A0A087Y0Y2_POEFO Loading...

Triple QxxK/R motif-containing protein

AlphaFold DB , UniProt , Accession A0A087Y0Y2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 84 aa.

						>A0A087Y0Y2_POEFO|A0A087Y0Y2
MGKKDAGATKLPVDQYRKQIGKQDYKKTKSVLKATRLKAEAKKNSSGFRDAFLVVAAILFFVFCVYAFFYLNLSTEINLDLDMD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.7	Very low	54.4	Low	255 Å²	255	138.5 Å²	138.5	100%	1.256	80%	0.802	S	S	*	*				0	95.6	0	-91.9	160	70.2	0	0	108.5
2	G	59.9	Low	55.2	Low	70 Å²	70	136.2 Å²	136.2	72%	0.722	80%	0.795	S	S	*	*			trans	-117.9	127.9	-172.9	0	0	0	0	0	111.7
3	K	60.1	Low	56.3	Low	204 Å²	204	133.5 Å²	133.5	89%	0.887	78%	0.781	S	S	*	*			trans	74.6	110.3	161	-49.5	-179.8	-178	-175.7	0	115.6
4	K	55.2	Low	57.1	Low	197 Å²	197	129.4 Å²	129.4	86%	0.857	75%	0.754	S	S	*	*			trans	160.2	85.9	131.9	-88.1	160.6	-179.7	177.7	0	109.4
5	D	52.5	Low	58	Low	159 Å²	159	127.7 Å²	127.7	85%	0.85	74%	0.737	S	S	*	*			trans	-155.7	17.5	156.9	-80.7	-44.2	0	0	0	112.9	G7	D5-G7 VanDerWaalsContact C-N 3.31Å; D5-G7 PolarHBondContact O-N 2.88Å
6	A	49.8	Very low	58.9	Low	115 Å²	115	129.4 Å²	129.4	95%	0.95	73%	0.728	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.1	19.7	-176.6	0	0	0	0	0	114.7
7	G	52	Low	59.8	Low	59 Å²	59	132.4 Å²	132.4	61%	0.608	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-143.5	17	-173.8	0	0	0	0	0	115.7	D5	D5-G7 VanDerWaalsContact C-N 3.31Å; D5-G7 PolarHBondContact O-N 2.88Å
8	A	53.6	Low	60.5	Low	85 Å²	85	132.8 Å²	132.8	70%	0.702	72%	0.719	S	S	*	*			trans	-84.7	-1.5	-174.6	0	0	0	0	0	114.6	K10	A8-K10 PolarHBondContact O-N 3.33Å
9	T	54.4	Low	61.2	Low	131 Å²	131	132.2 Å²	132.2	80%	0.804	71%	0.711	S	S	*	*			trans	-81.5	66.1	163.1	33.5	0	0	0	0	109.3	L11	T9-L11 PolarHBondContact O-N 3.47Å
10	K	58	Low	61.9	Low	130 Å²	130	129 Å²	129	57%	0.565	69%	0.693	S	S	*	*			trans	-60.8	111.5	166.3	-71.3	-179	-175.3	167.1	0	106.6	A8	A8-K10 PolarHBondContact O-N 3.33Å
11	L	59.6	Low	62.4	Low	118 Å²	118	125 Å²	125	62%	0.618	68%	0.682	S	S	*	*			trans	-51.8	134.7	174.1	-79.6	98.5	0	0	0	108	T9 V13 D14 Q15	T9-L11 PolarHBondContact O-N 3.47Å; L11-V13 PolarHBondContact O-N 3.41Å; L11-D14 PolarHBondContact O-N 3.39Å; L11-Q15 PolarHBondContact O-N 2.9Å
12	P	63.8	Low	64	Low	111 Å²	111	120.1 Å²	120.1	72%	0.721	65%	0.654	S	S	*	*	H	α-helix	trans	-52.6	-28.3	-175.1	14.3	-27.1	0	0	0	112.6	Q15 Y16	P12-Q15 PolarHBondContact O-N 2.93Å; P12-Y16 WeakPolarHBondContact O-CB 3.45Å; P12-Y16 PolarHBondContact O-N 3.29Å
13	V	68.9	Low	64.4	Low	102 Å²	102	122 Å²	122	62%	0.618	64%	0.644	S	S	*	*	H	α-helix	trans	-63.5	-43.6	174.9	-177.2	0	0	0	0	113.3	L11 Q15 Y16 R17	L11-V13 PolarHBondContact O-N 3.41Å; V13-Q15 VanDerWaalsContact C-N 3.32Å; V13-Q15 PolarHBondContact O-N 3.01Å; V13-Y16 WeakPolarHBondContact O-CB 3.44Å; V13-Y16 PolarHBondContact O-N 3.03Å; V13-R17 WeakPolarHBondContact O-CB 3.39Å; V13-R17 PolarHBondContact O-N 3.3Å
14	D	68.1	Low	64.6	Low	75 Å²	75	116.4 Å²	116.4	40%	0.401	62%	0.624	S	S	.	*	H	α-helix	trans	-72.3	-29.4	-179.7	-88.4	-25	0	0	0	112.4	L11 R17 K18	L11-D14 PolarHBondContact O-N 3.39Å; D14-R17 IonicContact OD1-NH1 3.63Å; D14-K18 PolarHBondContact O-N 3.05Å
15	Q	70.2	Confident	65.2	Low	105 Å²	105	113.9 Å²	113.9	49%	0.491	61%	0.61	S	S	.	*	H	α-helix	trans	-70.7	-41.5	173.1	-166.4	153.5	-49.8	0	0	111.1	L11 P12 V13 K18 Q19	L11-Q15 PolarHBondContact O-N 2.9Å; P12-Q15 PolarHBondContact O-N 2.93Å; V13-Q15 VanDerWaalsContact C-N 3.32Å; V13-Q15 PolarHBondContact O-N 3.01Å; Q15-K18 PolarHBondContact O-N 3.1Å; Q15-Q19 PolarHBondContact O-N 3.5Å
16	Y	72.8	Confident	65.7	Low	154 Å²	154	114.3 Å²	114.3	60%	0.604	60%	0.604	S	S	*	*	H	α-helix	trans	-60.4	-47.9	173	-174.2	-106.9	0	0	0	111.7	P12 V13 K18 Q19 I20	P12-Y16 WeakPolarHBondContact O-CB 3.45Å; P12-Y16 PolarHBondContact O-N 3.29Å; V13-Y16 WeakPolarHBondContact O-CB 3.44Å; V13-Y16 PolarHBondContact O-N 3.03Å; Y16-K18 VanDerWaalsContact C-N 3.3Å; Y16-K18 PolarHBondContact O-N 3.04Å; Y16-Q19 PolarHBondContact O-N 3.39Å; Y16-I20 HydrophobicContact CD1-CD1 3.9Å; Y16-I20 HydrophobicContact CE1-CD1 3.45Å; Y16-I20 VanDerWaalsContact CE1-CD1 3.45Å; Y16-I20 HydrophobicContact CE1-CG1 4.38Å; Y16-I20 PolarHBondContact O-N 3.17Å; Y16-I20 VanDerWaalsContact O-N 3.1Å
17	R	73.4	Confident	66.2	Low	181 Å²	181	114.7 Å²	114.7	68%	0.683	58%	0.584	S	S	*	*	H	α-helix	trans	-58.8	-39.2	178.2	-153.7	176.8	116.5	-157.6	9	112.7	V13 D14 G21	V13-R17 WeakPolarHBondContact O-CB 3.39Å; V13-R17 PolarHBondContact O-N 3.3Å; D14-R17 IonicContact OD1-NH1 3.63Å; R17-G21 PolarHBondContact O-N 2.96Å
18	K	73.3	Confident	66.7	Low	139 Å²	139	116 Å²	116	60%	0.604	58%	0.58	S	S	*	*	H	α-helix	trans	-73.7	-28.3	176	-82.3	175.6	177.7	168.7	0	113.5	D14 Q15 Y16 K22	D14-K18 PolarHBondContact O-N 3.05Å; Q15-K18 PolarHBondContact O-N 3.1Å; Y16-K18 VanDerWaalsContact C-N 3.3Å; Y16-K18 PolarHBondContact O-N 3.04Å; K18-K22 VanDerWaalsContact O-CG 3.3Å; K18-K22 WeakPolarHBondContact O-CG 3.3Å; K18-K22 PolarHBondContact O-N 3Å
19	Q	74.6	Confident	67.1	Low	121 Å²	121	117 Å²	117	57%	0.565	57%	0.569	S	S	*	*	H	α-helix	trans	-70.7	-41.5	174.7	-86.2	-175.5	-13.8	0	0	111.8	Q15 Y16 G21 K22 Q23	Q15-Q19 PolarHBondContact O-N 3.5Å; Y16-Q19 PolarHBondContact O-N 3.39Å; Q19-G21 PolarHBondContact O-N 3.04Å; Q19-K22 PolarHBondContact O-N 3.47Å; Q19-Q23 WeakPolarHBondContact O-CB 3.48Å; Q19-Q23 PolarHBondContact O-N 3.14Å
20	I	73.4	Confident	67.4	Low	68 Å²	68	114 Å²	114	35%	0.349	55%	0.554	S	S	.	*	H	α-helix	trans	-57.9	-51.5	175.9	-65.7	176.6	0	0	0	110.4	Y16 K22 Q23 D24	Y16-I20 HydrophobicContact CD1-CD1 3.9Å; Y16-I20 HydrophobicContact CE1-CD1 3.45Å; Y16-I20 VanDerWaalsContact CE1-CD1 3.45Å; Y16-I20 HydrophobicContact CE1-CG1 4.38Å; Y16-I20 PolarHBondContact O-N 3.17Å; Y16-I20 VanDerWaalsContact O-N 3.1Å; I20-K22 VanDerWaalsContact C-N 3.29Å; I20-K22 PolarHBondContact O-N 3.29Å; I20-Q23 PolarHBondContact O-N 3.29Å; I20-Q23 VanDerWaalsContact O-N 3.11Å; I20-D24 PolarHBondContact O-N 2.83Å
21	G	74.1	Confident	67.6	Low	45 Å²	45	112.1 Å²	112.1	46%	0.464	55%	0.553	S	S	.	*	H	α-helix	trans	-61.1	-34.2	179.7	0	0	0	0	0	114	R17 Q19 Y25	R17-G21 PolarHBondContact O-N 2.96Å; Q19-G21 PolarHBondContact O-N 3.04Å; G21-Y25 VanDerWaalsContact O-CB 3.31Å; G21-Y25 WeakPolarHBondContact O-CB 3.31Å; G21-Y25 PolarHBondContact O-N 3.25Å
22	K	76.1	Confident	67.6	Low	153 Å²	153	110.7 Å²	110.7	67%	0.665	55%	0.545	S	S	*	.	H	α-helix	trans	-71.5	-37.1	175.7	-75	178	-179.6	-172.7	0	112.5	K18 Q19 I20 K26	K18-K22 VanDerWaalsContact O-CG 3.3Å; K18-K22 WeakPolarHBondContact O-CG 3.3Å; K18-K22 PolarHBondContact O-N 3Å; Q19-K22 PolarHBondContact O-N 3.47Å; I20-K22 VanDerWaalsContact C-N 3.29Å; I20-K22 PolarHBondContact O-N 3.29Å; K22-K26 PolarHBondContact O-N 3.04Å
23	Q	69.8	Low	67.5	Low	110 Å²	110	112.7 Å²	112.7	51%	0.514	54%	0.543	S	S	.	.	H	α-helix	trans	-69.1	-45.2	178	-170.9	178	8.2	0	0	110.6	Q19 I20 K26 K27	Q19-Q23 WeakPolarHBondContact O-CB 3.48Å; Q19-Q23 PolarHBondContact O-N 3.14Å; I20-Q23 PolarHBondContact O-N 3.29Å; I20-Q23 VanDerWaalsContact O-N 3.11Å; Q23-K26 PolarHBondContact O-N 2.77Å; Q23-K27 PolarHBondContact O-N 3.5Å
24	D	63.4	Low	67.1	Low	86 Å²	86	110.3 Å²	110.3	46%	0.46	53%	0.533	S	S	.	.	H	α-helix	trans	-64.2	-42.1	177.2	-75.8	-18.6	0	0	0	111.4	I20 K26 K27 T28	I20-D24 PolarHBondContact O-N 2.83Å; D24-K26 VanDerWaalsContact C-N 3.29Å; D24-K26 PolarHBondContact O-N 2.91Å; D24-K27 PolarHBondContact O-N 3.11Å; D24-K27 VanDerWaalsContact O-N 3.14Å; D24-T28 PolarHBondContact O-N 2.97Å; D24-T28 PolarHBondContact O-OG1 3.13Å
25	Y	67.1	Low	66.7	Low	145 Å²	145	110.7 Å²	110.7	57%	0.569	54%	0.539	S	S	*	.	H	α-helix	trans	-59.2	-38.7	174.6	-172.9	-99.9	0	0	0	113	G21 K29	G21-Y25 VanDerWaalsContact O-CB 3.31Å; G21-Y25 WeakPolarHBondContact O-CB 3.31Å; G21-Y25 PolarHBondContact O-N 3.25Å; Y25-K29 HydrophobicContact CD1-CD 4.27Å; Y25-K29 HydrophobicContact CE1-CD 3.65Å; Y25-K29 HydrophobicContact CE1-CG 4.33Å; Y25-K29 VanDerWaalsContact CZ-CE 3.4Å; Y25-K29 WeakPolarHBondContact O-CB 3.35Å; Y25-K29 PolarHBondContact O-N 2.98Å; Y25-K29 VanDerWaalsContact O-N 3.12Å; Y25-K29 WeakPolarHBondContact OH-CE 3.45Å; Y25-K29 PolarHBondContact OH-NZ 3.26Å
26	K	62.6	Low	66.2	Low	168 Å²	168	113.7 Å²	113.7	73%	0.73	55%	0.546	S	S	*	.	H	α-helix	trans	-67.7	-41.4	175.1	-87.8	-171	174.1	-169.9	0	112.2	K22 Q23 D24 S30	K22-K26 PolarHBondContact O-N 3.04Å; Q23-K26 PolarHBondContact O-N 2.77Å; D24-K26 VanDerWaalsContact C-N 3.29Å; D24-K26 PolarHBondContact O-N 2.91Å; K26-S30 PolarHBondContact O-N 3Å
27	K	62	Low	65.5	Low	123 Å²	123	112.3 Å²	112.3	54%	0.535	55%	0.548	S	S	.	.	H	α-helix	trans	-68.3	-44.5	178.4	-73.5	-167.6	177.5	-172.3	0	112	Q23 D24 K29 S30 V31	Q23-K27 PolarHBondContact O-N 3.5Å; D24-K27 PolarHBondContact O-N 3.11Å; D24-K27 VanDerWaalsContact O-N 3.14Å; K27-K29 VanDerWaalsContact C-N 3.32Å; K27-K29 PolarHBondContact O-N 3.46Å; K27-S30 PolarHBondContact O-N 3.4Å; K27-S30 PolarHBondContact O-OG 3.29Å; K27-V31 WeakPolarHBondContact O-CG2 3.37Å; K27-V31 PolarHBondContact O-N 2.96Å; K27-V31 VanDerWaalsContact O-N 3.17Å
28	T	61.7	Low	64.8	Low	85 Å²	85	111 Å²	111	52%	0.521	55%	0.547	S	S	.	.	H	α-helix	trans	-68.5	-33.3	180	-46.5	0	0	0	0	111.6	D24 V31 L32	D24-T28 PolarHBondContact O-N 2.97Å; D24-T28 PolarHBondContact O-OG1 3.13Å; T28-V31 PolarHBondContact O-N 3.49Å; T28-L32 HydrophobicContact CG2-CD1 4.44Å; T28-L32 WeakPolarHBondContact O-CB 3.45Å; T28-L32 PolarHBondContact O-N 3.26Å
29	K	61.6	Low	64	Low	106 Å²	106	106.4 Å²	106.4	46%	0.461	54%	0.535	S	S	.	.	H	α-helix	trans	-64.1	-40.4	173	-94.8	-167.1	167.7	-179.5	0	113.6	Y25 K27 K33	Y25-K29 HydrophobicContact CD1-CD 4.27Å; Y25-K29 HydrophobicContact CE1-CD 3.65Å; Y25-K29 HydrophobicContact CE1-CG 4.33Å; Y25-K29 VanDerWaalsContact CZ-CE 3.4Å; Y25-K29 WeakPolarHBondContact O-CB 3.35Å; Y25-K29 PolarHBondContact O-N 2.98Å; Y25-K29 VanDerWaalsContact O-N 3.12Å; Y25-K29 WeakPolarHBondContact OH-CE 3.45Å; Y25-K29 PolarHBondContact OH-NZ 3.26Å; K27-K29 VanDerWaalsContact C-N 3.32Å; K27-K29 PolarHBondContact O-N 3.46Å; K29-K33 WeakPolarHBondContact O-CG 3.33Å; K29-K33 PolarHBondContact O-N 2.87Å; K29-K33 VanDerWaalsContact O-N 3.13Å
30	S	61.2	Low	63	Low	70 Å²	70	107.2 Å²	107.2	49%	0.49	54%	0.539	S	S	.	.	H	α-helix	trans	-69.5	-38.7	179	63.1	0	0	0	0	111.4	K26 K27 K33 A34	K26-S30 PolarHBondContact O-N 3Å; K27-S30 PolarHBondContact O-N 3.4Å; K27-S30 PolarHBondContact O-OG 3.29Å; S30-K33 PolarHBondContact O-N 2.98Å; S30-A34 PolarHBondContact O-N 3.19Å
31	V	61.3	Low	62.1	Low	90 Å²	90	106.7 Å²	106.7	55%	0.545	55%	0.545	S	S	.	.	H	α-helix	trans	-64.9	-40	175.6	177.1	0	0	0	0	111.7	K27 T28 K33 A34 T35	K27-V31 WeakPolarHBondContact O-CG2 3.37Å; K27-V31 PolarHBondContact O-N 2.96Å; K27-V31 VanDerWaalsContact O-N 3.17Å; T28-V31 PolarHBondContact O-N 3.49Å; V31-K33 PolarHBondContact O-N 3.2Å; V31-A34 PolarHBondContact O-N 3.17Å; V31-T35 WeakPolarHBondContact O-CB 3.48Å; V31-T35 PolarHBondContact O-N 3.29Å; V31-T35 PolarHBondContact O-OG1 3.25Å
32	L	61.2	Low	61.2	Low	88 Å²	88	112.8 Å²	112.8	46%	0.461	56%	0.559	S	S	.	*	H	α-helix	trans	-63.6	-39.1	174.3	-91.7	160.6	0	0	0	112.8	T28 T35 R36	T28-L32 HydrophobicContact CG2-CD1 4.44Å; T28-L32 WeakPolarHBondContact O-CB 3.45Å; T28-L32 PolarHBondContact O-N 3.26Å; L32-T35 PolarHBondContact O-N 3.41Å; L32-R36 WeakPolarHBondContact O-CG 3.07Å; L32-R36 PolarHBondContact O-N 3.12Å
33	K	61.4	Low	60.2	Low	153 Å²	153	114.3 Å²	114.3	67%	0.665	57%	0.565	S	S	*	*	H	α-helix	trans	-66.7	-44.2	175.2	-75.2	-173.8	176.8	-168	0	111.9	K29 S30 V31 T35 R36 L37	K29-K33 WeakPolarHBondContact O-CG 3.33Å; K29-K33 PolarHBondContact O-N 2.87Å; K29-K33 VanDerWaalsContact O-N 3.13Å; S30-K33 PolarHBondContact O-N 2.98Å; V31-K33 PolarHBondContact O-N 3.2Å; K33-T35 VanDerWaalsContact C-N 3.27Å; K33-T35 PolarHBondContact O-N 3.46Å; K33-R36 PolarHBondContact O-N 3.05Å; K33-L37 WeakPolarHBondContact O-CB 3.47Å; K33-L37 PolarHBondContact O-N 2.8Å
34	A	60.5	Low	59.4	Low	51 Å²	51	115.2 Å²	115.2	42%	0.421	57%	0.574	S	S	.	*	H	α-helix	trans	-62.7	-35.9	176.8	0	0	0	0	0	112.2	S30 V31 K38	S30-A34 PolarHBondContact O-N 3.19Å; V31-A34 PolarHBondContact O-N 3.17Å; A34-K38 WeakPolarHBondContact O-CB 3.42Å; A34-K38 VanDerWaalsContact O-CG 3.31Å; A34-K38 WeakPolarHBondContact O-CG 3.31Å; A34-K38 PolarHBondContact O-N 3.44Å; A34-K38 VanDerWaalsContact O-N 3.1Å
35	T	59.8	Low	59.1	Low	84 Å²	84	114.8 Å²	114.8	52%	0.515	58%	0.578	S	S	.	*	H	α-helix	trans	-70.9	-41	176.5	-52.6	0	0	0	0	111.6	V31 L32 K33 K38 A39	V31-T35 WeakPolarHBondContact O-CB 3.48Å; V31-T35 PolarHBondContact O-N 3.29Å; V31-T35 PolarHBondContact O-OG1 3.25Å; L32-T35 PolarHBondContact O-N 3.41Å; K33-T35 VanDerWaalsContact C-N 3.27Å; K33-T35 PolarHBondContact O-N 3.46Å; T35-K38 PolarHBondContact O-N 3.11Å; T35-A39 WeakPolarHBondContact O-CB 3.48Å; T35-A39 PolarHBondContact O-N 3.46Å
36	R	59.2	Low	58.6	Low	168 Å²	168	111.8 Å²	111.8	63%	0.634	58%	0.578	S	S	*	*	H	α-helix	trans	-64.5	-42	175	-76.1	-179.5	-179.9	164.6	0.3	112.4	L32 K33 K38 A39 E40	L32-R36 WeakPolarHBondContact O-CG 3.07Å; L32-R36 PolarHBondContact O-N 3.12Å; K33-R36 PolarHBondContact O-N 3.05Å; R36-K38 VanDerWaalsContact C-N 3.34Å; R36-K38 PolarHBondContact O-N 2.93Å; R36-A39 CarbonylContact O-C 3.57Å; R36-A39 PolarHBondContact O-N 3.43Å; R36-A39 VanDerWaalsContact O-N 3.11Å; R36-E40 PolarHBondContact O-N 2.92Å
37	L	58.1	Low	58.7	Low	125 Å²	125	106.4 Å²	106.4	65%	0.654	57%	0.57	S	S	*	*	H	α-helix	trans	-67.3	-35.7	179.3	-156.2	144.9	0	0	0	111.6	K33 A41	K33-L37 WeakPolarHBondContact O-CB 3.47Å; K33-L37 PolarHBondContact O-N 2.8Å; L37-A41 VanDerWaalsContact O-CB 3.25Å; L37-A41 WeakPolarHBondContact O-CB 3.24Å; L37-A41 PolarHBondContact O-N 3.29Å
38	K	58.3	Low	59.2	Low	152 Å²	152	108.3 Å²	108.3	66%	0.661	58%	0.579	S	S	*	*	H	α-helix	trans	-68.5	-33.9	170.3	-73.8	179.7	178.3	-175.1	0	112.9	A34 T35 R36 K42	A34-K38 WeakPolarHBondContact O-CB 3.42Å; A34-K38 VanDerWaalsContact O-CG 3.31Å; A34-K38 WeakPolarHBondContact O-CG 3.31Å; A34-K38 PolarHBondContact O-N 3.44Å; A34-K38 VanDerWaalsContact O-N 3.1Å; T35-K38 PolarHBondContact O-N 3.11Å; R36-K38 VanDerWaalsContact C-N 3.34Å; R36-K38 PolarHBondContact O-N 2.93Å; K38-K42 WeakPolarHBondContact O-CB 3.37Å; K38-K42 WeakPolarHBondContact O-CG 3.41Å; K38-K42 PolarHBondContact O-N 3.08Å; K38-K42 VanDerWaalsContact O-N 3.08Å
39	A	56.8	Low	60	Low	43 Å²	43	113 Å²	113	36%	0.355	59%	0.587	S	S	.	*	H	α-helix	trans	-74.6	-38.9	177	0	0	0	0	0	112.4	T35 R36 K42 K43	T35-A39 WeakPolarHBondContact O-CB 3.48Å; T35-A39 PolarHBondContact O-N 3.46Å; R36-A39 CarbonylContact O-C 3.57Å; R36-A39 PolarHBondContact O-N 3.43Å; R36-A39 VanDerWaalsContact O-N 3.11Å; A39-K42 PolarHBondContact O-N 3.1Å; A39-K43 VanDerWaalsContact O-CG 3.24Å; A39-K43 WeakPolarHBondContact O-CG 3.32Å; A39-K43 PolarHBondContact O-N 2.99Å
40	E	54.1	Low	60.9	Low	138 Å²	138	112.9 Å²	112.9	65%	0.645	59%	0.591	S	S	*	*	H	α-helix	trans	-67.5	-40.5	172.9	-81	-178.5	142.1	0	0	111.7	R36 K42 K43 N44	R36-E40 PolarHBondContact O-N 2.92Å; E40-K42 PolarHBondContact O-N 3.39Å; E40-K43 PolarHBondContact O-N 3.46Å; E40-N44 PolarHBondContact O-N 3Å
41	A	54.8	Low	62.2	Low	58 Å²	58	112.2 Å²	112.2	48%	0.479	59%	0.59	S	S	.	*	H	α-helix	trans	-60.8	-43.3	173.5	0	0	0	0	0	111.8	L37 K43 N44 S45	L37-A41 VanDerWaalsContact O-CB 3.25Å; L37-A41 WeakPolarHBondContact O-CB 3.24Å; L37-A41 PolarHBondContact O-N 3.29Å; A41-K43 VanDerWaalsContact C-N 3.34Å; A41-K43 PolarHBondContact O-N 3.47Å; A41-N44 PolarHBondContact O-N 3.38Å; A41-S45 VanDerWaalsContact O-CB 3.22Å; A41-S45 WeakPolarHBondContact O-CB 3.22Å; A41-S45 PolarHBondContact O-N 3.44Å; A41-S45 PolarHBondContact O-OG 3.3Å
42	K	54.3	Low	63.5	Low	173 Å²	173	114.3 Å²	114.3	75%	0.752	59%	0.592	S	S	*	*	H	α-helix	trans	-67.3	-30.5	176.7	-81.3	-173	173.2	-164.6	0	113.9	K38 A39 E40 N44 S45	K38-K42 WeakPolarHBondContact O-CB 3.37Å; K38-K42 WeakPolarHBondContact O-CG 3.41Å; K38-K42 PolarHBondContact O-N 3.08Å; K38-K42 VanDerWaalsContact O-N 3.08Å; A39-K42 PolarHBondContact O-N 3.1Å; E40-K42 PolarHBondContact O-N 3.39Å; K42-N44 VanDerWaalsContact C-N 3.3Å; K42-S45 PolarHBondContact O-OG 3.21Å
43	K	55.1	Low	64.9	Low	184 Å²	184	115.5 Å²	115.5	80%	0.8	60%	0.598	S	S	*	*	H	α-helix	trans	-71.8	-26.3	176.5	-74	173.4	-179.4	-167.5	0	112.4	A39 E40 A41	A39-K43 VanDerWaalsContact O-CG 3.24Å; A39-K43 WeakPolarHBondContact O-CG 3.32Å; A39-K43 PolarHBondContact O-N 2.99Å; E40-K43 PolarHBondContact O-N 3.46Å; A41-K43 VanDerWaalsContact C-N 3.34Å; A41-K43 PolarHBondContact O-N 3.47Å
44	N	53.3	Low	66.4	Low	130 Å²	130	111.9 Å²	111.9	70%	0.695	59%	0.589	S	S	*	*	S	Bend	trans	-97.7	-1.7	-174.4	-149.5	14.5	0	0	0	114.2	E40 A41 K42	E40-N44 PolarHBondContact O-N 3Å; A41-N44 PolarHBondContact O-N 3.38Å; K42-N44 VanDerWaalsContact C-N 3.3Å
45	S	55.7	Low	68	Low	77 Å²	77	113.4 Å²	113.4	54%	0.538	59%	0.592	S	S	.	*	S	Bend	trans	-104.6	1.2	-155.6	69.4	0	0	0	0	118.7	A41 K42	A41-S45 VanDerWaalsContact O-CB 3.22Å; A41-S45 WeakPolarHBondContact O-CB 3.22Å; A41-S45 PolarHBondContact O-N 3.44Å; A41-S45 PolarHBondContact O-OG 3.3Å; K42-S45 PolarHBondContact O-OG 3.21Å
46	S	57.4	Low	69.7	Low	82 Å²	82	111.4 Å²	111.4	57%	0.573	58%	0.584	S	S	*	*	S	Bend	trans	-148.5	-62.7	-176.2	-172	0	0	0	0	115.3	F48 R49 D50	S46-F48 PolarHBondContact O-N 2.97Å; S46-R49 PolarHBondContact O-N 3.02Å; S46-D50 WeakPolarHBondContact O-CB 3.35Å; S46-D50 PolarHBondContact O-N 3.38Å; S46-D50 VanDerWaalsContact O-N 3.08Å
47	G	63.9	Low	71.4	Confident	55 Å²	55	106.2 Å²	106.2	57%	0.567	58%	0.577	S	S	*	*	H	α-helix	trans	-63.7	-42.9	-169.2	0	0	0	0	0	114.9	A51	G47-A51 WeakPolarHBondContact O-CB 3.25Å; G47-A51 PolarHBondContact O-N 3.46Å
48	F	72.9	Confident	73.2	Confident	163 Å²	163	105 Å²	105	72%	0.715	57%	0.57	S	S	*	*	H	α-helix	trans	-70.2	-40.1	-178.1	-173.7	-97.6	0	0	0	112.6	S46 F52	S46-F48 PolarHBondContact O-N 2.97Å; F48-F52 WeakPolarHBondContact O-CB 3.35Å; F48-F52 PolarHBondContact O-N 3.08Å
49	R	79.7	Confident	75	Confident	184 Å²	184	103.3 Å²	103.3	69%	0.694	57%	0.568	S	S	*	*	H	α-helix	trans	-65.7	-41.2	177	-84.3	-176.1	71.3	172.5	1.4	111.4	S46 F52 L53	S46-R49 PolarHBondContact O-N 3.02Å; R49-F52 PolarHBondContact O-N 2.88Å; R49-L53 WeakPolarHBondContact O-CB 3.41Å; R49-L53 PolarHBondContact O-N 3.45Å
50	D	80.8	Confident	76.9	Confident	103 Å²	103	108 Å²	108	55%	0.551	58%	0.581	S	S	*	*	H	α-helix	trans	-67.9	-48	-179.4	-161.8	38.5	0	0	0	111.2	S46 F52 L53 V54	S46-D50 WeakPolarHBondContact O-CB 3.35Å; S46-D50 PolarHBondContact O-N 3.38Å; S46-D50 VanDerWaalsContact O-N 3.08Å; D50-F52 VanDerWaalsContact C-N 3.34Å; D50-F52 PolarHBondContact O-N 3.43Å; D50-L53 PolarHBondContact O-N 3.49Å; D50-L53 VanDerWaalsContact O-N 3.16Å; D50-V54 WeakPolarHBondContact O-CG2 3.14Å; D50-V54 PolarHBondContact O-N 2.91Å
51	A	86.7	Confident	78.8	Confident	56 Å²	56	108.2 Å²	108.2	46%	0.463	58%	0.58	S	S	.	*	H	α-helix	trans	-59.4	-42.7	174	0	0	0	0	0	112.4	G47 V54 V55	G47-A51 WeakPolarHBondContact O-CB 3.25Å; G47-A51 PolarHBondContact O-N 3.46Å; A51-V54 PolarHBondContact O-N 3.16Å; A51-V55 VanDerWaalsContact O-CG2 3.29Å; A51-V55 WeakPolarHBondContact O-CG2 3.29Å; A51-V55 PolarHBondContact O-N 2.97Å
52	F	88.9	Confident	80.7	Confident	134 Å²	134	109.7 Å²	109.7	59%	0.588	58%	0.583	S	S	*	*	H	α-helix	trans	-63.6	-41.1	175.8	-178.1	-95.3	0	0	0	112	F48 R49 D50 V55 A56	F48-F52 WeakPolarHBondContact O-CB 3.35Å; F48-F52 PolarHBondContact O-N 3.08Å; R49-F52 PolarHBondContact O-N 2.88Å; D50-F52 VanDerWaalsContact C-N 3.34Å; D50-F52 PolarHBondContact O-N 3.43Å; F52-V55 PolarHBondContact O-N 3.3Å; F52-A56 VanDerWaalsContact O-CB 3.25Å; F52-A56 WeakPolarHBondContact O-CB 3.34Å; F52-A56 PolarHBondContact O-N 2.88Å
53	L	90.4	Very high	82.6	Confident	113 Å²	113	107.9 Å²	107.9	59%	0.592	58%	0.575	S	S	*	*	H	α-helix	trans	-64.4	-42.8	179	-141	104.1	0	0	0	111.4	R49 D50 A56 A57	R49-L53 WeakPolarHBondContact O-CB 3.41Å; R49-L53 PolarHBondContact O-N 3.45Å; D50-L53 PolarHBondContact O-N 3.49Å; D50-L53 VanDerWaalsContact O-N 3.16Å; L53-A56 PolarHBondContact O-N 3.31Å; L53-A57 WeakPolarHBondContact O-CB 3.33Å; L53-A57 PolarHBondContact O-N 3.44Å
54	V	93.1	Very high	84.4	Confident	77 Å²	77	101.6 Å²	101.6	47%	0.467	55%	0.553	S	S	.	*	H	α-helix	trans	-63.2	-47.2	177.3	173.4	0	0	0	0	110.6	D50 A51 A56 A57 I58	D50-V54 WeakPolarHBondContact O-CG2 3.14Å; D50-V54 PolarHBondContact O-N 2.91Å; A51-V54 PolarHBondContact O-N 3.16Å; V54-A56 PolarHBondContact O-N 3.03Å; V54-A57 PolarHBondContact O-N 3.44Å; V54-I58 HydrophobicContact CG1-CD1 4.02Å; V54-I58 WeakPolarHBondContact O-CG1 3.38Å; V54-I58 PolarHBondContact O-N 3.44Å
55	V	94.3	Very high	86.2	Confident	83 Å²	83	98.4 Å²	98.4	50%	0.503	54%	0.539	S	S	.	.	H	α-helix	trans	-62.2	-44.6	177.3	173	0	0	0	0	111	A51 F52 A57 I58 L59	A51-V55 VanDerWaalsContact O-CG2 3.29Å; A51-V55 WeakPolarHBondContact O-CG2 3.29Å; A51-V55 PolarHBondContact O-N 2.97Å; F52-V55 PolarHBondContact O-N 3.3Å; V55-A57 VanDerWaalsContact C-N 3.33Å; V55-A57 PolarHBondContact O-N 3.49Å; V55-I58 PolarHBondContact O-N 2.98Å; V55-L59 HydrophobicContact CG1-CD1 4.09Å; V55-L59 HydrophobicContact CG1-CG 4.44Å; V55-L59 WeakPolarHBondContact O-CG 3.36Å; V55-L59 PolarHBondContact O-N 2.87Å
56	A	95.4	Very high	87.8	Confident	41 Å²	41	102 Å²	102	34%	0.339	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-40.3	177.4	0	0	0	0	0	112.2	F52 L53 V54 L59 F60	F52-A56 VanDerWaalsContact O-CB 3.25Å; F52-A56 WeakPolarHBondContact O-CB 3.34Å; F52-A56 PolarHBondContact O-N 2.88Å; L53-A56 PolarHBondContact O-N 3.31Å; V54-A56 PolarHBondContact O-N 3.03Å; A56-L59 PolarHBondContact O-N 2.9Å; A56-F60 VanDerWaalsContact O-CB 3.31Å; A56-F60 WeakPolarHBondContact O-CB 3.37Å; A56-F60 PolarHBondContact O-N 3.25Å
57	A	95.2	Very high	89.2	Confident	59 Å²	59	99.5 Å²	99.5	49%	0.488	53%	0.526	S	S	.	.	H	α-helix	trans	-64.3	-42.4	176.9	0	0	0	0	0	112.1	L53 V54 V55 F60 F61	L53-A57 WeakPolarHBondContact O-CB 3.33Å; L53-A57 PolarHBondContact O-N 3.44Å; V54-A57 PolarHBondContact O-N 3.44Å; V55-A57 VanDerWaalsContact C-N 3.33Å; V55-A57 PolarHBondContact O-N 3.49Å; A57-F60 PolarHBondContact O-N 3.42Å; A57-F61 WeakPolarHBondContact O-CB 3.32Å; A57-F61 PolarHBondContact O-N 2.9Å
58	I	96	Very high	90.3	Very high	100 Å²	100	103.5 Å²	103.5	51%	0.513	53%	0.528	S	S	.	.	H	α-helix	trans	-63.7	-47.3	176.3	-65.6	165.4	0	0	0	110.5	V54 V55 F60 F61 V62	V54-I58 HydrophobicContact CG1-CD1 4.02Å; V54-I58 WeakPolarHBondContact O-CG1 3.38Å; V54-I58 PolarHBondContact O-N 3.44Å; V55-I58 PolarHBondContact O-N 2.98Å; I58-F60 VanDerWaalsContact C-N 3.33Å; I58-F60 PolarHBondContact O-N 3.44Å; I58-F61 PolarHBondContact O-N 3.26Å; I58-V62 HydrophobicContact CG2-CG2 4.5Å; I58-V62 WeakPolarHBondContact O-CG2 3.38Å; I58-V62 PolarHBondContact O-N 2.9Å
59	L	95.8	Very high	90.9	Very high	116 Å²	116	102.3 Å²	102.3	61%	0.607	52%	0.523	S	S	*	.	H	α-helix	trans	-60.3	-43.6	178.2	-72.5	176	0	0	0	111.8	V55 A56 V62 F63	V55-L59 HydrophobicContact CG1-CD1 4.09Å; V55-L59 HydrophobicContact CG1-CG 4.44Å; V55-L59 WeakPolarHBondContact O-CG 3.36Å; V55-L59 PolarHBondContact O-N 2.87Å; A56-L59 PolarHBondContact O-N 2.9Å; L59-V62 PolarHBondContact O-N 2.93Å; L59-F63 WeakPolarHBondContact O-CB 3.25Å; L59-F63 PolarHBondContact O-N 3.45Å
60	F	96.2	Very high	91.1	Very high	142 Å²	142	100.2 Å²	100.2	62%	0.623	52%	0.516	S	S	*	.	H	α-helix	trans	-64	-42.6	176.9	-175.1	-100.4	0	0	0	111.8	A56 A57 I58 F63 C64	A56-F60 VanDerWaalsContact O-CB 3.31Å; A56-F60 WeakPolarHBondContact O-CB 3.37Å; A56-F60 PolarHBondContact O-N 3.25Å; A57-F60 PolarHBondContact O-N 3.42Å; I58-F60 VanDerWaalsContact C-N 3.33Å; I58-F60 PolarHBondContact O-N 3.44Å; F60-F63 PolarHBondContact O-N 3.4Å; F60-C64 WeakPolarHBondContact CE1-SG 3.2Å; F60-C64 VanDerWaalsContact CZ-SG 3.53Å; F60-C64 WeakPolarHBondContact O-CB 3.47Å; F60-C64 PolarHBondContact O-N 3.46Å; F60-C64 PolarHBondContact O-SG 2.86Å; F60-C64 VanDerWaalsContact O-SG 3.4Å
61	F	95.7	Very high	91.1	Very high	143 Å²	143	100.4 Å²	100.4	63%	0.627	52%	0.516	S	S	*	.	H	α-helix	trans	-62.1	-46.4	177.5	-174.1	-99.1	0	0	0	111.8	A57 I58 F63 C64 V65	A57-F61 WeakPolarHBondContact O-CB 3.32Å; A57-F61 PolarHBondContact O-N 2.9Å; I58-F61 PolarHBondContact O-N 3.26Å; F61-F63 VanDerWaalsContact C-N 3.31Å; F61-F63 PolarHBondContact O-N 3.47Å; F61-C64 PolarHBondContact O-N 2.95Å; F61-V65 HydrophobicContact CD1-CG2 4.23Å; F61-V65 HydrophobicContact CE1-CG2 3.86Å; F61-V65 HydrophobicContact CE2-CG2 4.5Å; F61-V65 HydrophobicContact CZ-CG2 4Å; F61-V65 WeakPolarHBondContact O-CG2 3.19Å; F61-V65 PolarHBondContact O-N 3.44Å
62	V	94.4	Very high	90.5	Very high	89 Å²	89	101.3 Å²	101.3	54%	0.539	51%	0.513	S	S	.	.	H	α-helix	trans	-60.7	-43.2	175.1	173.3	0	0	0	0	110.7	I58 L59 C64 V65 Y66	I58-V62 HydrophobicContact CG2-CG2 4.5Å; I58-V62 WeakPolarHBondContact O-CG2 3.38Å; I58-V62 PolarHBondContact O-N 2.9Å; L59-V62 PolarHBondContact O-N 2.93Å; V62-C64 PolarHBondContact O-N 3.25Å; V62-V65 PolarHBondContact O-N 3.41Å; V62-Y66 VanDerWaalsContact O-CB 3.26Å; V62-Y66 WeakPolarHBondContact O-CB 3.31Å; V62-Y66 PolarHBondContact O-N 3.38Å
63	F	93.7	Very high	89.4	Confident	134 Å²	134	99.3 Å²	99.3	59%	0.588	51%	0.508	S	S	*	.	H	α-helix	trans	-61.6	-43.2	176.6	-175.6	-95.2	0	0	0	112	L59 F60 F61 Y66 A67	L59-F63 WeakPolarHBondContact O-CB 3.25Å; L59-F63 PolarHBondContact O-N 3.45Å; F60-F63 PolarHBondContact O-N 3.4Å; F61-F63 VanDerWaalsContact C-N 3.31Å; F61-F63 PolarHBondContact O-N 3.47Å; F63-Y66 PolarHBondContact O-N 2.82Å; F63-A67 WeakPolarHBondContact O-CB 3.42Å; F63-A67 PolarHBondContact O-N 3.49Å
64	C	92.4	Very high	88.2	Confident	52 Å²	52	95.7 Å²	95.7	35%	0.351	49%	0.492	S	S	.	.	H	α-helix	trans	-64.1	-44.3	176.6	-76.4	0	0	0	0	112.3	F60 F61 V62 A67 F68	F60-C64 WeakPolarHBondContact CE1-SG 3.2Å; F60-C64 VanDerWaalsContact CZ-SG 3.53Å; F60-C64 WeakPolarHBondContact O-CB 3.47Å; F60-C64 PolarHBondContact O-N 3.46Å; F60-C64 PolarHBondContact O-SG 2.86Å; F60-C64 VanDerWaalsContact O-SG 3.4Å; F61-C64 PolarHBondContact O-N 2.95Å; V62-C64 PolarHBondContact O-N 3.25Å; C64-A67 PolarHBondContact O-N 2.82Å; C64-F68 WeakPolarHBondContact O-CB 3.45Å; C64-F68 PolarHBondContact O-N 2.78Å
65	V	91.2	Very high	86.9	Confident	64 Å²	64	96.4 Å²	96.4	39%	0.388	50%	0.497	S	S	.	.	H	α-helix	trans	-64.4	-43.1	176.8	173.9	0	0	0	0	110.5	F61 V62 F68 F69	F61-V65 HydrophobicContact CD1-CG2 4.23Å; F61-V65 HydrophobicContact CE1-CG2 3.86Å; F61-V65 HydrophobicContact CE2-CG2 4.5Å; F61-V65 HydrophobicContact CZ-CG2 4Å; F61-V65 WeakPolarHBondContact O-CG2 3.19Å; F61-V65 PolarHBondContact O-N 3.44Å; V62-V65 PolarHBondContact O-N 3.41Å; V65-F68 PolarHBondContact O-N 3.38Å; V65-F69 HydrophobicContact CG1-CD2 4.2Å; V65-F69 WeakPolarHBondContact O-CB 3.26Å; V65-F69 PolarHBondContact O-N 2.86Å
66	Y	90.1	Very high	85.3	Confident	152 Å²	152	99.2 Å²	99.2	60%	0.596	51%	0.505	S	S	*	.	H	α-helix	trans	-64.2	-45.2	177	-178	-97.1	0	0	0	111.9	V62 F63 F68 F69 Y70	V62-Y66 VanDerWaalsContact O-CB 3.26Å; V62-Y66 WeakPolarHBondContact O-CB 3.31Å; V62-Y66 PolarHBondContact O-N 3.38Å; F63-Y66 PolarHBondContact O-N 2.82Å; Y66-F68 VanDerWaalsContact C-N 3.35Å; Y66-F69 PolarHBondContact O-N 3.48Å; Y66-Y70 WeakPolarHBondContact O-CB 3.04Å; Y66-Y70 PolarHBondContact O-N 3.49Å
67	A	87.3	Confident	83.7	Confident	29 Å²	29	101.7 Å²	101.7	24%	0.24	51%	0.511	C	S	.	.	H	α-helix	trans	-65.1	-39	176.6	0	0	0	0	0	111.5	F63 C64 Y70 L71	F63-A67 WeakPolarHBondContact O-CB 3.42Å; F63-A67 PolarHBondContact O-N 3.49Å; C64-A67 PolarHBondContact O-N 2.82Å; A67-Y70 PolarHBondContact O-N 2.81Å; A67-L71 VanDerWaalsContact O-CB 3.27Å; A67-L71 WeakPolarHBondContact O-CB 3.19Å; A67-L71 WeakPolarHBondContact O-CG 3.13Å; A67-L71 PolarHBondContact O-N 3.45Å
68	F	86.4	Confident	82.1	Confident	139 Å²	139	103.4 Å²	103.4	61%	0.61	51%	0.512	S	S	*	.	H	α-helix	trans	-66	-45.9	176	-172.3	-99.5	0	0	0	111.3	C64 V65 Y66 L71 N72	C64-F68 WeakPolarHBondContact O-CB 3.45Å; C64-F68 PolarHBondContact O-N 2.78Å; V65-F68 PolarHBondContact O-N 3.38Å; Y66-F68 VanDerWaalsContact C-N 3.35Å; F68-L71 PolarHBondContact O-N 2.77Å; F68-N72 WeakPolarHBondContact CD1-ND2 3.42Å; F68-N72 WeakPolarHBondContact CD2-ND2 3.09Å; F68-N72 WeakPolarHBondContact CE1-ND2 3.37Å; F68-N72 VanDerWaalsContact CE2-ND2 3.35Å; F68-N72 WeakPolarHBondContact CE2-ND2 3.21Å; F68-N72 WeakPolarHBondContact CG-ND2 3.49Å; F68-N72 WeakPolarHBondContact CZ-ND2 3.27Å; F68-N72 WeakPolarHBondContact O-CB 3.35Å; F68-N72 PolarHBondContact O-N 2.82Å; F68-N72 PolarHBondContact O-ND2 3.44Å
69	F	85.1	Confident	80.4	Confident	139 Å²	139	104 Å²	104	61%	0.61	52%	0.516	S	S	*	.	H	α-helix	trans	-62.7	-44.9	173.5	-105.1	-87.5	0	0	0	111.6	V65 Y66 L71 N72 L73	V65-F69 HydrophobicContact CG1-CD2 4.2Å; V65-F69 WeakPolarHBondContact O-CB 3.26Å; V65-F69 PolarHBondContact O-N 2.86Å; Y66-F69 PolarHBondContact O-N 3.48Å; F69-L71 PolarHBondContact O-N 3.48Å; F69-N72 PolarHBondContact O-N 3.43Å; F69-L73 WeakPolarHBondContact O-CB 3.15Å; F69-L73 PolarHBondContact O-N 2.89Å
70	Y	84.3	Confident	78.5	Confident	139 Å²	139	104.4 Å²	104.4	55%	0.545	52%	0.518	S	S	.	.	H	α-helix	trans	-62.1	-44.1	179	-176.5	-93.2	0	0	0	111.5	Y66 A67 S74	Y66-Y70 WeakPolarHBondContact O-CB 3.04Å; Y66-Y70 PolarHBondContact O-N 3.49Å; A67-Y70 PolarHBondContact O-N 2.81Å; Y70-S74 WeakPolarHBondContact CE1-OG 3.46Å; Y70-S74 WeakPolarHBondContact O-CA 3.44Å; Y70-S74 WeakPolarHBondContact O-CB 3.15Å; Y70-S74 PolarHBondContact O-N 3.4Å; Y70-S74 PolarHBondContact O-OG 2.63Å
71	L	79.9	Confident	76.8	Confident	108 Å²	108	103.2 Å²	103.2	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-70.6	-44.1	178.4	-70.7	173.4	0	0	0	111.9	A67 F68 F69 S74 T75	A67-L71 VanDerWaalsContact O-CB 3.27Å; A67-L71 WeakPolarHBondContact O-CB 3.19Å; A67-L71 WeakPolarHBondContact O-CG 3.13Å; A67-L71 PolarHBondContact O-N 3.45Å; F68-L71 PolarHBondContact O-N 2.77Å; F69-L71 PolarHBondContact O-N 3.48Å; L71-S74 PolarHBondContact O-N 2.77Å; L71-T75 VanDerWaalsContact O-CB 3.23Å; L71-T75 WeakPolarHBondContact O-CB 3.23Å; L71-T75 PolarHBondContact O-N 3.37Å; L71-T75 PolarHBondContact O-OG1 2.96Å
72	N	75.1	Confident	75	Confident	74 Å²	74	102.4 Å²	102.4	40%	0.396	52%	0.52	S	S	.	.	H	α-helix	trans	-64.2	-43.6	176.4	-76.2	-72.1	0	0	0	111.5	F68 F69 T75 E76	F68-N72 WeakPolarHBondContact CD1-ND2 3.42Å; F68-N72 WeakPolarHBondContact CD2-ND2 3.09Å; F68-N72 WeakPolarHBondContact CE1-ND2 3.37Å; F68-N72 VanDerWaalsContact CE2-ND2 3.35Å; F68-N72 WeakPolarHBondContact CE2-ND2 3.21Å; F68-N72 WeakPolarHBondContact CG-ND2 3.49Å; F68-N72 WeakPolarHBondContact CZ-ND2 3.27Å; F68-N72 WeakPolarHBondContact O-CB 3.35Å; F68-N72 PolarHBondContact O-N 2.82Å; F68-N72 PolarHBondContact O-ND2 3.44Å; F69-N72 PolarHBondContact O-N 3.43Å; N72-T75 PolarHBondContact O-N 3Å; N72-E76 PolarHBondContact O-N 2.79Å
73	L	65.6	Low	73.2	Confident	93 Å²	93	105 Å²	105	49%	0.487	53%	0.528	S	S	.	.	H	α-helix	trans	-69.3	-39	177.8	-154.7	87.6	0	0	0	111.7	F69 T75 E76 I77	F69-L73 WeakPolarHBondContact O-CB 3.15Å; F69-L73 PolarHBondContact O-N 2.89Å; L73-T75 VanDerWaalsContact C-N 3.34Å; L73-E76 PolarHBondContact O-N 2.85Å; L73-I77 HydrophobicContact CD2-CD1 3.92Å; L73-I77 HydrophobicContact CG-CD1 3.93Å; L73-I77 VanDerWaalsContact O-CB 3.31Å; L73-I77 WeakPolarHBondContact O-CB 3.31Å; L73-I77 WeakPolarHBondContact O-CD1 3.44Å; L73-I77 WeakPolarHBondContact O-CG1 3.04Å; L73-I77 PolarHBondContact O-N 2.77Å
74	S	65.2	Low	71.1	Confident	37 Å²	37	108.9 Å²	108.9	26%	0.259	56%	0.555	S	S	.	*	H	α-helix	trans	-67.8	-35.9	174.6	-60.8	0	0	0	0	111.3	Y70 L71 N78	Y70-S74 WeakPolarHBondContact CE1-OG 3.46Å; Y70-S74 WeakPolarHBondContact O-CA 3.44Å; Y70-S74 WeakPolarHBondContact O-CB 3.15Å; Y70-S74 PolarHBondContact O-N 3.4Å; Y70-S74 PolarHBondContact O-OG 2.63Å; L71-S74 PolarHBondContact O-N 2.77Å; S74-N78 WeakPolarHBondContact O-CB 3.44Å; S74-N78 PolarHBondContact O-N 2.96Å
75	T	65.2	Low	70.1	Confident	92 Å²	92	111.8 Å²	111.8	56%	0.564	57%	0.565	S	S	*	*	H	α-helix	trans	-64.4	-44.9	173.4	-72.2	0	0	0	0	110.8	L71 N72 L73 L79	L71-T75 VanDerWaalsContact O-CB 3.23Å; L71-T75 WeakPolarHBondContact O-CB 3.23Å; L71-T75 PolarHBondContact O-N 3.37Å; L71-T75 PolarHBondContact O-OG1 2.96Å; N72-T75 PolarHBondContact O-N 3Å; L73-T75 VanDerWaalsContact C-N 3.34Å; T75-L79 VanDerWaalsContact O-CB 3.22Å; T75-L79 WeakPolarHBondContact O-CB 3.22Å; T75-L79 PolarHBondContact O-N 3.43Å
76	E	61.8	Low	68.9	Low	142 Å²	142	114.3 Å²	114.3	66%	0.664	58%	0.575	S	S	*	*	H	α-helix	trans	-65.6	-46.8	175.8	-74.4	-169.4	170.4	0	0	112.3	N72 L73 N78 L79 D80	N72-E76 PolarHBondContact O-N 2.79Å; L73-E76 PolarHBondContact O-N 2.85Å; E76-N78 VanDerWaalsContact C-N 3.34Å; E76-N78 PolarHBondContact O-N 3.5Å; E76-L79 PolarHBondContact O-N 2.83Å; E76-D80 WeakPolarHBondContact O-CB 3Å; E76-D80 PolarHBondContact O-N 3.47Å
77	I	61.2	Low	67.8	Low	92 Å²	92	112.2 Å²	112.2	47%	0.472	57%	0.574	S	S	.	*	H	α-helix	trans	-62.8	-40.1	178.2	-68.9	166.3	0	0	0	111.5	L73 D80 L81	L73-I77 HydrophobicContact CD2-CD1 3.92Å; L73-I77 HydrophobicContact CG-CD1 3.93Å; L73-I77 VanDerWaalsContact O-CB 3.31Å; L73-I77 WeakPolarHBondContact O-CB 3.31Å; L73-I77 WeakPolarHBondContact O-CD1 3.44Å; L73-I77 WeakPolarHBondContact O-CG1 3.04Å; L73-I77 PolarHBondContact O-N 2.77Å; I77-D80 PolarHBondContact O-N 3.1Å; I77-L81 HydrophobicContact CG2-CD1 4Å; I77-L81 WeakPolarHBondContact O-CB 3.42Å; I77-L81 WeakPolarHBondContact O-CG 3.45Å; I77-L81 PolarHBondContact O-N 3.37Å
78	N	62.3	Low	66.6	Low	96 Å²	96	117.1 Å²	117.1	51%	0.513	59%	0.593	S	S	.	*	H	α-helix	trans	-73.1	-35	179.8	-161.9	-119.3	0	0	0	111.5	S74 E76 L81 D82	S74-N78 WeakPolarHBondContact O-CB 3.44Å; S74-N78 PolarHBondContact O-N 2.96Å; E76-N78 VanDerWaalsContact C-N 3.34Å; E76-N78 PolarHBondContact O-N 3.5Å; N78-L81 PolarHBondContact O-N 3.32Å; N78-D82 PolarHBondContact O-N 2.94Å; N78-D82 VanDerWaalsContact O-N 3.1Å
79	L	59.3	Low	65.4	Low	113 Å²	113	115.7 Å²	115.7	59%	0.592	59%	0.592	S	S	*	*	H	α-helix	trans	-65.4	-38.2	172.6	-163	79.5	0	0	0	112	T75 E76 M83	T75-L79 VanDerWaalsContact O-CB 3.22Å; T75-L79 WeakPolarHBondContact O-CB 3.22Å; T75-L79 PolarHBondContact O-N 3.43Å; E76-L79 PolarHBondContact O-N 2.83Å; L79-M83 WeakPolarHBondContact O-CG 3.34Å; L79-M83 PolarHBondContact O-N 3.04Å
80	D	56.7	Low	64.1	Low	123 Å²	123	114.1 Å²	114.1	66%	0.658	59%	0.591	S	S	*	*	H	α-helix	trans	-69.4	-37.2	176.8	-156.4	39.4	0	0	0	111.7	E76 I77 M83	E76-D80 WeakPolarHBondContact O-CB 3Å; E76-D80 PolarHBondContact O-N 3.47Å; I77-D80 PolarHBondContact O-N 3.1Å; D80-M83 PolarHBondContact O-N 3.43Å
81	L	59.8	Low	62.6	Low	117 Å²	117	112.4 Å²	112.4	61%	0.613	59%	0.594	S	S	*	*	H	α-helix	trans	-70.9	-28.2	175.7	-82.3	165.4	0	0	0	114.5	I77 N78 M83	I77-L81 HydrophobicContact CG2-CD1 4Å; I77-L81 WeakPolarHBondContact O-CB 3.42Å; I77-L81 WeakPolarHBondContact O-CG 3.45Å; I77-L81 PolarHBondContact O-N 3.37Å; N78-L81 PolarHBondContact O-N 3.32Å; L81-M83 VanDerWaalsContact C-N 3.3Å
82	D	57.3	Low	61.3	Low	126 Å²	126	112.7 Å²	112.7	67%	0.674	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.4	-7.1	176.7	-78.1	-18	0	0	0	112.5	N78	N78-D82 PolarHBondContact O-N 2.94Å; N78-D82 VanDerWaalsContact O-N 3.1Å
83	M	56.7	Low	60.2	Low	145 Å²	145	115.9 Å²	115.9	71%	0.714	61%	0.613	S	S	*	*			trans	-96.7	-8.1	-178.6	-81.2	-170.7	51.2	0	0	114.9	L79 D80 L81	L79-M83 WeakPolarHBondContact O-CG 3.34Å; L79-M83 PolarHBondContact O-N 3.04Å; D80-M83 PolarHBondContact O-N 3.43Å; L81-M83 VanDerWaalsContact C-N 3.3Å
84	D	50.7	Low	59.7	Low	215 Å²	215	118 Å²	118	100%	1.15	63%	0.625	S	S	*	*			trans	-95.9	0	171	-92.1	-12.4	0	0	0	112.2

Retrieved 84 of 84 residues in 40.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).