A0A087Y1T9_POEFO Loading...

LYR motif containing 7

AlphaFold DB , UniProt , Accession A0A087Y1T9, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 76 aa.

						>A0A087Y1T9_POEFO|A0A087Y1T9
FKAARLQINEEFKKNRNETSEENIEKMIKMGSDVEAVLRETVLQVEHVAENKLLLRPREGLLLENVPYCDEPRKKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	61.6	Low	83.6	Confident	111 Å²	111	100.1 Å²	100.1	49%	0.487	50%	0.496	S	S	.	.				0	-25.2	0	-85.4	-83.8	0	0	0	116.5	A3 A4 R5 V42 Q44	F1-A3 PolarHBondContact O-N 3.1Å; F1-A4 PolarHBondContact O-N 2.99Å; F1-R5 WeakPolarHBondContact O-CB 3.31Å; F1-R5 PolarHBondContact O-N 3.22Å; F1-V42 HydrophobicContact CD2-CG1 4.42Å; F1-V42 HydrophobicContact CE1-CG1 4.28Å; F1-V42 HydrophobicContact CE2-CB 4.28Å; F1-V42 HydrophobicContact CE2-CG1 3.29Å; F1-V42 HydrophobicContact CZ-CB 3.77Å; F1-V42 HydrophobicContact CZ-CG1 3.22Å; F1-Q44 HydrophobicContact CD2-CG 3.7Å; F1-Q44 HydrophobicContact CE2-CB 4.43Å; F1-Q44 HydrophobicContact CE2-CG 3.26Å; F1-Q44 HydrophobicContact CZ-CG 3.96Å
2	K	74.1	Confident	84	Confident	175 Å²	175	102.8 Å²	102.8	76%	0.761	50%	0.503	S	S	*	.	H	α-helix	trans	-56.5	-47.4	-178.6	-82.9	-177.8	177.7	176.7	0	114	R5 L6	K2-R5 PolarHBondContact O-N 3.28Å; K2-L6 WeakPolarHBondContact O-CG 3.27Å; K2-L6 PolarHBondContact O-N 3.1Å
3	A	78.8	Confident	84.8	Confident	78 Å²	78	105 Å²	105	65%	0.645	51%	0.509	S	S	*	.	H	α-helix	trans	-63.6	-48.6	179.6	0	0	0	0	0	112.8	F1 R5 L6 Q7	F1-A3 PolarHBondContact O-N 3.1Å; A3-R5 VanDerWaalsContact C-N 3.32Å; A3-R5 PolarHBondContact O-N 2.77Å; A3-L6 WeakPolarHBondContact O-CB 3.31Å; A3-L6 PolarHBondContact O-N 3.49Å; A3-L6 VanDerWaalsContact O-N 3.14Å; A3-Q7 PolarHBondContact O-N 3.39Å
4	A	80.9	Confident	85.5	Confident	37 Å²	37	107.3 Å²	107.3	31%	0.306	52%	0.515	S	S	.	.	H	α-helix	trans	-58.1	-43.4	176	0	0	0	0	0	112.1	F1 L6 Q7 I8	F1-A4 PolarHBondContact O-N 2.99Å; A4-L6 VanDerWaalsContact C-N 3.34Å; A4-L6 PolarHBondContact O-N 2.72Å; A4-Q7 PolarHBondContact O-N 3.41Å; A4-I8 VanDerWaalsContact O-CG1 3.28Å; A4-I8 WeakPolarHBondContact O-CG1 3.41Å; A4-I8 PolarHBondContact O-N 2.8Å
5	R	84.6	Confident	85.9	Confident	160 Å²	160	104.7 Å²	104.7	60%	0.604	51%	0.505	S	S	*	.	H	α-helix	trans	-62	-41.1	176.3	-168.9	-179.9	76.4	142.5	2.6	112.3	F1 K2 A3 N9	F1-R5 WeakPolarHBondContact O-CB 3.31Å; F1-R5 PolarHBondContact O-N 3.22Å; K2-R5 PolarHBondContact O-N 3.28Å; A3-R5 VanDerWaalsContact C-N 3.32Å; A3-R5 PolarHBondContact O-N 2.77Å; R5-N9 WeakPolarHBondContact O-CB 3.49Å; R5-N9 PolarHBondContact O-N 3.26Å; R5-N9 PolarHBondContact O-ND2 3.47Å
6	L	89.3	Confident	86.3	Confident	105 Å²	105	111.3 Å²	111.3	55%	0.55	52%	0.523	S	S	.	.	H	α-helix	trans	-62.6	-47.1	176.5	-73	168.5	0	0	0	110.9	K2 A3 A4 I8 N9 E10	K2-L6 WeakPolarHBondContact O-CG 3.27Å; K2-L6 PolarHBondContact O-N 3.1Å; A3-L6 WeakPolarHBondContact O-CB 3.31Å; A3-L6 PolarHBondContact O-N 3.49Å; A3-L6 VanDerWaalsContact O-N 3.14Å; A4-L6 VanDerWaalsContact C-N 3.34Å; A4-L6 PolarHBondContact O-N 2.72Å; L6-I8 PolarHBondContact O-N 3.35Å; L6-N9 PolarHBondContact O-N 2.99Å; L6-E10 WeakPolarHBondContact O-CG 3.29Å; L6-E10 PolarHBondContact O-N 3.31Å
7	Q	89	Confident	86.9	Confident	131 Å²	131	113.2 Å²	113.2	61%	0.612	54%	0.537	S	S	*	.	H	α-helix	trans	-61.3	-46.4	179.4	-173.6	173.8	1.6	0	0	112	A3 A4 N9 E10 E11	A3-Q7 PolarHBondContact O-N 3.39Å; A4-Q7 PolarHBondContact O-N 3.41Å; Q7-N9 VanDerWaalsContact C-N 3.33Å; Q7-N9 PolarHBondContact O-N 3.43Å; Q7-E10 PolarHBondContact O-N 3.48Å; Q7-E11 WeakPolarHBondContact O-CG 3.4Å; Q7-E11 PolarHBondContact O-N 3.31Å
8	I	87.3	Confident	87.4	Confident	64 Å²	64	110.4 Å²	110.4	33%	0.328	52%	0.524	S	S	.	.	H	α-helix	trans	-55.6	-50.3	175.3	-69.6	166	0	0	0	110.1	A4 L6 E10 E11 F12 L38	A4-I8 VanDerWaalsContact O-CG1 3.28Å; A4-I8 WeakPolarHBondContact O-CG1 3.41Å; A4-I8 PolarHBondContact O-N 2.8Å; L6-I8 PolarHBondContact O-N 3.35Å; I8-E10 VanDerWaalsContact C-N 3.32Å; I8-E10 PolarHBondContact O-N 2.98Å; I8-E11 PolarHBondContact O-N 3.26Å; I8-F12 HydrophobicContact CG2-CD2 3.68Å; I8-F12 HydrophobicContact CG2-CE2 3.68Å; I8-F12 VanDerWaalsContact O-CD2 3.28Å; I8-F12 WeakPolarHBondContact O-CD2 3.48Å; I8-F12 PolarHBondContact O-N 2.88Å; I8-L38 HydrophobicContact CD1-CD1 4.29Å
9	N	89.3	Confident	87.9	Confident	71 Å²	71	111.5 Å²	111.5	38%	0.38	54%	0.539	S	S	.	.	H	α-helix	trans	-61.5	-38.7	-179.4	-71.7	-10	0	0	0	112.9	R5 L6 Q7 K13	R5-N9 WeakPolarHBondContact O-CB 3.49Å; R5-N9 PolarHBondContact O-N 3.26Å; R5-N9 PolarHBondContact O-ND2 3.47Å; L6-N9 PolarHBondContact O-N 2.99Å; Q7-N9 VanDerWaalsContact C-N 3.33Å; Q7-N9 PolarHBondContact O-N 3.43Å; N9-K13 VanDerWaalsContact O-CG 3.27Å; N9-K13 WeakPolarHBondContact O-CG 3.33Å; N9-K13 PolarHBondContact O-N 2.83Å
10	E	94.3	Very high	88.4	Confident	86 Å²	86	108.1 Å²	108.1	40%	0.402	53%	0.527	S	S	.	.	H	α-helix	trans	-66.4	-42.2	176.6	-71.6	-56.8	122	0	0	111.8	L6 Q7 I8 F12 K13 K14	L6-E10 WeakPolarHBondContact O-CG 3.29Å; L6-E10 PolarHBondContact O-N 3.31Å; Q7-E10 PolarHBondContact O-N 3.48Å; I8-E10 VanDerWaalsContact C-N 3.32Å; I8-E10 PolarHBondContact O-N 2.98Å; E10-F12 PolarHBondContact O-N 3.16Å; E10-K13 PolarHBondContact O-N 3.38Å; E10-K13 IonicContact OE1-NZ 2.72Å; E10-K13 PolarHBondContact OE1-NZ 2.97Å; E10-K14 VanDerWaalsContact O-CG 3.31Å; E10-K14 WeakPolarHBondContact O-CG 3.28Å; E10-K14 PolarHBondContact O-N 3.38Å
11	E	90.4	Very high	88.8	Confident	83 Å²	83	110 Å²	110	39%	0.388	53%	0.534	S	S	.	.	H	α-helix	trans	-62.9	-41.4	175.2	-66.6	-50.8	131	0	0	112.1	Q7 I8 K13 K14 N15	Q7-E11 WeakPolarHBondContact O-CG 3.4Å; Q7-E11 PolarHBondContact O-N 3.31Å; I8-E11 PolarHBondContact O-N 3.26Å; E11-K13 PolarHBondContact O-N 2.95Å; E11-K14 PolarHBondContact O-N 3.41Å; E11-K14 IonicContact OE1-NZ 3.88Å; E11-K14 PolarHBondContact OE1-NZ 3.22Å; E11-K14 IonicContact OE2-NZ 2.77Å; E11-N15 PolarHBondContact O-N 3.41Å; E11-N15 PolarHBondContact O-ND2 3.5Å
12	F	88.8	Confident	90.5	Very high	132 Å²	132	110.1 Å²	110.1	58%	0.579	54%	0.537	S	S	*	.	H	α-helix	trans	-64.2	-39.8	174.1	-85.7	-78.5	0	0	0	112.6	I8 E10 N15 R16	I8-F12 HydrophobicContact CG2-CD2 3.68Å; I8-F12 HydrophobicContact CG2-CE2 3.68Å; I8-F12 VanDerWaalsContact O-CD2 3.28Å; I8-F12 WeakPolarHBondContact O-CD2 3.48Å; I8-F12 PolarHBondContact O-N 2.88Å; E10-F12 PolarHBondContact O-N 3.16Å; F12-N15 PolarHBondContact O-N 3.02Å; F12-R16 PolarHBondContact O-N 3.47Å
13	K	93.9	Very high	91.6	Very high	132 Å²	132	104.7 Å²	104.7	57%	0.574	52%	0.516	S	S	*	.	H	α-helix	trans	-64.4	-42.2	177.4	-76.4	173.9	-168.7	170	0	112.4	N9 E10 E11 N15 R16	N9-K13 VanDerWaalsContact O-CG 3.27Å; N9-K13 WeakPolarHBondContact O-CG 3.33Å; N9-K13 PolarHBondContact O-N 2.83Å; E10-K13 PolarHBondContact O-N 3.38Å; E10-K13 IonicContact OE1-NZ 2.72Å; E10-K13 PolarHBondContact OE1-NZ 2.97Å; E11-K13 PolarHBondContact O-N 2.95Å; K13-N15 PolarHBondContact O-N 2.99Å; K13-R16 VanDerWaalsContact O-CB 3.31Å; K13-R16 WeakPolarHBondContact O-CB 3.45Å; K13-R16 PolarHBondContact O-N 3.23Å
14	K	94.6	Very high	92.4	Very high	137 Å²	137	104 Å²	104	60%	0.596	50%	0.501	S	S	*	.	H	α-helix	trans	-57.6	-35.8	179	-74.2	171.3	-173	173.1	0	112	E10 E11	E10-K14 VanDerWaalsContact O-CG 3.31Å; E10-K14 WeakPolarHBondContact O-CG 3.28Å; E10-K14 PolarHBondContact O-N 3.38Å; E11-K14 PolarHBondContact O-N 3.41Å; E11-K14 IonicContact OE1-NZ 3.88Å; E11-K14 PolarHBondContact OE1-NZ 3.22Å; E11-K14 IonicContact OE2-NZ 2.77Å
15	N	92.1	Very high	93.1	Very high	68 Å²	68	107.8 Å²	107.8	36%	0.364	51%	0.512	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.9	7.4	-176.1	-63.3	-65.1	0	0	0	114	E11 F12 K13 N17 E18 M27	E11-N15 PolarHBondContact O-N 3.41Å; E11-N15 PolarHBondContact O-ND2 3.5Å; F12-N15 PolarHBondContact O-N 3.02Å; K13-N15 PolarHBondContact O-N 2.99Å; N15-N17 PolarHBondContact O-N 3.45Å; N15-N17 VanDerWaalsContact O-N 3.1Å; N15-E18 WeakPolarHBondContact O-CB 3.46Å; N15-E18 PolarHBondContact O-N 3.06Å; N15-E18 VanDerWaalsContact O-N 3.1Å; N15-M27 HydrophobicContact CB-CE 4.08Å; N15-M27 HydrophobicContact CB-SD 3.48Å; N15-M27 WeakPolarHBondContact CB-SD 3.47Å
16	R	92.6	Very high	93.7	Very high	210 Å²	210	105.8 Å²	105.8	79%	0.792	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.5	-29.4	-174.3	-178.5	179.7	179	-161.5	-0.4	114.5	F12 K13	F12-R16 PolarHBondContact O-N 3.47Å; K13-R16 VanDerWaalsContact O-CB 3.31Å; K13-R16 WeakPolarHBondContact O-CB 3.45Å; K13-R16 PolarHBondContact O-N 3.23Å
17	N	96.2	Very high	93.9	Very high	144 Å²	144	103.4 Å²	103.4	77%	0.77	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.8	9.9	-175.9	-58.8	-28.8	0	0	0	112.8	N15	N15-N17 PolarHBondContact O-N 3.45Å; N15-N17 VanDerWaalsContact O-N 3.1Å
18	E	96.2	Very high	94.1	Very high	64 Å²	64	102.5 Å²	102.5	30%	0.299	49%	0.493	S	S	.	.			trans	-64.2	136.8	172.3	179.1	58.6	-88.9	0	0	109.9	N15 S20 N23 I24 M27	N15-E18 WeakPolarHBondContact O-CB 3.46Å; N15-E18 PolarHBondContact O-N 3.06Å; N15-E18 VanDerWaalsContact O-N 3.1Å; E18-S20 VanDerWaalsContact OE1-CB 3.28Å; E18-S20 WeakPolarHBondContact OE1-CB 3.28Å; E18-S20 PolarHBondContact OE1-N 2.99Å; E18-N23 HydrophobicContact CG-CB 3.91Å; E18-N23 WeakPolarHBondContact OE2-CB 3.33Å; E18-N23 PolarHBondContact OE2-ND2 3.15Å; E18-I24 HydrophobicContact CG-CG1 3.96Å; E18-M27 HydrophobicContact CB-CE 3.93Å; E18-M27 HydrophobicContact CG-CE 3.73Å
19	T	96.4	Very high	94.5	Very high	131 Å²	131	106 Å²	106	80%	0.804	51%	0.506	S	S	*	.			trans	-123.5	-9.7	-178.3	57.6	0	0	0	0	112.8	E21	T19-E21 PolarHBondContact O-N 2.95Å
20	S	97.9	Very high	94.7	Very high	42 Å²	42	108.8 Å²	108.8	29%	0.294	52%	0.518	S	S	.	.			trans	-73.3	116.1	174.1	173.7	0	0	0	0	110.3	E18 E22 N23 I24	E18-S20 VanDerWaalsContact OE1-CB 3.28Å; E18-S20 WeakPolarHBondContact OE1-CB 3.28Å; E18-S20 PolarHBondContact OE1-N 2.99Å; S20-E22 VanDerWaalsContact C-N 3.31Å; S20-E22 PolarHBondContact O-N 3.34Å; S20-N23 PolarHBondContact O-N 2.97Å; S20-N23 VanDerWaalsContact O-N 3.16Å; S20-N23 PolarHBondContact OG-N 2.9Å; S20-I24 VanDerWaalsContact O-CG1 3.29Å; S20-I24 WeakPolarHBondContact O-CG1 3.47Å; S20-I24 PolarHBondContact O-N 2.63Å
21	E	97	Very high	94.6	Very high	148 Å²	148	106.1 Å²	106.1	69%	0.692	51%	0.513	S	S	*	.	H	α-helix	trans	-55.8	-45.4	177.8	-173.1	170.3	-164	0	0	111.6	T19 N23 I24 E25	T19-E21 PolarHBondContact O-N 2.95Å; E21-N23 VanDerWaalsContact C-N 3.32Å; E21-N23 PolarHBondContact O-N 2.94Å; E21-I24 PolarHBondContact O-N 3.41Å; E21-I24 VanDerWaalsContact O-N 3.17Å; E21-E25 WeakPolarHBondContact O-CG 3.32Å; E21-E25 PolarHBondContact O-N 2.98Å
22	E	97.6	Very high	94.8	Very high	115 Å²	115	105.2 Å²	105.2	54%	0.537	52%	0.516	S	S	.	.	H	α-helix	trans	-59.6	-41.3	178	-172.1	-170.1	163.6	0	0	112.2	S20 K26	S20-E22 VanDerWaalsContact C-N 3.31Å; S20-E22 PolarHBondContact O-N 3.34Å; E22-K26 WeakPolarHBondContact O-CG 3.42Å; E22-K26 PolarHBondContact O-N 3.19Å; E22-K26 VanDerWaalsContact O-N 3.15Å; E22-K26 WeakPolarHBondContact OE1-CE 3.32Å; E22-K26 IonicContact OE1-NZ 2.63Å; E22-K26 PolarHBondContact OE1-NZ 3.41Å
23	N	95.5	Very high	95	Very high	60 Å²	60	103.1 Å²	103.1	32%	0.321	51%	0.511	S	S	.	.	H	α-helix	trans	-70.5	-38.7	178.8	-71.9	-11.2	0	0	0	111.3	E18 S20 E21 K26 M27	E18-N23 HydrophobicContact CG-CB 3.91Å; E18-N23 WeakPolarHBondContact OE2-CB 3.33Å; E18-N23 PolarHBondContact OE2-ND2 3.15Å; S20-N23 PolarHBondContact O-N 2.97Å; S20-N23 VanDerWaalsContact O-N 3.16Å; S20-N23 PolarHBondContact OG-N 2.9Å; E21-N23 VanDerWaalsContact C-N 3.32Å; E21-N23 PolarHBondContact O-N 2.94Å; N23-K26 PolarHBondContact O-N 3.17Å; N23-M27 WeakPolarHBondContact O-CG 3.28Å; N23-M27 PolarHBondContact O-N 3.34Å
24	I	95.6	Very high	94.9	Very high	63 Å²	63	99.8 Å²	99.8	32%	0.323	50%	0.501	S	S	.	.	H	α-helix	trans	-61.1	-47.2	176.6	-68.6	163.9	0	0	0	110.2	E18 S20 E21 K26 M27 I28	E18-I24 HydrophobicContact CG-CG1 3.96Å; S20-I24 VanDerWaalsContact O-CG1 3.29Å; S20-I24 WeakPolarHBondContact O-CG1 3.47Å; S20-I24 PolarHBondContact O-N 2.63Å; E21-I24 PolarHBondContact O-N 3.41Å; E21-I24 VanDerWaalsContact O-N 3.17Å; I24-K26 VanDerWaalsContact C-N 3.34Å; I24-K26 PolarHBondContact O-N 3.46Å; I24-M27 HydrophobicContact CG1-CE 4.21Å; I24-M27 PolarHBondContact O-N 3.37Å; I24-I28 HydrophobicContact CG2-CD1 3.77Å; I24-I28 HydrophobicContact CG2-CG1 4.39Å; I24-I28 WeakPolarHBondContact O-CG1 3.47Å; I24-I28 PolarHBondContact O-N 3.14Å
25	E	96.9	Very high	94.7	Very high	118 Å²	118	98.3 Å²	98.3	55%	0.551	50%	0.497	S	S	*	.	H	α-helix	trans	-59	-44.5	177.1	-72.7	-176.4	166.6	0	0	112.2	E21 M27 I28 K29	E21-E25 WeakPolarHBondContact O-CG 3.32Å; E21-E25 PolarHBondContact O-N 2.98Å; E25-M27 VanDerWaalsContact C-N 3.34Å; E25-M27 PolarHBondContact O-N 3.36Å; E25-I28 PolarHBondContact O-N 3.21Å; E25-K29 WeakPolarHBondContact O-CB 3.35Å; E25-K29 PolarHBondContact O-N 3.48Å
26	K	95.9	Very high	94.5	Very high	117 Å²	117	97.1 Å²	97.1	51%	0.509	50%	0.496	S	S	.	.	H	α-helix	trans	-60.7	-42.5	176.2	-73.7	172.8	-173.5	167.1	0	112	E22 N23 I24 K29 M30	E22-K26 WeakPolarHBondContact O-CG 3.42Å; E22-K26 PolarHBondContact O-N 3.19Å; E22-K26 VanDerWaalsContact O-N 3.15Å; E22-K26 WeakPolarHBondContact OE1-CE 3.32Å; E22-K26 IonicContact OE1-NZ 2.63Å; E22-K26 PolarHBondContact OE1-NZ 3.41Å; N23-K26 PolarHBondContact O-N 3.17Å; I24-K26 VanDerWaalsContact C-N 3.34Å; I24-K26 PolarHBondContact O-N 3.46Å; K26-K29 PolarHBondContact O-N 2.92Å; K26-M30 WeakPolarHBondContact O-CB 3.48Å; K26-M30 PolarHBondContact O-N 3.41Å
27	M	93.9	Very high	94.4	Very high	56 Å²	56	91 Å²	91	28%	0.276	48%	0.482	S	S	.	.	H	α-helix	trans	-67.4	-40.1	178.2	-71.8	-173.1	-66.5	0	0	112.3	N15 E18 N23 I24 E25 K29 M30 G31	N15-M27 HydrophobicContact CB-CE 4.08Å; N15-M27 HydrophobicContact CB-SD 3.48Å; N15-M27 WeakPolarHBondContact CB-SD 3.47Å; E18-M27 HydrophobicContact CB-CE 3.93Å; E18-M27 HydrophobicContact CG-CE 3.73Å; N23-M27 WeakPolarHBondContact O-CG 3.28Å; N23-M27 PolarHBondContact O-N 3.34Å; I24-M27 HydrophobicContact CG1-CE 4.21Å; I24-M27 PolarHBondContact O-N 3.37Å; E25-M27 VanDerWaalsContact C-N 3.34Å; E25-M27 PolarHBondContact O-N 3.36Å; M27-K29 VanDerWaalsContact C-N 3.34Å; M27-M30 PolarHBondContact O-N 3.38Å; M27-G31 PolarHBondContact O-N 3.44Å
28	I	93.5	Very high	93.9	Very high	112 Å²	112	86.4 Å²	86.4	57%	0.574	46%	0.457	S	S	*	.	H	α-helix	trans	-60.7	-47.3	174.5	-69.7	168.6	0	0	0	109.8	I24 E25 M30 G31 S32	I24-I28 HydrophobicContact CG2-CD1 3.77Å; I24-I28 HydrophobicContact CG2-CG1 4.39Å; I24-I28 WeakPolarHBondContact O-CG1 3.47Å; I24-I28 PolarHBondContact O-N 3.14Å; E25-I28 PolarHBondContact O-N 3.21Å; I28-M30 PolarHBondContact O-N 2.93Å; I28-G31 PolarHBondContact O-N 3.43Å; I28-S32 PolarHBondContact O-N 2.91Å
29	K	96.2	Very high	93.3	Very high	138 Å²	138	88.8 Å²	88.8	60%	0.6	46%	0.463	S	S	*	.	H	α-helix	trans	-59.1	-48	177.1	-174.2	-176.2	175.9	-167.4	0	111.6	E25 K26 M27 G31 S32 D33	E25-K29 WeakPolarHBondContact O-CB 3.35Å; E25-K29 PolarHBondContact O-N 3.48Å; K26-K29 PolarHBondContact O-N 2.92Å; M27-K29 VanDerWaalsContact C-N 3.34Å; K29-G31 VanDerWaalsContact C-N 3.3Å; K29-G31 PolarHBondContact O-N 3.03Å; K29-S32 WeakPolarHBondContact O-CB 3.33Å; K29-S32 PolarHBondContact O-N 3.37Å; K29-S32 VanDerWaalsContact O-N 3.13Å; K29-D33 VanDerWaalsContact O-CG 3.32Å; K29-D33 PolarHBondContact O-N 2.94Å
30	M	94	Very high	92.7	Very high	129 Å²	129	89.7 Å²	89.7	64%	0.635	46%	0.459	S	S	*	.	H	α-helix	trans	-57.9	-43	176.5	179.5	-176.8	168.1	0	0	111.8	K26 M27 I28 S32 D33 V34	K26-M30 WeakPolarHBondContact O-CB 3.48Å; K26-M30 PolarHBondContact O-N 3.41Å; M27-M30 PolarHBondContact O-N 3.38Å; I28-M30 PolarHBondContact O-N 2.93Å; M30-S32 VanDerWaalsContact C-N 3.34Å; M30-S32 PolarHBondContact O-N 2.94Å; M30-D33 PolarHBondContact O-N 3.33Å; M30-V34 WeakPolarHBondContact O-CG2 3.45Å; M30-V34 PolarHBondContact O-N 3.47Å
31	G	91.8	Very high	92	Very high	29 Å²	29	92.3 Å²	92.3	30%	0.299	47%	0.473	S	S	.	.	H	α-helix	trans	-60.8	-42.6	175.8	0	0	0	0	0	112.6	M27 I28 K29 V34 E35	M27-G31 PolarHBondContact O-N 3.44Å; I28-G31 PolarHBondContact O-N 3.43Å; K29-G31 VanDerWaalsContact C-N 3.3Å; K29-G31 PolarHBondContact O-N 3.03Å; G31-V34 PolarHBondContact O-N 3.48Å; G31-E35 WeakPolarHBondContact O-CB 3.34Å; G31-E35 PolarHBondContact O-N 3.49Å
32	S	93.5	Very high	91.3	Very high	65 Å²	65	87.3 Å²	87.3	46%	0.455	45%	0.453	S	S	.	.	H	α-helix	trans	-63.1	-44.3	175	-172.5	0	0	0	0	112.2	I28 K29 M30 V34 E35 A36	I28-S32 PolarHBondContact O-N 2.91Å; K29-S32 WeakPolarHBondContact O-CB 3.33Å; K29-S32 PolarHBondContact O-N 3.37Å; K29-S32 VanDerWaalsContact O-N 3.13Å; M30-S32 VanDerWaalsContact C-N 3.34Å; M30-S32 PolarHBondContact O-N 2.94Å; S32-V34 VanDerWaalsContact C-N 3.34Å; S32-V34 PolarHBondContact O-N 3.17Å; S32-E35 PolarHBondContact O-N 2.74Å; S32-A36 PolarHBondContact O-N 3.45Å
33	D	94.4	Very high	90.6	Very high	87 Å²	87	86.8 Å²	86.8	47%	0.465	45%	0.453	S	S	.	.	H	α-helix	trans	-63.7	-41.8	179.8	-67.5	-20.3	0	0	0	110.8	K29 M30 A36 V37	K29-D33 VanDerWaalsContact O-CG 3.32Å; K29-D33 PolarHBondContact O-N 2.94Å; M30-D33 PolarHBondContact O-N 3.33Å; D33-A36 PolarHBondContact O-N 3.33Å; D33-V37 WeakPolarHBondContact O-CG2 3.33Å; D33-V37 PolarHBondContact O-N 3Å; D33-V37 VanDerWaalsContact O-N 3.17Å
34	V	91.4	Very high	89.9	Confident	62 Å²	62	87.9 Å²	87.9	38%	0.376	46%	0.456	S	S	.	.	H	α-helix	trans	-63.7	-41.7	174.4	170.2	0	0	0	0	111.5	M30 G31 S32 V37 L38	M30-V34 WeakPolarHBondContact O-CG2 3.45Å; M30-V34 PolarHBondContact O-N 3.47Å; G31-V34 PolarHBondContact O-N 3.48Å; S32-V34 VanDerWaalsContact C-N 3.34Å; S32-V34 PolarHBondContact O-N 3.17Å; V34-V37 PolarHBondContact O-N 3.44Å; V34-L38 HydrophobicContact CG1-CD1 3.95Å; V34-L38 HydrophobicContact CG1-CG 4.3Å; V34-L38 WeakPolarHBondContact O-CG 3.22Å; V34-L38 PolarHBondContact O-N 3.34Å
35	E	89.2	Confident	89.5	Confident	107 Å²	107	88.6 Å²	88.6	50%	0.5	46%	0.463	S	S	.	.	H	α-helix	trans	-60.8	-45	177.8	-172.6	-106.1	151.7	0	0	111.6	G31 S32 V37 L38 R39	G31-E35 WeakPolarHBondContact O-CB 3.34Å; G31-E35 PolarHBondContact O-N 3.49Å; S32-E35 PolarHBondContact O-N 2.74Å; E35-V37 PolarHBondContact O-N 2.96Å; E35-L38 CarbonylContact O-C 3.59Å; E35-L38 PolarHBondContact O-N 2.89Å; E35-R39 WeakPolarHBondContact O-CB 3.44Å; E35-R39 PolarHBondContact O-N 2.81Å
36	A	89.4	Confident	89.1	Confident	42 Å²	42	86.8 Å²	86.8	35%	0.347	46%	0.455	S	S	.	.	H	α-helix	trans	-57.5	-47.3	175.4	0	0	0	0	0	112	S32 D33 L38 R39 E40	S32-A36 PolarHBondContact O-N 3.45Å; D33-A36 PolarHBondContact O-N 3.33Å; A36-L38 PolarHBondContact O-N 3.13Å; A36-R39 WeakPolarHBondContact O-CA 3.48Å; A36-R39 VanDerWaalsContact O-CB 3.22Å; A36-R39 WeakPolarHBondContact O-CB 2.99Å; A36-R39 PolarHBondContact O-N 3.09Å; A36-E40 PolarHBondContact O-N 3.04Å; A36-E40 VanDerWaalsContact O-N 3.14Å
37	V	89.6	Confident	88.9	Confident	83 Å²	83	88.9 Å²	88.9	50%	0.503	47%	0.466	S	S	.	.	H	α-helix	trans	-61.8	-46.9	177.4	173.2	0	0	0	0	111.3	D33 V34 E35 R39 E40 T41	D33-V37 WeakPolarHBondContact O-CG2 3.33Å; D33-V37 PolarHBondContact O-N 3Å; D33-V37 VanDerWaalsContact O-N 3.17Å; V34-V37 PolarHBondContact O-N 3.44Å; E35-V37 PolarHBondContact O-N 2.96Å; V37-R39 PolarHBondContact O-N 2.99Å; V37-E40 PolarHBondContact O-N 3.22Å; V37-T41 HydrophobicContact CG1-CG2 4.15Å; V37-T41 WeakPolarHBondContact O-CB 3.42Å; V37-T41 WeakPolarHBondContact O-CG2 3.41Å; V37-T41 PolarHBondContact O-N 2.97Å; V37-T41 PolarHBondContact O-OG1 3.23Å
38	L	86.9	Confident	88.9	Confident	47 Å²	47	89.4 Å²	89.4	25%	0.246	47%	0.472	C	S	.	.	H	α-helix	trans	-63.1	-25.7	175.4	-68.3	176	0	0	0	111.8	I8 V34 E35 A36 V42 R58	I8-L38 HydrophobicContact CD1-CD1 4.29Å; V34-L38 HydrophobicContact CG1-CD1 3.95Å; V34-L38 HydrophobicContact CG1-CG 4.3Å; V34-L38 WeakPolarHBondContact O-CG 3.22Å; V34-L38 PolarHBondContact O-N 3.34Å; E35-L38 CarbonylContact O-C 3.59Å; E35-L38 PolarHBondContact O-N 2.89Å; A36-L38 PolarHBondContact O-N 3.13Å; L38-V42 HydrophobicContact CD2-CG2 3.79Å; L38-R58 PolarHBondContact O-NH2 2.99Å
39	R	82.6	Confident	89	Confident	113 Å²	113	86.7 Å²	86.7	43%	0.426	47%	0.466	S	S	.	.	H	α-helix	trans	-69.1	-40.2	178.9	-158.8	174.4	-178.6	-86.9	2.9	112.6	E35 A36 V37 R58	E35-R39 WeakPolarHBondContact O-CB 3.44Å; E35-R39 PolarHBondContact O-N 2.81Å; A36-R39 WeakPolarHBondContact O-CA 3.48Å; A36-R39 VanDerWaalsContact O-CB 3.22Å; A36-R39 WeakPolarHBondContact O-CB 2.99Å; A36-R39 PolarHBondContact O-N 3.09Å; V37-R39 PolarHBondContact O-N 2.99Å; R39-R58 VanDerWaalsContact O-CZ 3.28Å; R39-R58 PolarHBondContact O-NE 3.14Å; R39-R58 PolarHBondContact O-NH2 3.2Å
40	E	82.9	Confident	89	Confident	151 Å²	151	88.6 Å²	88.6	71%	0.706	48%	0.477	S	S	*	.	H	α-helix	trans	-89.5	-38	-175.9	-66	177.2	178.9	0	0	112.7	A36 V37	A36-E40 PolarHBondContact O-N 3.04Å; A36-E40 VanDerWaalsContact O-N 3.14Å; V37-E40 PolarHBondContact O-N 3.22Å
41	T	84.1	Confident	88.9	Confident	97 Å²	97	90.1 Å²	90.1	60%	0.595	49%	0.488	S	S	*	.	H	α-helix	trans	-97.7	-13.6	-165.5	63.8	0	0	0	0	114.4	V37	V37-T41 HydrophobicContact CG1-CG2 4.15Å; V37-T41 WeakPolarHBondContact O-CB 3.42Å; V37-T41 WeakPolarHBondContact O-CG2 3.41Å; V37-T41 PolarHBondContact O-N 2.97Å; V37-T41 PolarHBondContact O-OG1 3.23Å
42	V	82.8	Confident	89	Confident	43 Å²	43	95 Å²	95	26%	0.261	50%	0.501	S	S	.	.			trans	-119.8	122.3	-172.1	-165.6	0	0	0	0	112.2	F1 L38 R58	F1-V42 HydrophobicContact CD2-CG1 4.42Å; F1-V42 HydrophobicContact CE1-CG1 4.28Å; F1-V42 HydrophobicContact CE2-CB 4.28Å; F1-V42 HydrophobicContact CE2-CG1 3.29Å; F1-V42 HydrophobicContact CZ-CB 3.77Å; F1-V42 HydrophobicContact CZ-CG1 3.22Å; L38-V42 HydrophobicContact CD2-CG2 3.79Å; V42-R58 PolarHBondContact O-NH2 3.14Å
43	L	82.4	Confident	88.9	Confident	104 Å²	104	96.6 Å²	96.6	55%	0.545	50%	0.504	S	S	.	.			trans	-94.8	137.3	168.6	-70.1	172.7	0	0	0	110.9	L61	L43-L61 HydrophobicContact CD2-CD1 4.4Å
44	Q	81.8	Confident	88.7	Confident	82 Å²	82	96.1 Å²	96.1	38%	0.383	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	129.2	175.7	-73.2	-179.6	-2	0	0	110	F1 R56	F1-Q44 HydrophobicContact CD2-CG 3.7Å; F1-Q44 HydrophobicContact CE2-CB 4.43Å; F1-Q44 HydrophobicContact CE2-CG 3.26Å; F1-Q44 HydrophobicContact CZ-CG 3.96Å; Q44-R56 HydrophobicContact CB-CB 4.19Å; Q44-R56 PolarHBondContact O-N 2.75Å
45	V	85.9	Confident	88.4	Confident	79 Å²	79	97.9 Å²	97.9	48%	0.479	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	137.8	-179.9	-169.7	0	0	0	0	109.5	L53 L54 L55	V45-L53 HydrophobicContact CG1-CB 3.77Å; V45-L53 HydrophobicContact CG1-CD1 4.16Å; V45-L53 HydrophobicContact CG1-CD2 4.2Å; V45-L53 HydrophobicContact CG1-CG 4.26Å; V45-L54 WeakPolarHBondContact CA-O 3.42Å; V45-L55 HydrophobicContact CB-CD2 4.29Å; V45-L55 HydrophobicContact CG1-CD2 4.09Å; V45-L55 HydrophobicContact CG2-CD2 3.47Å; V45-L55 VanDerWaalsContact CG2-CD2 3.47Å
46	E	88.3	Confident	88.2	Confident	80 Å²	80	99.4 Å²	99.4	37%	0.374	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	130.5	177.2	-176.2	174.8	-168.8	0	0	110.2	V48 L53 L54 R56	E46-V48 HydrophobicContact CB-CG1 4.38Å; E46-V48 HydrophobicContact CG-CG1 3.98Å; E46-V48 PolarHBondContact O-N 3.28Å; E46-L53 CarbonylContact O-C 3.58Å; E46-L53 WeakPolarHBondContact O-CA 3.22Å; E46-L54 HydrophobicContact CB-CB 4.45Å; E46-L54 PolarHBondContact N-O 3.03Å; E46-L54 PolarHBondContact O-N 2.81Å; E46-R56 IonicContact OE2-CZ 3.28Å; E46-R56 VanDerWaalsContact OE2-CZ 3.28Å; E46-R56 IonicContact OE2-NE 2.96Å; E46-R56 PolarHBondContact OE2-NE 2.66Å; E46-R56 IonicContact OE2-NH2 2.74Å; E46-R56 PolarHBondContact OE2-NH2 3.48Å
47	H	91.4	Very high	87.6	Confident	160 Å²	160	99.8 Å²	99.8	74%	0.741	51%	0.508	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.6	114.3	168	-88.6	-137.8	0	0	0	108.5	L53	H47-L53 WeakPolarHBondContact CD2-CD2 3.39Å; H47-L53 WeakPolarHBondContact NE2-CD2 3.37Å
48	V	95.3	Very high	87	Confident	67 Å²	67	99.4 Å²	99.4	41%	0.406	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	-19.4	-177.2	-64.4	0	0	0	0	113.3	E46 K52 L54	E46-V48 HydrophobicContact CB-CG1 4.38Å; E46-V48 HydrophobicContact CG-CG1 3.98Å; E46-V48 PolarHBondContact O-N 3.28Å; V48-K52 HydrophobicContact CG2-CB 4.02Å; V48-K52 HydrophobicContact CG2-CD 3.86Å; V48-K52 HydrophobicContact CG2-CG 3.65Å; V48-K52 WeakPolarHBondContact CG2-O 3.38Å; V48-K52 PolarHBondContact N-O 2.94Å; V48-L54 HydrophobicContact CG1-CB 3.66Å; V48-L54 HydrophobicContact CG1-CD2 4.26Å; V48-L54 HydrophobicContact CG2-CB 4.26Å
49	A	94.8	Very high	86.2	Confident	55 Å²	55	105.6 Å²	105.6	46%	0.455	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-160.9	176.4	170.4	0	0	0	0	0	110.2	N51 K52	A49-N51 PolarHBondContact O-N 2.85Å; A49-K52 HydrophobicContact CB-CB 3.86Å; A49-K52 HydrophobicContact CB-CD 4.42Å; A49-K52 PolarHBondContact N-O 3.29Å; A49-K52 PolarHBondContact O-N 2.9Å
50	E	95.4	Very high	85.8	Confident	178 Å²	178	103.3 Å²	103.3	83%	0.832	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.5	124.7	169	-172	173.6	-166.2	0	0	109.9	K52	E50-K52 PolarHBondContact O-N 3.24Å; E50-K52 VanDerWaalsContact O-N 3.09Å
51	N	92.4	Very high	85.2	Confident	162 Å²	162	99.7 Å²	99.7	87%	0.866	52%	0.522	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.5	21.2	-176.5	-55.4	-41.7	0	0	0	115.3	A49	A49-N51 PolarHBondContact O-N 2.85Å
52	K	93.7	Very high	84.7	Confident	131 Å²	131	100.2 Å²	100.2	57%	0.57	52%	0.521	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.6	120.4	179.1	-163.9	177.4	178.6	177.5	0	112.2	V48 A49 E50	V48-K52 HydrophobicContact CG2-CB 4.02Å; V48-K52 HydrophobicContact CG2-CD 3.86Å; V48-K52 HydrophobicContact CG2-CG 3.65Å; V48-K52 WeakPolarHBondContact CG2-O 3.38Å; V48-K52 PolarHBondContact N-O 2.94Å; A49-K52 HydrophobicContact CB-CB 3.86Å; A49-K52 HydrophobicContact CB-CD 4.42Å; A49-K52 PolarHBondContact N-O 3.29Å; A49-K52 PolarHBondContact O-N 2.9Å; E50-K52 PolarHBondContact O-N 3.24Å; E50-K52 VanDerWaalsContact O-N 3.09Å
53	L	92.5	Very high	84.3	Confident	99 Å²	99	105.6 Å²	105.6	52%	0.518	55%	0.547	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	135.2	176.8	-56.5	-178.3	0	0	0	110.1	V45 E46 H47	V45-L53 HydrophobicContact CG1-CB 3.77Å; V45-L53 HydrophobicContact CG1-CD1 4.16Å; V45-L53 HydrophobicContact CG1-CD2 4.2Å; V45-L53 HydrophobicContact CG1-CG 4.26Å; E46-L53 CarbonylContact O-C 3.58Å; E46-L53 WeakPolarHBondContact O-CA 3.22Å; H47-L53 WeakPolarHBondContact CD2-CD2 3.39Å; H47-L53 WeakPolarHBondContact NE2-CD2 3.37Å
54	L	89.1	Confident	84	Confident	76 Å²	76	108.9 Å²	108.9	40%	0.398	56%	0.56	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-103.1	113.4	168.7	179.4	63.4	0	0	0	108.7	V45 E46 V48 R56	V45-L54 WeakPolarHBondContact CA-O 3.42Å; E46-L54 HydrophobicContact CB-CB 4.45Å; E46-L54 PolarHBondContact N-O 3.03Å; E46-L54 PolarHBondContact O-N 2.81Å; V48-L54 HydrophobicContact CG1-CB 3.66Å; V48-L54 HydrophobicContact CG1-CD2 4.26Å; V48-L54 HydrophobicContact CG2-CB 4.26Å; L54-R56 HydrophobicContact CG-CG 4.42Å
55	L	86.6	Confident	83.5	Confident	100 Å²	100	113 Å²	113	52%	0.524	59%	0.585	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-72.8	137	166.4	-59.3	-179.2	0	0	0	108.4	V45 P57	V45-L55 HydrophobicContact CB-CD2 4.29Å; V45-L55 HydrophobicContact CG1-CD2 4.09Å; V45-L55 HydrophobicContact CG2-CD2 3.47Å; V45-L55 VanDerWaalsContact CG2-CD2 3.47Å; L55-P57 VanDerWaalsContact C-CD 3.43Å; L55-P57 HydrophobicContact CB-CG 4.24Å; L55-P57 WeakPolarHBondContact O-CD 3.39Å
56	R	83.6	Confident	83	Confident	138 Å²	138	112.3 Å²	112.3	52%	0.521	58%	0.58	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-117	74.6	168.4	-65.4	-176.5	-179.7	-111.9	5.2	108.6	Q44 E46 L54	Q44-R56 HydrophobicContact CB-CB 4.19Å; Q44-R56 PolarHBondContact O-N 2.75Å; E46-R56 IonicContact OE2-CZ 3.28Å; E46-R56 VanDerWaalsContact OE2-CZ 3.28Å; E46-R56 IonicContact OE2-NE 2.96Å; E46-R56 PolarHBondContact OE2-NE 2.66Å; E46-R56 IonicContact OE2-NH2 2.74Å; E46-R56 PolarHBondContact OE2-NH2 3.48Å; L54-R56 HydrophobicContact CG-CG 4.42Å
57	P	76.7	Confident	82.6	Confident	51 Å²	51	113.4 Å²	113.4	33%	0.331	60%	0.595	S	S	.	*			trans	-67.5	151.6	176.5	-10.6	28.3	0	0	0	109.4	L55 L62	L55-P57 VanDerWaalsContact C-CD 3.43Å; L55-P57 HydrophobicContact CB-CG 4.24Å; L55-P57 WeakPolarHBondContact O-CD 3.39Å; P57-L62 HydrophobicContact CB-CD2 3.6Å; P57-L62 HydrophobicContact CB-CG 4.29Å; P57-L62 HydrophobicContact CG-CD2 3.67Å
58	R	77.4	Confident	81.9	Confident	74 Å²	74	114.8 Å²	114.8	28%	0.279	60%	0.595	S	S	.	*			trans	-72.9	145.9	168.1	-78.5	176.7	-82.5	-116	-15.4	109.4	L38 R39 V42 G60 L61	L38-R58 PolarHBondContact O-NH2 2.99Å; R39-R58 VanDerWaalsContact O-CZ 3.28Å; R39-R58 PolarHBondContact O-NE 3.14Å; R39-R58 PolarHBondContact O-NH2 3.2Å; V42-R58 PolarHBondContact O-NH2 3.14Å; R58-G60 PolarHBondContact O-N 2.8Å; R58-G60 VanDerWaalsContact O-N 3.14Å; R58-L61 HydrophobicContact CB-CD1 4.41Å; R58-L61 WeakPolarHBondContact O-CB 3.48Å; R58-L61 PolarHBondContact O-N 3.36Å
59	E	71.3	Confident	81.3	Confident	177 Å²	177	115 Å²	115	83%	0.827	60%	0.598	S	S	*	*	G	3₁₀ helix	trans	-51.8	-40.7	-176.3	-70.3	179.2	166.2	0	0	113.1	L61 L62	E59-L61 PolarHBondContact O-N 2.9Å; E59-L62 PolarHBondContact O-N 3.2Å
60	G	74.3	Confident	80.6	Confident	65 Å²	65	118.9 Å²	118.9	67%	0.67	61%	0.611	S	S	*	*	G	3₁₀ helix	trans	-72.4	-3.8	178.8	0	0	0	0	0	116.1	R58	R58-G60 PolarHBondContact O-N 2.8Å; R58-G60 VanDerWaalsContact O-N 3.14Å
61	L	69.8	Low	80.1	Confident	75 Å²	75	117.5 Å²	117.5	39%	0.393	61%	0.605	S	S	.	*	G	3₁₀ helix	trans	-102.7	-9.2	173.7	-68.6	172.1	0	0	0	112.3	L43 R58 E59 L63	L43-L61 HydrophobicContact CD2-CD1 4.4Å; R58-L61 HydrophobicContact CB-CD1 4.41Å; R58-L61 WeakPolarHBondContact O-CB 3.48Å; R58-L61 PolarHBondContact O-N 3.36Å; E59-L61 PolarHBondContact O-N 2.9Å; L61-L63 PolarHBondContact O-N 3.29Å
62	L	73.2	Confident	79.4	Confident	108 Å²	108	115.6 Å²	115.6	57%	0.565	60%	0.601	S	S	*	*			trans	-75.2	115.2	178.2	-64	176.5	0	0	0	108.6	P57 E59	P57-L62 HydrophobicContact CB-CD2 3.6Å; P57-L62 HydrophobicContact CB-CG 4.29Å; P57-L62 HydrophobicContact CG-CD2 3.67Å; E59-L62 PolarHBondContact O-N 3.2Å
63	L	73.9	Confident	78.3	Confident	156 Å²	156	118 Å²	118	82%	0.817	61%	0.607	S	S	*	*			trans	-77.1	162.3	167.6	-63.6	175.9	0	0	0	109.6	L61 N65	L61-L63 PolarHBondContact O-N 3.29Å; L63-N65 PolarHBondContact O-N 3.3Å
64	E	77.1	Confident	77.1	Confident	173 Å²	173	123 Å²	123	81%	0.808	62%	0.624	S	S	*	*			trans	-52.7	133.4	168.8	-69.7	-175.9	175.7	0	0	109.5	V66	E64-V66 HydrophobicContact CB-CG2 4.06Å; E64-V66 PolarHBondContact O-N 3.31Å
65	N	70.1	Confident	75.6	Confident	170 Å²	170	129.3 Å²	129.3	91%	0.909	65%	0.649	S	S	*	*			trans	-69.2	72.4	174.1	-84.1	-46.8	0	0	0	109.4	L63 P67	L63-N65 PolarHBondContact O-N 3.3Å; N65-P67 WeakPolarHBondContact O-CD 3.47Å
66	V	77.1	Confident	74.2	Confident	63 Å²	63	133.5 Å²	133.5	38%	0.382	69%	0.686	S	S	.	*	P	Polyproline II helix	trans	-86	119.2	168.7	-171.5	0	0	0	0	106.6	E64 Y68 R73	E64-V66 HydrophobicContact CB-CG2 4.06Å; E64-V66 PolarHBondContact O-N 3.31Å; V66-Y68 PolarHBondContact O-N 2.72Å; V66-R73 VanDerWaalsContact CG1-NH2 3.31Å
67	P	79.4	Confident	73.7	Confident	104 Å²	104	133.3 Å²	133.3	68%	0.675	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-50.2	134.7	174.4	-26.2	34.3	0	0	0	110.1	N65 C69	N65-P67 WeakPolarHBondContact O-CD 3.47Å; P67-C69 PolarHBondContact O-N 3.34Å
68	Y	77.1	Confident	73.6	Confident	189 Å²	189	137.6 Å²	137.6	74%	0.741	71%	0.713	S	S	*	*	P	Polyproline II helix	trans	-58.3	131.9	171.2	176.5	-96.2	0	0	0	108.7	V66 D70	V66-Y68 PolarHBondContact O-N 2.72Å; Y68-D70 WeakPolarHBondContact CE1-OD1 3.08Å; Y68-D70 VanDerWaalsContact CZ-OD1 3.22Å; Y68-D70 PolarHBondContact OH-OD1 2.62Å
69	C	81.8	Confident	73.4	Confident	72 Å²	72	141.1 Å²	141.1	49%	0.486	74%	0.738	S	S	.	*			trans	-132.8	123.1	178	-174.1	0	0	0	0	107.5	P67 E71	P67-C69 PolarHBondContact O-N 3.34Å; C69-E71 PolarHBondContact O-N 3.17Å
70	D	81.2	Confident	73.5	Confident	135 Å²	135	139 Å²	139	72%	0.722	73%	0.732	S	S	*	*	S	Bend	trans	-67.3	-20.7	177	-73.2	-58	0	0	0	112.3	Y68	Y68-D70 WeakPolarHBondContact CE1-OD1 3.08Å; Y68-D70 VanDerWaalsContact CZ-OD1 3.22Å; Y68-D70 PolarHBondContact OH-OD1 2.62Å
71	E	84.1	Confident	73.4	Confident	150 Å²	150	143.6 Å²	143.6	70%	0.701	74%	0.736	S	S	*	*	S	Bend	trans	-84.1	136.9	179.7	-61	-173.7	174.8	0	0	111.5	C69 R73	C69-E71 PolarHBondContact O-N 3.17Å; E71-R73 PolarHBondContact O-N 3.35Å
72	P	78.3	Confident	73.7	Confident	122 Å²	122	148.2 Å²	148.2	79%	0.792	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-57.3	123.9	175.3	-19	29	0	0	0	110.4	K74	P72-K74 PolarHBondContact O-N 3.13Å; P72-K74 VanDerWaalsContact O-N 3.13Å
73	R	70.3	Confident	73.7	Confident	181 Å²	181	151.1 Å²	151.1	68%	0.683	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-59.8	121.1	174.8	-63.4	-176	-155	172.6	6.6	108.9	V66 E71 K75	V66-R73 VanDerWaalsContact CG1-NH2 3.31Å; E71-R73 PolarHBondContact O-N 3.35Å; R73-K75 PolarHBondContact O-N 3.32Å
74	K	66.5	Low	73.7	Confident	204 Å²	204	150.7 Å²	150.7	89%	0.887	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-63.6	125	167.7	-66.9	-176.8	-178.1	177	0	107.5	P72 S76	P72-K74 PolarHBondContact O-N 3.13Å; P72-K74 VanDerWaalsContact O-N 3.13Å; K74-S76 PolarHBondContact O-N 3.33Å
75	K	58.3	Low	73.4	Confident	209 Å²	209	148.8 Å²	148.8	91%	0.909	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-63	125.6	172.9	-68.7	-172.6	177.7	-176.5	0	108	R73	R73-K75 PolarHBondContact O-N 3.32Å
76	S	56.8	Low	73.7	Confident	187 Å²	187	146.9 Å²	146.9	100%	1.308	75%	0.753	S	S	*	*			trans	-82.9	0	170.3	-165	0	0	0	0	111.2	K74	K74-S76 PolarHBondContact O-N 3.33Å

Retrieved 76 of 76 residues in 183.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).