K63 IonicContact OD1-NZ 2.84Å; D60-K63 PolarHBondContact OD1-NZ 3.28Å; D60-N64 WeakPolarHBondContact O-CB 3.4Å; D60-N64 PolarHBondContact O-N 3.42Å
61	L	93.4	Very high	91.9	Very high	77 Å²	77	98.6 Å²	98.6	40%	0.403	49%	0.492	S	S	.	.	H	α-helix	trans	-62.5	-46.6	172.1	-172.4	70.4	0	0	0	111.4	L29 Q57 A58 M59 N64 H65	L29-L61 HydrophobicContact CD2-CD2 4.12Å; Q57-L61 WeakPolarHBondContact O-CB 3.18Å; Q57-L61 PolarHBondContact O-N 3.01Å; A58-L61 PolarHBondContact O-N 3.1Å; M59-L61 VanDerWaalsContact C-N 3.34Å; L61-N64 PolarHBondContact O-N 3.06Å; L61-H65 WeakPolarHBondContact O-CB 3.15Å; L61-H65 PolarHBondContact O-N 3.44Å
62	V	93.3	Very high	92.4	Very high	83 Å²	83	100.5 Å²	100.5	50%	0.503	50%	0.499	S	S	.	.	H	α-helix	trans	-62.8	-45.3	176.8	170.4	0	0	0	0	110.9	A58 M59 N64 H65 L66	A58-V62 VanDerWaalsContact O-CG2 3.31Å; A58-V62 WeakPolarHBondContact O-CG2 3.3Å; A58-V62 PolarHBondContact O-N 3.47Å; M59-V62 PolarHBondContact O-N 3.37Å; V62-N64 VanDerWaalsContact C-N 3.35Å; V62-N64 PolarHBondContact O-N 3.34Å; V62-H65 PolarHBondContact O-N 3.14Å; V62-L66 HydrophobicContact CG1-CD1 4.01Å; V62-L66 HydrophobicContact CG1-CG 4.43Å; V62-L66 WeakPolarHBondContact O-CB 3.25Å; V62-L66 WeakPolarHBondContact O-CG 3.38Å; V62-L66 PolarHBondContact O-N 3.3Å
63	K	95.3	Very high	92.5	Very high	113 Å²	113	101.9 Å²	101.9	49%	0.491	50%	0.503	S	S	.	.	H	α-helix	trans	-59	-47.3	177.3	-176	-169.1	-64.5	149.8	0	110.8	M59 D60 L66 M67	M59-K63 VanDerWaalsContact O-CB 3.3Å; M59-K63 WeakPolarHBondContact O-CB 3.45Å; M59-K63 PolarHBondContact O-N 3.05Å; D60-K63 PolarHBondContact O-N 3.27Å; D60-K63 IonicContact OD1-NZ 2.84Å; D60-K63 PolarHBondContact OD1-NZ 3.28Å; K63-L66 PolarHBondContact O-N 3Å; K63-M67 WeakPolarHBondContact O-CB 3.48Å; K63-M67 VanDerWaalsContact O-CG 3.31Å; K63-M67 WeakPolarHBondContact O-CG 3.46Å; K63-M67 PolarHBondContact O-N 2.84Å
64	N	93.1	Very high	92.8	Very high	71 Å²	71	101 Å²	101	38%	0.38	50%	0.5	S	S	.	.	H	α-helix	trans	-63.7	-44.8	179.6	-162.7	24	0	0	0	111.2	D60 L61 V62 L66 M67 Y68	D60-N64 WeakPolarHBondContact O-CB 3.4Å; D60-N64 PolarHBondContact O-N 3.42Å; L61-N64 PolarHBondContact O-N 3.06Å; V62-N64 VanDerWaalsContact C-N 3.35Å; V62-N64 PolarHBondContact O-N 3.34Å; N64-L66 PolarHBondContact O-N 2.97Å; N64-M67 PolarHBondContact O-N 3.32Å; N64-Y68 VanDerWaalsContact CG-CE2 3.42Å; N64-Y68 WeakPolarHBondContact O-CD2 3.21Å; N64-Y68 PolarHBondContact O-N 3.3Å; N64-Y68 WeakPolarHBondContact OD1-CE2 3.46Å
65	H	94.5	Very high	93.2	Very high	132 Å²	132	99 Å²	99	61%	0.611	49%	0.493	S	S	*	.	H	α-helix	trans	-60.9	-46.2	176.9	-174	64.6	0	0	0	112.3	L61 V62 M67 Y68 A69	L61-H65 WeakPolarHBondContact O-CB 3.15Å; L61-H65 PolarHBondContact O-N 3.44Å; V62-H65 PolarHBondContact O-N 3.14Å; H65-M67 PolarHBondContact O-N 3.34Å; H65-Y68 PolarHBondContact O-N 3.49Å; H65-A69 WeakPolarHBondContact O-CB 3.4Å; H65-A69 PolarHBondContact O-N 3.48Å
66	L	94.8	Very high	93.6	Very high	99 Å²	99	98.1 Å²	98.1	52%	0.518	49%	0.488	S	S	.	.	H	α-helix	trans	-62.9	-41.9	176.7	-72.7	175.2	0	0	0	111.9	V62 K63 N64 Y68 A69 V70	V62-L66 HydrophobicContact CG1-CD1 4.01Å; V62-L66 HydrophobicContact CG1-CG 4.43Å; V62-L66 WeakPolarHBondContact O-CB 3.25Å; V62-L66 WeakPolarHBondContact O-CG 3.38Å; V62-L66 PolarHBondContact O-N 3.3Å; K63-L66 PolarHBondContact O-N 3Å; N64-L66 PolarHBondContact O-N 2.97Å; L66-Y68 VanDerWaalsContact C-N 3.31Å; L66-Y68 PolarHBondContact O-N 3.47Å; L66-A69 PolarHBondContact O-N 2.93Å; L66-V70 VanDerWaalsContact O-CB 3.25Å; L66-V70 WeakPolarHBondContact O-CB 3.48Å; L66-V70 WeakPolarHBondContact O-CG2 3.31Å; L66-V70 PolarHBondContact O-N 3.44Å
67	M	90.4	Very high	93.9	Very high	124 Å²	124	97.1 Å²	97.1	61%	0.611	49%	0.486	S	S	*	.	H	α-helix	trans	-61.5	-40.7	176.9	-74.9	-147.3	-60.2	0	0	112	K63 N64 H65 R71	K63-M67 WeakPolarHBondContact O-CB 3.48Å; K63-M67 VanDerWaalsContact O-CG 3.31Å; K63-M67 WeakPolarHBondContact O-CG 3.46Å; K63-M67 PolarHBondContact O-N 2.84Å; N64-M67 PolarHBondContact O-N 3.32Å; H65-M67 PolarHBondContact O-N 3.34Å; M67-R71 WeakPolarHBondContact O-CB 3.46Å; M67-R71 PolarHBondContact O-N 2.91Å; M67-R71 VanDerWaalsContact O-N 3.1Å
68	Y	94.2	Very high	94.2	Very high	136 Å²	136	96.6 Å²	96.6	53%	0.533	48%	0.482	S	S	.	.	H	α-helix	trans	-69.3	-47.7	176.2	-73.3	-59.7	0	0	0	112.7	N64 H65 L66 V70 R71 E72	N64-Y68 VanDerWaalsContact CG-CE2 3.42Å; N64-Y68 WeakPolarHBondContact O-CD2 3.21Å; N64-Y68 PolarHBondContact O-N 3.3Å; N64-Y68 WeakPolarHBondContact OD1-CE2 3.46Å; H65-Y68 PolarHBondContact O-N 3.49Å; L66-Y68 VanDerWaalsContact C-N 3.31Å; L66-Y68 PolarHBondContact O-N 3.47Å; Y68-V70 PolarHBondContact O-N 3.4Å; Y68-R71 WeakPolarHBondContact O-CB 3.3Å; Y68-R71 PolarHBondContact O-N 3.45Å; Y68-E72 WeakPolarHBondContact O-CB 3.29Å; Y68-E72 PolarHBondContact O-N 2.88Å
69	A	92.3	Very high	94.5	Very high	34 Å²	34	99.1 Å²	99.1	28%	0.281	49%	0.485	S	S	.	.	H	α-helix	trans	-61.2	-45.9	-179.8	0	0	0	0	0	111.4	H65 L66 R71 E72 E73	H65-A69 WeakPolarHBondContact O-CB 3.4Å; H65-A69 PolarHBondContact O-N 3.48Å; L66-A69 PolarHBondContact O-N 2.93Å; A69-R71 VanDerWaalsContact C-N 3.33Å; A69-R71 PolarHBondContact O-N 2.89Å; A69-E72 PolarHBondContact O-N 2.92Å; A69-E73 VanDerWaalsContact O-CG 3.3Å; A69-E73 WeakPolarHBondContact O-CG 3.31Å; A69-E73 PolarHBondContact O-N 3.42Å
70	V	94.8	Very high	94.6	Very high	89 Å²	89	98.3 Å²	98.3	54%	0.539	48%	0.48	S	S	.	.	H	α-helix	trans	-64.2	-40.3	178.2	172.5	0	0	0	0	111.3	L66 Y68 V74	L66-V70 VanDerWaalsContact O-CB 3.25Å; L66-V70 WeakPolarHBondContact O-CB 3.48Å; L66-V70 WeakPolarHBondContact O-CG2 3.31Å; L66-V70 PolarHBondContact O-N 3.44Å; Y68-V70 PolarHBondContact O-N 3.4Å; V70-V74 WeakPolarHBondContact O-CB 3.37Å; V70-V74 VanDerWaalsContact O-CG2 3.26Å; V70-V74 WeakPolarHBondContact O-CG2 3.5Å; V70-V74 PolarHBondContact O-N 3.03Å
71	R	94	Very high	94.8	Very high	163 Å²	163	100.3 Å²	100.3	62%	0.615	49%	0.489	S	S	*	.	H	α-helix	trans	-58.6	-54.8	174.3	175.9	-178.4	-103.5	175.5	-2.2	110.1	M67 Y68 A69 E73 V74 E75	M67-R71 WeakPolarHBondContact O-CB 3.46Å; M67-R71 PolarHBondContact O-N 2.91Å; M67-R71 VanDerWaalsContact O-N 3.1Å; Y68-R71 WeakPolarHBondContact O-CB 3.3Å; Y68-R71 PolarHBondContact O-N 3.45Å; A69-R71 VanDerWaalsContact C-N 3.33Å; A69-R71 PolarHBondContact O-N 2.89Å; R71-E73 PolarHBondContact O-N 2.85Å; R71-V74 WeakPolarHBondContact O-CB 2.9Å; R71-V74 PolarHBondContact O-N 3.23Å; R71-E75 WeakPolarHBondContact CG-OE2 3.27Å; R71-E75 PolarHBondContact O-N 3.06Å
72	E	94.5	Very high	95	Very high	126 Å²	126	102.3 Å²	102.3	59%	0.589	50%	0.495	S	S	*	.	H	α-helix	trans	-55.9	-46.9	-179.3	-174.4	167.7	-161.8	0	0	112.6	Y68 A69 V74 E75 I76	Y68-E72 WeakPolarHBondContact O-CB 3.29Å; Y68-E72 PolarHBondContact O-N 2.88Å; A69-E72 PolarHBondContact O-N 2.92Å; E72-V74 VanDerWaalsContact C-N 3.32Å; E72-V74 PolarHBondContact O-N 2.96Å; E72-E75 PolarHBondContact O-N 3.45Å; E72-I76 HydrophobicContact CG-CD1 3.97Å; E72-I76 VanDerWaalsContact O-CG1 3.31Å; E72-I76 WeakPolarHBondContact O-CG1 3.43Å; E72-I76 PolarHBondContact O-N 3.46Å
73	E	92.1	Very high	95.2	Very high	117 Å²	117	103.2 Å²	103.2	55%	0.547	49%	0.493	S	S	.	.	H	α-helix	trans	-59.4	-41	175.8	-69.1	-66.3	156.6	0	0	112.2	A69 R71 I76 L77	A69-E73 VanDerWaalsContact O-CG 3.3Å; A69-E73 WeakPolarHBondContact O-CG 3.31Å; A69-E73 PolarHBondContact O-N 3.42Å; R71-E73 PolarHBondContact O-N 2.85Å; E73-I76 PolarHBondContact O-N 2.98Å; E73-L77 WeakPolarHBondContact O-CB 3.3Å; E73-L77 VanDerWaalsContact O-CG 3.25Å; E73-L77 WeakPolarHBondContact O-CG 3.29Å; E73-L77 PolarHBondContact O-N 3.46Å
74	V	96.4	Very high	95.3	Very high	62 Å²	62	103.5 Å²	103.5	38%	0.376	50%	0.5	S	S	.	.	H	α-helix	trans	-65.3	-41.4	176.4	167.5	0	0	0	0	111.5	V70 R71 E72 L77 K78	V70-V74 WeakPolarHBondContact O-CB 3.37Å; V70-V74 VanDerWaalsContact O-CG2 3.26Å; V70-V74 WeakPolarHBondContact O-CG2 3.5Å; V70-V74 PolarHBondContact O-N 3.03Å; R71-V74 WeakPolarHBondContact O-CB 2.9Å; R71-V74 PolarHBondContact O-N 3.23Å; E72-V74 VanDerWaalsContact C-N 3.32Å; E72-V74 PolarHBondContact O-N 2.96Å; V74-L77 PolarHBondContact O-N 2.83Å; V74-K78 HydrophobicContact CG1-CD 4.3Å; V74-K78 VanDerWaalsContact O-CG 3.31Å; V74-K78 WeakPolarHBondContact O-CG 3.33Å; V74-K78 PolarHBondContact O-N 3.32Å
75	E	96.1	Very high	95.4	Very high	81 Å²	81	103 Å²	103	38%	0.379	51%	0.505	S	S	.	.	H	α-helix	trans	-66.1	-41.2	177	-93	65.1	-114.2	0	0	112.1	R71 E72 K78 E79	R71-E75 WeakPolarHBondContact CG-OE2 3.27Å; R71-E75 PolarHBondContact O-N 3.06Å; E72-E75 PolarHBondContact O-N 3.45Å; E75-K78 PolarHBondContact O-N 2.82Å; E75-K78 IonicContact OE1-NZ 2.74Å; E75-K78 PolarHBondContact OE1-NZ 2.82Å; E75-E79 PolarHBondContact O-N 2.83Å; E75-E79 VanDerWaalsContact O-N 3.11Å
76	I	96.3	Very high	95.5	Very high	72 Å²	72	103.4 Å²	103.4	37%	0.369	51%	0.507	S	S	.	.	H	α-helix	trans	-59.9	-48.5	173.9	-68.8	165.6	0	0	0	110.3	E72 E73 K78 E79 Q80	E72-I76 HydrophobicContact CG-CD1 3.97Å; E72-I76 VanDerWaalsContact O-CG1 3.31Å; E72-I76 WeakPolarHBondContact O-CG1 3.43Å; E72-I76 PolarHBondContact O-N 3.46Å; E73-I76 PolarHBondContact O-N 2.98Å; I76-K78 VanDerWaalsContact C-N 3.32Å; I76-K78 PolarHBondContact O-N 2.78Å; I76-E79 PolarHBondContact O-N 2.96Å; I76-Q80 HydrophobicContact CG2-CG 4.42Å; I76-Q80 WeakPolarHBondContact O-CG 3.36Å; I76-Q80 PolarHBondContact O-N 3.04Å
77	L	97.6	Very high	95.6	Very high	90 Å²	90	104 Å²	104	47%	0.471	51%	0.506	S	S	.	.	H	α-helix	trans	-60.1	-40.9	179	-74.3	170.3	0	0	0	112.2	E73 V74 E79 Q80 I81	E73-L77 WeakPolarHBondContact O-CB 3.3Å; E73-L77 VanDerWaalsContact O-CG 3.25Å; E73-L77 WeakPolarHBondContact O-CG 3.29Å; E73-L77 PolarHBondContact O-N 3.46Å; V74-L77 PolarHBondContact O-N 2.83Å; L77-E79 PolarHBondContact O-N 3.36Å; L77-Q80 PolarHBondContact O-N 3.27Å; L77-I81 VanDerWaalsContact O-CG1 3.26Å; L77-I81 WeakPolarHBondContact O-CG1 3.28Å; L77-I81 PolarHBondContact O-N 3.38Å
78	K	97	Very high	95.8	Very high	118 Å²	118	102.2 Å²	102.2	51%	0.513	50%	0.499	S	S	.	.	H	α-helix	trans	-60.9	-43.8	175.8	-75.3	170.1	-173.9	164.1	0	112	V74 E75 I76 I81 K82	V74-K78 HydrophobicContact CG1-CD 4.3Å; V74-K78 VanDerWaalsContact O-CG 3.31Å; V74-K78 WeakPolarHBondContact O-CG 3.33Å; V74-K78 PolarHBondContact O-N 3.32Å; E75-K78 PolarHBondContact O-N 2.82Å; E75-K78 IonicContact OE1-NZ 2.74Å; E75-K78 PolarHBondContact OE1-NZ 2.82Å; I76-K78 VanDerWaalsContact C-N 3.32Å; I76-K78 PolarHBondContact O-N 2.78Å; K78-I81 PolarHBondContact O-N 3.48Å; K78-K82 WeakPolarHBondContact O-CB 3.36Å; K78-K82 PolarHBondContact O-N 3.26Å
79	E	96.4	Very high	95.9	Very high	103 Å²	103	99.6 Å²	99.6	48%	0.481	49%	0.494	S	S	.	.	H	α-helix	trans	-68	-39.5	178.9	-164.3	60.7	-142.5	0	0	111.1	E75 I76 L77 I81 K82 E83	E75-E79 PolarHBondContact O-N 2.83Å; E75-E79 VanDerWaalsContact O-N 3.11Å; I76-E79 PolarHBondContact O-N 2.96Å; L77-E79 PolarHBondContact O-N 3.36Å; E79-I81 PolarHBondContact O-N 3.18Å; E79-K82 WeakPolarHBondContact O-CB 3.5Å; E79-K82 PolarHBondContact O-N 2.93Å; E79-K82 IonicContact OE1-NZ 2.78Å; E79-K82 PolarHBondContact OE1-NZ 2.85Å; E79-K82 IonicContact OE2-NZ 3.3Å; E79-K82 PolarHBondContact OE2-NZ 3.47Å; E79-E83 PolarHBondContact O-N 3.39Å
80	Q	97.3	Very high	96	Very high	100 Å²	100	101.8 Å²	101.8	47%	0.467	50%	0.499	S	S	.	.	H	α-helix	trans	-60.1	-44	173.7	-72.8	179.3	-32.4	0	0	112.4	I76 L77 K82 E83 L84	I76-Q80 HydrophobicContact CG2-CG 4.42Å; I76-Q80 WeakPolarHBondContact O-CG 3.36Å; I76-Q80 PolarHBondContact O-N 3.04Å; L77-Q80 PolarHBondContact O-N 3.27Å; Q80-K82 VanDerWaalsContact C-N 3.31Å; Q80-K82 PolarHBondContact O-N 3.43Å; Q80-E83 PolarHBondContact O-N 2.77Å; Q80-L84 WeakPolarHBondContact O-CB 3.4Å; Q80-L84 WeakPolarHBondContact O-CG 2.98Å; Q80-L84 PolarHBondContact O-N 2.91Å
81	I	96.9	Very high	96	Very high	116 Å²	116	102.5 Å²	102.5	60%	0.595	50%	0.499	S	S	*	.	H	α-helix	trans	-60.3	-44.1	175.7	-70.8	164.6	0	0	0	110.3	L77 K78 E79 L84 A85	L77-I81 VanDerWaalsContact O-CG1 3.26Å; L77-I81 WeakPolarHBondContact O-CG1 3.28Å; L77-I81 PolarHBondContact O-N 3.38Å; K78-I81 PolarHBondContact O-N 3.48Å; E79-I81 PolarHBondContact O-N 3.18Å; I81-L84 PolarHBondContact O-N 3.11Å; I81-A85 VanDerWaalsContact O-CB 3.31Å; I81-A85 WeakPolarHBondContact O-CB 3.44Å; I81-A85 PolarHBondContact O-N 3.16Å
82	K	97.6	Very high	95.9	Very high	119 Å²	119	99.4 Å²	99.4	52%	0.517	49%	0.491	S	S	.	.	H	α-helix	trans	-63.9	-46.2	179.4	176.4	168.1	151.1	-108.4	0	112.1	K78 E79 Q80 A85 E86	K78-K82 WeakPolarHBondContact O-CB 3.36Å; K78-K82 PolarHBondContact O-N 3.26Å; E79-K82 WeakPolarHBondContact O-CB 3.5Å; E79-K82 PolarHBondContact O-N 2.93Å; E79-K82 IonicContact OE1-NZ 2.78Å; E79-K82 PolarHBondContact OE1-NZ 2.85Å; E79-K82 IonicContact OE2-NZ 3.3Å; E79-K82 PolarHBondContact OE2-NZ 3.47Å; Q80-K82 VanDerWaalsContact C-N 3.31Å; Q80-K82 PolarHBondContact O-N 3.43Å; K82-A85 PolarHBondContact O-N 2.87Å; K82-E86 PolarHBondContact O-N 2.99Å
83	E	97.2	Very high	95.9	Very high	102 Å²	102	100.2 Å²	100.2	48%	0.477	49%	0.489	S	S	.	.	H	α-helix	trans	-62.9	-42.5	177.3	-171.1	-174	168.2	0	0	111.8	E79 Q80 E86 K87	E79-E83 PolarHBondContact O-N 3.39Å; Q80-E83 PolarHBondContact O-N 2.77Å; E83-E86 PolarHBondContact O-N 3.31Å; E83-K87 PolarHBondContact O-N 2.9Å; E83-K87 IonicContact OE1-NZ 2.62Å; E83-K87 PolarHBondContact OE1-NZ 3.23Å
84	L	97.5	Very high	95.8	Very high	120 Å²	120	98.9 Å²	98.9	63%	0.628	48%	0.483	S	S	*	.	H	α-helix	trans	-64.1	-41.9	175.8	-77.4	169.4	0	0	0	111.9	Q80 I81 K87 N88	Q80-L84 WeakPolarHBondContact O-CB 3.4Å; Q80-L84 WeakPolarHBondContact O-CG 2.98Å; Q80-L84 PolarHBondContact O-N 2.91Å; I81-L84 PolarHBondContact O-N 3.11Å; L84-K87 PolarHBondContact O-N 3.25Å; L84-N88 VanDerWaalsContact O-CB 3.32Å; L84-N88 WeakPolarHBondContact O-CB 3.31Å; L84-N88 PolarHBondContact O-N 2.87Å
85	A	95.6	Very high	95.5	Very high	59 Å²	59	99.5 Å²	99.5	49%	0.488	48%	0.484	S	S	.	.	H	α-helix	trans	-64.2	-41.2	177.5	0	0	0	0	0	112.1	I81 K82 N88 N89	I81-A85 VanDerWaalsContact O-CB 3.31Å; I81-A85 WeakPolarHBondContact O-CB 3.44Å; I81-A85 PolarHBondContact O-N 3.16Å; K82-A85 PolarHBondContact O-N 2.87Å; A85-N88 PolarHBondContact O-N 3.44Å; A85-N89 PolarHBondContact O-N 3.3Å
86	E	96.4	Very high	95.1	Very high	141 Å²	141	103 Å²	103	66%	0.659	50%	0.495	S	S	*	.	H	α-helix	trans	-64.8	-46.3	175.7	-175.5	172.4	-166.2	0	0	111.6	K82 E83 N88 N89 Q90	K82-E86 PolarHBondContact O-N 2.99Å; E83-E86 PolarHBondContact O-N 3.31Å; E86-N88 VanDerWaalsContact C-N 3.31Å; E86-N88 PolarHBondContact O-N 3.34Å; E86-N89 PolarHBondContact O-N 3.45Å; E86-Q90 PolarHBondContact O-N 3.39Å
87	K	96.8	Very high	94.9	Very high	112 Å²	112	104.2 Å²	104.2	49%	0.487	50%	0.502	S	S	.	.	H	α-helix	trans	-59.4	-42.1	173.8	-80.6	-163.3	178.6	73.5	0	111.9	E83 L84 Q90 L91	E83-K87 PolarHBondContact O-N 2.9Å; E83-K87 IonicContact OE1-NZ 2.62Å; E83-K87 PolarHBondContact OE1-NZ 3.23Å; L84-K87 PolarHBondContact O-N 3.25Å; K87-Q90 PolarHBondContact O-N 3.05Å; K87-L91 WeakPolarHBondContact O-CB 3.4Å; K87-L91 VanDerWaalsContact O-CG 3.31Å; K87-L91 WeakPolarHBondContact O-CG 3.14Å; K87-L91 PolarHBondContact O-N 2.88Å
88	N	95.6	Very high	94.4	Very high	87 Å²	87	105.5 Å²	105.5	47%	0.465	51%	0.508	S	S	.	.	H	α-helix	trans	-62.9	-46.6	178.3	-165.3	-1.2	0	0	0	110.9	L84 A85 E86 Q90 L91 E92	L84-N88 VanDerWaalsContact O-CB 3.32Å; L84-N88 WeakPolarHBondContact O-CB 3.31Å; L84-N88 PolarHBondContact O-N 2.87Å; A85-N88 PolarHBondContact O-N 3.44Å; E86-N88 VanDerWaalsContact C-N 3.31Å; E86-N88 PolarHBondContact O-N 3.34Å; N88-Q90 VanDerWaalsContact C-N 3.29Å; N88-Q90 PolarHBondContact O-N 3.15Å; N88-L91 CarbonylContact O-C 3.59Å; N88-L91 PolarHBondContact O-N 2.86Å; N88-L91 VanDerWaalsContact O-N 3.1Å; N88-E92 WeakPolarHBondContact O-CG 3.38Å; N88-E92 PolarHBondContact O-N 3.24Å
89	N	95	Very high	93.8	Very high	81 Å²	81	105 Å²	105	43%	0.433	51%	0.506	S	S	.	.	H	α-helix	trans	-60.6	-38.6	177.4	-168.7	-101.5	0	0	0	112.9	A85 E86 R93	A85-N89 PolarHBondContact O-N 3.3Å; E86-N89 PolarHBondContact O-N 3.45Å; N89-R93 WeakPolarHBondContact O-CB 3.47Å; N89-R93 PolarHBondContact O-N 3.41Å; N89-R93 VanDerWaalsContact O-N 3.09Å; N89-R93 PolarHBondContact OD1-NH2 3.4Å
90	Q	95.6	Very high	93.2	Very high	80 Å²	80	104.7 Å²	104.7	37%	0.374	51%	0.508	S	S	.	.	H	α-helix	trans	-63.5	-46.7	174.5	-178	60.9	31.1	0	0	111.1	E86 K87 N88 R93 E94	E86-Q90 PolarHBondContact O-N 3.39Å; K87-Q90 PolarHBondContact O-N 3.05Å; N88-Q90 VanDerWaalsContact C-N 3.29Å; N88-Q90 PolarHBondContact O-N 3.15Å; Q90-R93 PolarHBondContact O-N 3.34Å; Q90-E94 PolarHBondContact NE2-OE1 3.5Å; Q90-E94 WeakPolarHBondContact O-CG 3.37Å; Q90-E94 PolarHBondContact O-N 3.49Å
91	L	94.4	Very high	92.5	Very high	104 Å²	104	106.2 Å²	106.2	55%	0.545	52%	0.518	S	S	.	.	H	α-helix	trans	-64	-39.7	177.8	-72.7	171.7	0	0	0	112.4	K87 N88 R93 E94 N95	K87-L91 WeakPolarHBondContact O-CB 3.4Å; K87-L91 VanDerWaalsContact O-CG 3.31Å; K87-L91 WeakPolarHBondContact O-CG 3.14Å; K87-L91 PolarHBondContact O-N 2.88Å; N88-L91 CarbonylContact O-C 3.59Å; N88-L91 PolarHBondContact O-N 2.86Å; N88-L91 VanDerWaalsContact O-N 3.1Å; L91-R93 VanDerWaalsContact C-N 3.35Å; L91-R93 PolarHBondContact O-N 3.37Å; L91-E94 PolarHBondContact O-N 2.87Å; L91-N95 WeakPolarHBondContact O-CB 3.29Å; L91-N95 PolarHBondContact O-N 2.73Å
92	E	92.6	Very high	91.8	Very high	98 Å²	98	102.3 Å²	102.3	46%	0.458	50%	0.503	S	S	.	.	H	α-helix	trans	-60.6	-44.3	174.9	-76.3	175.1	171	0	0	111.4	N88 N95 Y96	N88-E92 WeakPolarHBondContact O-CG 3.38Å; N88-E92 PolarHBondContact O-N 3.24Å; E92-N95 PolarHBondContact O-N 2.87Å; E92-Y96 WeakPolarHBondContact O-CB 3.32Å; E92-Y96 PolarHBondContact O-N 3.37Å
93	R	92.9	Very high	90.6	Very high	142 Å²	142	99.2 Å²	99.2	54%	0.536	50%	0.497	S	S	.	.	H	α-helix	trans	-63.3	-45.6	177	-170.8	-172	-58.2	146	6.9	111.6	N89 Q90 L91 Y96 L97	N89-R93 WeakPolarHBondContact O-CB 3.47Å; N89-R93 PolarHBondContact O-N 3.41Å; N89-R93 VanDerWaalsContact O-N 3.09Å; N89-R93 PolarHBondContact OD1-NH2 3.4Å; Q90-R93 PolarHBondContact O-N 3.34Å; L91-R93 VanDerWaalsContact C-N 3.35Å; L91-R93 PolarHBondContact O-N 3.37Å; R93-Y96 PolarHBondContact O-N 2.87Å; R93-L97 WeakPolarHBondContact O-CB 3.17Å; R93-L97 PolarHBondContact O-N 3.08Å
94	E	91.1	Very high	89.3	Confident	89 Å²	89	99.3 Å²	99.3	42%	0.416	51%	0.506	S	S	.	.	H	α-helix	trans	-63.8	-42.9	176.5	-73.3	176.5	-166.4	0	0	111.6	Q90 L91 Y96 L97 L98	Q90-E94 PolarHBondContact NE2-OE1 3.5Å; Q90-E94 WeakPolarHBondContact O-CG 3.37Å; Q90-E94 PolarHBondContact O-N 3.49Å; L91-E94 PolarHBondContact O-N 2.87Å; E94-Y96 PolarHBondContact O-N 3.45Å; E94-L97 PolarHBondContact O-N 3.37Å; E94-L98 WeakPolarHBondContact O-CB 3.22Å; E94-L98 VanDerWaalsContact O-CG 3.3Å; E94-L98 WeakPolarHBondContact O-CG 3.48Å; E94-L98 PolarHBondContact O-N 2.88Å
95	N	89.3	Confident	88.1	Confident	76 Å²	76	100 Å²	100	41%	0.406	51%	0.506	S	S	.	.	H	α-helix	trans	-63.7	-42.7	178.3	-164.2	-87.5	0	0	0	111.6	L91 E92 L98 K99	L91-N95 WeakPolarHBondContact O-CB 3.29Å; L91-N95 PolarHBondContact O-N 2.73Å; E92-N95 PolarHBondContact O-N 2.87Å; N95-L98 PolarHBondContact O-N 3.24Å; N95-K99 WeakPolarHBondContact O-CB 3.42Å; N95-K99 WeakPolarHBondContact O-CG 3.24Å; N95-K99 PolarHBondContact O-N 3.27Å; N95-K99 WeakPolarHBondContact OD1-CD 3.42Å; N95-K99 WeakPolarHBondContact OD1-CE 3.23Å; N95-K99 PolarHBondContact OD1-NZ 2.87Å
96	Y	89.1	Confident	87	Confident	153 Å²	153	102.6 Å²	102.6	60%	0.6	51%	0.509	S	S	*	.	H	α-helix	trans	-60.2	-46.4	174.4	177.6	-101.2	0	0	0	111.5	E92 R93 E94 K99 N100	E92-Y96 WeakPolarHBondContact O-CB 3.32Å; E92-Y96 PolarHBondContact O-N 3.37Å; R93-Y96 PolarHBondContact O-N 2.87Å; E94-Y96 PolarHBondContact O-N 3.45Å; Y96-K99 PolarHBondContact O-N 2.96Å; Y96-N100 WeakPolarHBondContact CE1-ND2 3.48Å; Y96-N100 PolarHBondContact O-N 3.29Å; Y96-N100 PolarHBondContact OH-ND2 3.24Å
97	L	90.4	Very high	85.8	Confident	99 Å²	99	98.4 Å²	98.4	52%	0.518	49%	0.49	S	S	.	.	H	α-helix	trans	-63.1	-44.2	178.2	-175.5	60.8	0	0	0	111.9	R93 E94 K99 N100 L101	R93-L97 WeakPolarHBondContact O-CB 3.17Å; R93-L97 PolarHBondContact O-N 3.08Å; E94-L97 PolarHBondContact O-N 3.37Å; L97-K99 PolarHBondContact O-N 3.37Å; L97-N100 PolarHBondContact O-N 2.82Å; L97-L101 HydrophobicContact CD1-CD1 3.68Å; L97-L101 HydrophobicContact CD1-CG 4.3Å; L97-L101 HydrophobicContact CD2-CD1 4.42Å; L97-L101 HydrophobicContact CG-CD1 3.65Å; L97-L101 WeakPolarHBondContact O-CB 3.47Å; L97-L101 WeakPolarHBondContact O-CD1 3.32Å; L97-L101 WeakPolarHBondContact O-CG 3.16Å; L97-L101 PolarHBondContact O-N 2.87Å
98	L	87.5	Confident	84.6	Confident	116 Å²	116	99.7 Å²	99.7	61%	0.607	50%	0.498	S	S	*	.	H	α-helix	trans	-60.3	-43.6	175.6	-76.2	166.9	0	0	0	111.9	E94 N95 N100 L101 A102	E94-L98 WeakPolarHBondContact O-CB 3.22Å; E94-L98 VanDerWaalsContact O-CG 3.3Å; E94-L98 WeakPolarHBondContact O-CG 3.48Å; E94-L98 PolarHBondContact O-N 2.88Å; N95-L98 PolarHBondContact O-N 3.24Å; L98-N100 VanDerWaalsContact C-N 3.32Å; L98-N100 PolarHBondContact O-N 2.96Å; L98-L101 PolarHBondContact O-N 3.28Å; L98-A102 WeakPolarHBondContact O-CB 3.43Å; L98-A102 PolarHBondContact O-N 3.37Å
99	K	85.5	Confident	83.6	Confident	107 Å²	107	102.2 Å²	102.2	47%	0.465	51%	0.505	S	S	.	.	H	α-helix	trans	-61.7	-38.4	176.1	-78.6	171.4	171.5	160.5	0	112.5	N95 Y96 L97 L107	N95-K99 WeakPolarHBondContact O-CB 3.42Å; N95-K99 WeakPolarHBondContact O-CG 3.24Å; N95-K99 PolarHBondContact O-N 3.27Å; N95-K99 WeakPolarHBondContact OD1-CD 3.42Å; N95-K99 WeakPolarHBondContact OD1-CE 3.23Å; N95-K99 PolarHBondContact OD1-NZ 2.87Å; Y96-K99 PolarHBondContact O-N 2.96Å; L97-K99 PolarHBondContact O-N 3.37Å; K99-L107 HydrophobicContact CG-CD2 4.34Å
100	N	82.2	Confident	82.3	Confident	98 Å²	98	105.5 Å²	105.5	52%	0.524	52%	0.515	S	S	.	.	H	α-helix	trans	-73.2	-31.1	178.5	-73.9	-10.7	0	0	0	113.5	Y96 L97 L98	Y96-N100 WeakPolarHBondContact CE1-ND2 3.48Å; Y96-N100 PolarHBondContact O-N 3.29Å; Y96-N100 PolarHBondContact OH-ND2 3.24Å; L97-N100 PolarHBondContact O-N 2.82Å; L98-N100 VanDerWaalsContact C-N 3.32Å; L98-N100 PolarHBondContact O-N 2.96Å
101	L	83.4	Confident	81.1	Confident	131 Å²	131	108.2 Å²	108.2	69%	0.686	53%	0.528	S	S	*	.	H	α-helix	trans	-91.3	-19.8	-177.3	-72.2	162.1	0	0	0	113.6	L97 L98	L97-L101 HydrophobicContact CD1-CD1 3.68Å; L97-L101 HydrophobicContact CD1-CG 4.3Å; L97-L101 HydrophobicContact CD2-CD1 4.42Å; L97-L101 HydrophobicContact CG-CD1 3.65Å; L97-L101 WeakPolarHBondContact O-CB 3.47Å; L97-L101 WeakPolarHBondContact O-CD1 3.32Å; L97-L101 WeakPolarHBondContact O-CG 3.16Å; L97-L101 PolarHBondContact O-N 2.87Å; L98-L101 PolarHBondContact O-N 3.28Å
102	A	81.7	Confident	80.1	Confident	34 Å²	34	107.9 Å²	107.9	28%	0.281	54%	0.535	S	S	.	.	S	Bend	trans	-77.2	142.2	-177.5	0	0	0	0	0	112.2	L98 L107	L98-A102 WeakPolarHBondContact O-CB 3.43Å; L98-A102 PolarHBondContact O-N 3.37Å; A102-L107 HydrophobicContact CB-CD1 3.57Å; A102-L107 HydrophobicContact CB-CG 4.31Å
103	S	73.6	Confident	79	Confident	54 Å²	54	113.8 Å²	113.8	38%	0.378	55%	0.553	S	S	.	*			trans	-66.9	143.8	172.3	178	0	0	0	0	110.3	E105 Q106 L107	S103-E105 PolarHBondContact O-N 2.95Å; S103-E105 VanDerWaalsContact O-N 3.1Å; S103-Q106 VanDerWaalsContact N-OE1 3.17Å; S103-Q106 WeakPolarHBondContact O-CA 3.24Å; S103-Q106 WeakPolarHBondContact O-CB 3Å; S103-Q106 PolarHBondContact O-N 3.08Å; S103-L107 PolarHBondContact O-N 2.87Å; S103-L107 VanDerWaalsContact O-N 3.15Å
104	P	69.9	Low	77.8	Confident	105 Å²	105	110.4 Å²	110.4	68%	0.682	55%	0.545	S	S	*	.	H	α-helix	trans	-52.7	-35.1	179.2	16.2	-29.7	0	0	0	113.3	Q106 L107 E108	P104-Q106 VanDerWaalsContact C-N 3.3Å; P104-Q106 PolarHBondContact O-N 3.44Å; P104-L107 PolarHBondContact O-N 3.49Å; P104-E108 PolarHBondContact O-N 3.07Å; P104-E108 VanDerWaalsContact O-N 3.13Å
105	E	72.1	Confident	76.5	Confident	133 Å²	133	110.4 Å²	110.4	62%	0.621	55%	0.552	S	S	*	*	H	α-helix	trans	-68	-27.4	177.9	-142.2	-176.3	179.3	0	0	113.1	S103 K109	S103-E105 PolarHBondContact O-N 2.95Å; S103-E105 VanDerWaalsContact O-N 3.1Å; E105-K109 WeakPolarHBondContact O-CG 3.38Å
106	Q	72.6	Confident	75.1	Confident	115 Å²	115	112.5 Å²	112.5	54%	0.537	57%	0.568	S	S	.	*	H	α-helix	trans	-81.4	-35.7	176	-63.9	174.7	-62	0	0	111.6	S103 P104 F110	S103-Q106 VanDerWaalsContact N-OE1 3.17Å; S103-Q106 WeakPolarHBondContact O-CA 3.24Å; S103-Q106 WeakPolarHBondContact O-CB 3Å; S103-Q106 PolarHBondContact O-N 3.08Å; P104-Q106 VanDerWaalsContact C-N 3.3Å; P104-Q106 PolarHBondContact O-N 3.44Å; Q106-F110 PolarHBondContact O-N 3.02Å
107	L	71.6	Confident	73.5	Confident	53 Å²	53	112.2 Å²	112.2	28%	0.277	58%	0.577	S	S	.	*	H	α-helix	trans	-63.8	-40.2	174	-93.8	116.4	0	0	0	112.3	K99 A102 S103 P104 F110 Q111	K99-L107 HydrophobicContact CG-CD2 4.34Å; A102-L107 HydrophobicContact CB-CD1 3.57Å; A102-L107 HydrophobicContact CB-CG 4.31Å; S103-L107 PolarHBondContact O-N 2.87Å; S103-L107 VanDerWaalsContact O-N 3.15Å; P104-L107 PolarHBondContact O-N 3.49Å; L107-F110 WeakPolarHBondContact O-CB 3.22Å; L107-F110 PolarHBondContact O-N 3.34Å; L107-Q111 PolarHBondContact O-N 2.71Å
108	E	71.3	Confident	72.1	Confident	139 Å²	139	112 Å²	112	65%	0.65	58%	0.58	S	S	*	*	H	α-helix	trans	-67.5	-39.3	-179.1	-161.9	178.1	-169.5	0	0	112.3	P104 F110 Q111 S112	P104-E108 PolarHBondContact O-N 3.07Å; P104-E108 VanDerWaalsContact O-N 3.13Å; E108-F110 VanDerWaalsContact C-N 3.27Å; E108-F110 PolarHBondContact O-N 3.17Å; E108-Q111 PolarHBondContact O-N 2.8Å; E108-S112 PolarHBondContact O-N 2.95Å; E108-S112 VanDerWaalsContact O-N 3.14Å; E108-S112 PolarHBondContact O-OG 3.27Å
109	K	73.3	Confident	70.7	Confident	139 Å²	139	111.2 Å²	111.2	60%	0.604	58%	0.576	S	S	*	*	H	α-helix	trans	-65	-29.8	171.4	-70.1	177.3	-166.8	-74.9	0	112.9	E105 S112	E105-K109 WeakPolarHBondContact O-CG 3.38Å; K109-S112 WeakPolarHBondContact CA-OG 3.05Å; K109-S112 PolarHBondContact O-OG 2.84Å; K109-S112 VanDerWaalsContact O-OG 3.07Å
110	F	69.1	Low	69	Low	150 Å²	150	113 Å²	113	66%	0.658	59%	0.589	S	S	*	*	H	α-helix	trans	-72.6	-49.4	174.2	-106.1	-81.6	0	0	0	111.3	Q106 L107 E108 S112 R113 I114	Q106-F110 PolarHBondContact O-N 3.02Å; L107-F110 WeakPolarHBondContact O-CB 3.22Å; L107-F110 PolarHBondContact O-N 3.34Å; E108-F110 VanDerWaalsContact C-N 3.27Å; E108-F110 PolarHBondContact O-N 3.17Å; F110-S112 VanDerWaalsContact C-N 3.28Å; F110-S112 PolarHBondContact O-N 2.89Å; F110-R113 PolarHBondContact O-N 3.38Å; F110-I114 WeakPolarHBondContact O-CG1 3.48Å; F110-I114 PolarHBondContact O-N 2.82Å
111	Q	70.3	Confident	67.3	Low	137 Å²	137	115.7 Å²	115.7	64%	0.64	60%	0.604	S	S	*	*	H	α-helix	trans	-59.2	-37.3	180	-76	-170	70.3	0	0	112.9	L107 E108 R113 I114	L107-Q111 PolarHBondContact O-N 2.71Å; E108-Q111 PolarHBondContact O-N 2.8Å; Q111-R113 PolarHBondContact O-N 3.05Å; Q111-I114 PolarHBondContact O-N 2.93Å
112	S	71.8	Confident	65.5	Low	98 Å²	98	115.4 Å²	115.4	69%	0.685	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.3	-12.6	176.5	51.4	0	0	0	0	114.6	E108 K109 F110	E108-S112 PolarHBondContact O-N 2.95Å; E108-S112 VanDerWaalsContact O-N 3.14Å; E108-S112 PolarHBondContact O-OG 3.27Å; K109-S112 WeakPolarHBondContact CA-OG 3.05Å; K109-S112 PolarHBondContact O-OG 2.84Å; K109-S112 VanDerWaalsContact O-OG 3.07Å; F110-S112 VanDerWaalsContact C-N 3.28Å; F110-S112 PolarHBondContact O-N 2.89Å
113	R	71.4	Confident	63.7	Low	221 Å²	221	122.2 Å²	122.2	83%	0.834	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.4	-7.9	177.8	-86	-176	173	-172.1	-1.6	114.5	F110 Q111 P115	F110-R113 PolarHBondContact O-N 3.38Å; Q111-R113 PolarHBondContact O-N 3.05Å; R113-P115 WeakPolarHBondContact O-CD 3.4Å
114	I	67.8	Low	62	Low	71 Å²	71	126.9 Å²	126.9	36%	0.364	65%	0.65	S	S	.	*	S	Bend	trans	-80.3	124.4	-179.4	-61.7	172.9	0	0	0	109	F110 Q111 V118 L119	F110-I114 WeakPolarHBondContact O-CG1 3.48Å; F110-I114 PolarHBondContact O-N 2.82Å; Q111-I114 PolarHBondContact O-N 2.93Å; I114-V118 HydrophobicContact CG2-CB 4.08Å; I114-V118 HydrophobicContact CG2-CG2 4.06Å; I114-L119 HydrophobicContact CG2-CD2 4.11Å
115	P	62.4	Low	60.6	Low	89 Å²	89	128.3 Å²	128.3	58%	0.578	66%	0.656	S	S	*	*			trans	-59.8	138.6	172.1	-20.6	32.2	0	0	0	111.1	R113 D117 V118	R113-P115 WeakPolarHBondContact O-CD 3.4Å; P115-D117 PolarHBondContact O-N 2.98Å; P115-V118 WeakPolarHBondContact O-CG2 3.11Å; P115-V118 PolarHBondContact O-N 2.88Å; P115-V118 VanDerWaalsContact O-N 3.14Å
116	T	59.6	Low	59.2	Low	120 Å²	120	131 Å²	131	74%	0.736	67%	0.669	S	S	*	*	G	3₁₀ helix	trans	-57.1	-23.3	-173.3	-41.7	0	0	0	0	114.3	V118 L119	T116-V118 VanDerWaalsContact C-N 3.27Å; T116-V118 PolarHBondContact O-N 2.98Å; T116-L119 PolarHBondContact O-N 3.06Å
117	D	56.9	Low	57.4	Low	148 Å²	148	130 Å²	130	79%	0.791	68%	0.68	S	S	*	*	G	3₁₀ helix	trans	-63.5	-25.2	178.3	-99	-33.6	0	0	0	114.3	P115	P115-D117 PolarHBondContact O-N 2.98Å
118	V	60.1	Low	55.6	Low	95 Å²	95	134.2 Å²	134.2	58%	0.576	71%	0.708	S	S	*	*	G	3₁₀ helix	trans	-88.3	-10.2	-174.4	-143.7	0	0	0	0	113.3	I114 P115 T116	I114-V118 HydrophobicContact CG2-CB 4.08Å; I114-V118 HydrophobicContact CG2-CG2 4.06Å; P115-V118 WeakPolarHBondContact O-CG2 3.11Å; P115-V118 PolarHBondContact O-N 2.88Å; P115-V118 VanDerWaalsContact O-N 3.14Å; T116-V118 VanDerWaalsContact C-N 3.27Å; T116-V118 PolarHBondContact O-N 2.98Å
119	L	57.3	Low	53.9	Low	99 Å²	99	133 Å²	133	52%	0.518	71%	0.712	S	S	.	*	G	3₁₀ helix	trans	-83.7	-11.8	-176.9	-62.9	-168.7	0	0	0	114.2	I114 T116	I114-L119 HydrophobicContact CG2-CD2 4.11Å; T116-L119 PolarHBondContact O-N 3.06Å
120	L	50.6	Low	51.9	Low	144 Å²	144	132.1 Å²	132.1	75%	0.754	72%	0.718	S	S	*	*	S	Bend	trans	-84.9	-15.9	-172.3	-61	177	0	0	0	114.2
121	D	46.2	Very low	50.3	Low	154 Å²	154	131 Å²	131	82%	0.824	73%	0.726	S	S	*	*	S	Bend	trans	-93.8	-14.7	-174.9	-153.6	40	0	0	0	113.5
122	N	46.7	Very low	48.4	Very low	125 Å²	125	132.5 Å²	132.5	67%	0.668	73%	0.733	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.3	10.9	-169.8	-130.5	0.3	0	0	0	114.9
123	Q	42.5	Very low	46.5	Very low	177 Å²	177	137.2 Å²	137.2	83%	0.827	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.2	6.7	-174.4	-78.7	-107.3	82.2	0	0	114.9
124	N	37.7	Very low	44.7	Very low	153 Å²	153	135.1 Å²	135.1	82%	0.818	74%	0.743	S	S	*	*	S	Bend	trans	-112.5	18.5	-176.1	-156.9	23.7	0	0	0	116.6
125	V	40.8	Very low	43.1	Very low	134 Å²	134	139.5 Å²	139.5	81%	0.812	76%	0.762	S	S	*	*	S	Bend	trans	-133.9	59.2	171.8	-159.5	0	0	0	0	111.6
126	Q	42.6	Very low	41.7	Very low	190 Å²	190	143.6 Å²	143.6	89%	0.888	77%	0.774	S	S	*	*			trans	-150.8	75.3	163.5	-160.5	100.1	38.3	0	0	111.6
127	A	34.7	Very low	40.3	Very low	93 Å²	93	143.2 Å²	143.2	77%	0.769	78%	0.776	S	S	*	*			trans	-159	83.3	156.1	0	0	0	0	0	111	P129	A127-P129 VanDerWaalsContact O-CD 3.28Å; A127-P129 WeakPolarHBondContact O-CD 3.37Å
128	T	34.4	Very low	38.9	Very low	143 Å²	143	141.9 Å²	141.9	88%	0.877	78%	0.777	S	S	*	*			trans	-90.1	109.7	150.8	42.1	0	0	0	0	108.6
129	P	35.2	Very low	37.8	Very low	113 Å²	113	142.8 Å²	142.8	73%	0.734	79%	0.788	S	S	*	*			trans	-96.3	123.9	155.4	29.9	-21.1	0	0	0	109.9	A127	A127-P129 VanDerWaalsContact O-CD 3.28Å; A127-P129 WeakPolarHBondContact O-CD 3.37Å
130	V	31.8	Very low	36.9	Very low	120 Å²	120	146.8 Å²	146.8	73%	0.727	80%	0.803	S	S	*	*			trans	-49.1	134.2	166.6	-179.3	0	0	0	0	110.9	Q132	V130-Q132 HydrophobicContact CG1-CG 4.46Å; V130-Q132 PolarHBondContact O-N 3.32Å
131	P	35.4	Very low	36.3	Very low	126 Å²	126	144.1 Å²	144.1	82%	0.818	80%	0.797	S	S	*	*			trans	-82.5	99.5	166.8	7.3	9.2	0	0	0	109.6
132	Q	30.7	Very low	36.1	Very low	170 Å²	170	143.2 Å²	143.2	79%	0.794	80%	0.797	S	S	*	*			trans	-83.3	110.1	157.3	-75	-165.8	-38	0	0	108.5	V130 Q134	V130-Q132 HydrophobicContact CG1-CG 4.46Å; V130-Q132 PolarHBondContact O-N 3.32Å; Q132-Q134 PolarHBondContact O-N 3.23Å
133	H	31.8	Very low	35.8	Very low	197 Å²	197	141.1 Å²	141.1	91%	0.912	81%	0.805	S	S	*	*			trans	-84.2	95	169.7	-137.3	82.2	0	0	0	108.2
134	Q	34.2	Very low	36.1	Very low	176 Å²	176	138.6 Å²	138.6	82%	0.822	81%	0.807	S	S	*	*			trans	-102.1	101.5	174.1	-159.3	161.7	37.1	0	0	110.4	Q132	Q132-Q134 PolarHBondContact O-N 3.23Å
135	Q	34.7	Very low	36.2	Very low	164 Å²	164	135.5 Å²	135.5	77%	0.766	80%	0.802	S	S	*	*			trans	-7.3	120.7	140.7	-155.2	170.2	34	0	0	116.3
136	Q	31.7	Very low	36.4	Very low	175 Å²	175	139.5 Å²	139.5	82%	0.818	83%	0.826	S	S	*	*				158.1	124.9	123.5	-89.2	174.7	2.5	0	0	112.5
137	S	31	Very low	36.1	Very low	111 Å²	111	137 Å²	137	78%	0.776	82%	0.823	S	S	*	*				-175.6	115.8	118	34.7	0	0	0	0	113.4
138	C	28	Very low	36.2	Very low	120 Å²	120	139.3 Å²	139.3	81%	0.811	83%	0.826	S	S	*	*			trans	69.6	91.7	136.5	-51.8	0	0	0	0	119.8
139	S	36	Very low	36.3	Very low	115 Å²	115	139.1 Å²	139.1	80%	0.804	82%	0.823	S	S	*	*			trans	-77.7	113.3	154.9	50.7	0	0	0	0	111.8
140	H	38	Very low	36.4	Very low	182 Å²	182	140.6 Å²	140.6	84%	0.843	83%	0.829	S	S	*	*			trans	-148	142.6	155.9	-74.5	-120.2	0	0	0	105.5
141	S	38.7	Very low	36.7	Very low	89 Å²	89	141.9 Å²	141.9	62%	0.622	84%	0.835	S	S	*	*			cis	179.7	139.2	-16.2	168.8	0	0	0	0	103.2
142	T	41.9	Very low	36.7	Very low	135 Å²	135	142.9 Å²	142.9	83%	0.828	84%	0.836	S	S	*	*			trans	63.9	126.8	151.2	51.1	0	0	0	0	119.6
143	G	39.6	Very low	37.2	Very low	81 Å²	81	141 Å²	141	84%	0.835	84%	0.839	S	S	*	*			trans	-87.4	-168.4	-174.4	0	0	0	0	0	115.7
144	S	48.5	Very low	37.6	Very low	124 Å²	124	136.7 Å²	136.7	87%	0.867	83%	0.833	S	S	*	*			trans	-175	140.4	146.7	-171.4	0	0	0	0	109.1
145	A	41	Very low	37.9	Very low	87 Å²	87	133.4 Å²	133.4	72%	0.719	83%	0.834	S	S	*	*			trans	-61.5	148.1	173.2	0	0	0	0	0	112.8
146	V	45.4	Very low	38.2	Very low	218 Å²	218	130.6 Å²	130.6	100%	1.321	84%	0.84	S	S	*	*				-151.1	0	115.2	-166.8	0	0	0	0	107.9

Retrieved 146 of 146 residues in 48.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).