A0A087Y248_POEFO Loading...

Heat shock factor-binding protein 1

Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

AlphaFold DB , UniProt , Accession A0A087Y248, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 77 aa.

						>A0A087Y248_POEFO|A0A087Y248
MAETDPKSVQDLTNVVQTLLQQMQDKFQTMSDQIIGRIDEMSTRIDDLEKNIADLMTQAGVEEIEAAPEKPKESQGS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.1	Very low	72.4	Confident	239 Å²	239	122.5 Å²	122.5	100%	1.177	68%	0.675	S	S	*	*				0	113.9	0	-106.6	143.7	150	0	0	106.1	E3	M1-E3 PolarHBondContact O-N 2.77Å; M1-E3 VanDerWaalsContact O-N 3.16Å
2	A	53.2	Low	74.2	Confident	103 Å²	103	121.7 Å²	121.7	85%	0.851	67%	0.668	S	S	*	*			trans	-71.3	107.1	171.8	0	0	0	0	0	106.5	T4	A2-T4 PolarHBondContact O-N 3.32Å; A2-T4 VanDerWaalsContact O-N 3.09Å
3	E	55.8	Low	75.8	Confident	187 Å²	187	118.5 Å²	118.5	87%	0.874	65%	0.654	S	S	*	*			trans	-64	108.7	172.1	-62.8	-176	115.1	0	0	106.6	M1 D5	M1-E3 PolarHBondContact O-N 2.77Å; M1-E3 VanDerWaalsContact O-N 3.16Å; E3-D5 PolarHBondContact O-N 3.17Å
4	T	67.2	Low	77.3	Confident	115 Å²	115	116.1 Å²	116.1	71%	0.706	64%	0.64	S	S	*	*			trans	-62.6	108.9	170.9	43.3	0	0	0	0	107.4	A2	A2-T4 PolarHBondContact O-N 3.32Å; A2-T4 VanDerWaalsContact O-N 3.09Å
5	D	73.4	Confident	78.5	Confident	90 Å²	90	113.7 Å²	113.7	48%	0.481	63%	0.63	S	S	.	*			trans	-56.4	122.9	-179.9	-171.9	-47.7	0	0	0	109.2	E3 K7 S8 V9	E3-D5 PolarHBondContact O-N 3.17Å; D5-K7 PolarHBondContact O-N 3.47Å; D5-K7 VanDerWaalsContact O-N 3.12Å; D5-K7 VanDerWaalsContact OD1-CB 3.28Å; D5-K7 WeakPolarHBondContact OD1-CB 3.26Å; D5-K7 PolarHBondContact OD1-N 3.07Å; D5-S8 VanDerWaalsContact O-CB 3.32Å; D5-S8 WeakPolarHBondContact O-CB 3.38Å; D5-S8 PolarHBondContact O-N 3.43Å; D5-V9 PolarHBondContact O-N 3.23Å
6	P	71.3	Confident	79.7	Confident	93 Å²	93	111.1 Å²	111.1	60%	0.604	62%	0.617	S	S	*	*	H	α-helix	trans	-58.6	-25.1	-177.9	20.1	-30.3	0	0	0	113.4	V9 Q10	P6-V9 PolarHBondContact O-N 3.27Å; P6-Q10 WeakPolarHBondContact O-CG 3.44Å; P6-Q10 PolarHBondContact O-N 3.46Å; P6-Q10 VanDerWaalsContact O-N 3.15Å
7	K	75.4	Confident	80.7	Confident	148 Å²	148	112.2 Å²	112.2	64%	0.643	62%	0.617	S	S	*	*	H	α-helix	trans	-66.3	-40.2	171.8	-70	179.4	175	174.2	0	111.8	D5 V9 Q10 D11	D5-K7 PolarHBondContact O-N 3.47Å; D5-K7 VanDerWaalsContact O-N 3.12Å; D5-K7 VanDerWaalsContact OD1-CB 3.28Å; D5-K7 WeakPolarHBondContact OD1-CB 3.26Å; D5-K7 PolarHBondContact OD1-N 3.07Å; K7-V9 VanDerWaalsContact C-N 3.26Å; K7-V9 PolarHBondContact O-N 2.95Å; K7-Q10 PolarHBondContact O-N 2.98Å; K7-D11 VanDerWaalsContact O-CG 3.32Å; K7-D11 PolarHBondContact O-N 3.49Å
8	S	83.1	Confident	81.7	Confident	76 Å²	76	110.2 Å²	110.2	53%	0.531	61%	0.609	S	S	.	*	H	α-helix	trans	-63.6	-32.6	177.7	-179.4	0	0	0	0	112.4	D5 L12	D5-S8 VanDerWaalsContact O-CB 3.32Å; D5-S8 WeakPolarHBondContact O-CB 3.38Å; D5-S8 PolarHBondContact O-N 3.43Å; S8-L12 PolarHBondContact O-N 3.2Å
9	V	89.7	Confident	82.5	Confident	75 Å²	75	109.6 Å²	109.6	46%	0.455	60%	0.604	S	S	.	*	H	α-helix	trans	-75	-38.3	177	179.6	0	0	0	0	111.4	D5 P6 K7 L12 T13	D5-V9 PolarHBondContact O-N 3.23Å; P6-V9 PolarHBondContact O-N 3.27Å; K7-V9 VanDerWaalsContact C-N 3.26Å; K7-V9 PolarHBondContact O-N 2.95Å; V9-L12 PolarHBondContact O-N 2.99Å; V9-T13 PolarHBondContact O-N 3.39Å; V9-T13 PolarHBondContact O-OG1 3.37Å
10	Q	91.2	Very high	83.3	Confident	122 Å²	122	109.5 Å²	109.5	57%	0.57	60%	0.602	S	S	*	*	H	α-helix	trans	-63.9	-45.4	174.5	-73.6	175.8	-4.2	0	0	111.3	P6 K7 L12 T13 N14	P6-Q10 WeakPolarHBondContact O-CG 3.44Å; P6-Q10 PolarHBondContact O-N 3.46Å; P6-Q10 VanDerWaalsContact O-N 3.15Å; K7-Q10 PolarHBondContact O-N 2.98Å; Q10-L12 VanDerWaalsContact C-N 3.34Å; Q10-L12 PolarHBondContact O-N 2.92Å; Q10-T13 WeakPolarHBondContact O-CB 3.28Å; Q10-T13 PolarHBondContact O-N 2.87Å; Q10-T13 VanDerWaalsContact O-N 3.14Å; Q10-N14 VanDerWaalsContact O-CG 3.3Å; Q10-N14 PolarHBondContact O-N 3.32Å; Q10-N14 PolarHBondContact O-ND2 3.49Å
11	D	93.1	Very high	84	Confident	100 Å²	100	108.7 Å²	108.7	54%	0.535	59%	0.594	S	S	.	*	H	α-helix	trans	-60.7	-43.5	177.7	-70.4	-21.9	0	0	0	111.6	K7 T13 N14 V15	K7-D11 VanDerWaalsContact O-CG 3.32Å; K7-D11 PolarHBondContact O-N 3.49Å; D11-T13 VanDerWaalsContact C-N 3.31Å; D11-T13 PolarHBondContact O-N 3.45Å; D11-N14 PolarHBondContact O-N 2.83Å; D11-V15 WeakPolarHBondContact O-CG2 3.49Å; D11-V15 PolarHBondContact O-N 2.88Å
12	L	94.3	Very high	86.6	Confident	112 Å²	112	103 Å²	103	59%	0.586	56%	0.564	S	S	*	*	H	α-helix	trans	-61.5	-41.3	175.3	-179.4	60.9	0	0	0	111.8	S8 V9 Q10 V15 V16	S8-L12 PolarHBondContact O-N 3.2Å; V9-L12 PolarHBondContact O-N 2.99Å; Q10-L12 VanDerWaalsContact C-N 3.34Å; Q10-L12 PolarHBondContact O-N 2.92Å; L12-V15 PolarHBondContact O-N 2.79Å; L12-V16 HydrophobicContact CD1-CG2 4.44Å; L12-V16 WeakPolarHBondContact O-CG2 3.48Å; L12-V16 PolarHBondContact O-N 2.98Å
13	T	95.1	Very high	88.8	Confident	80 Å²	80	104.9 Å²	104.9	49%	0.491	56%	0.557	S	S	.	*	H	α-helix	trans	-63.7	-42.4	178.6	-58.6	0	0	0	0	111.2	V9 Q10 D11 V15 V16 Q17	V9-T13 PolarHBondContact O-N 3.39Å; V9-T13 PolarHBondContact O-OG1 3.37Å; Q10-T13 WeakPolarHBondContact O-CB 3.28Å; Q10-T13 PolarHBondContact O-N 2.87Å; Q10-T13 VanDerWaalsContact O-N 3.14Å; D11-T13 VanDerWaalsContact C-N 3.31Å; D11-T13 PolarHBondContact O-N 3.45Å; T13-V15 VanDerWaalsContact C-N 3.34Å; T13-V15 PolarHBondContact O-N 2.74Å; T13-V16 PolarHBondContact O-N 3.47Å; T13-Q17 WeakPolarHBondContact O-CB 3.29Å; T13-Q17 PolarHBondContact O-N 3.03Å
14	N	96	Very high	90.8	Very high	86 Å²	86	101.7 Å²	101.7	46%	0.46	54%	0.542	S	S	.	.	H	α-helix	trans	-62.3	-40.8	176.1	-68.4	-27.8	0	0	0	112	Q10 D11 Q17 T18	Q10-N14 VanDerWaalsContact O-CG 3.3Å; Q10-N14 PolarHBondContact O-N 3.32Å; Q10-N14 PolarHBondContact O-ND2 3.49Å; D11-N14 PolarHBondContact O-N 2.83Å; N14-Q17 PolarHBondContact O-N 3.08Å; N14-T18 WeakPolarHBondContact O-CB 3.39Å; N14-T18 PolarHBondContact O-N 3.36Å; N14-T18 PolarHBondContact O-OG1 2.91Å
15	V	96.1	Very high	92.3	Very high	80 Å²	80	100.2 Å²	100.2	49%	0.485	53%	0.53	S	S	.	.	H	α-helix	trans	-63.2	-48	175.6	171.5	0	0	0	0	110.7	D11 L12 T13 Q17 T18 L19	D11-V15 WeakPolarHBondContact O-CG2 3.49Å; D11-V15 PolarHBondContact O-N 2.88Å; L12-V15 PolarHBondContact O-N 2.79Å; T13-V15 VanDerWaalsContact C-N 3.34Å; T13-V15 PolarHBondContact O-N 2.74Å; V15-Q17 VanDerWaalsContact C-N 3.33Å; V15-Q17 PolarHBondContact O-N 2.75Å; V15-T18 PolarHBondContact O-N 3.01Å; V15-L19 HydrophobicContact CG1-CD1 4.1Å; V15-L19 WeakPolarHBondContact O-CD1 3.45Å; V15-L19 PolarHBondContact O-N 3.01Å
16	V	97.1	Very high	93.5	Very high	71 Å²	71	102.4 Å²	102.4	43%	0.43	54%	0.535	S	S	.	.	H	α-helix	trans	-60.9	-44.1	178.3	172.3	0	0	0	0	110.9	L12 T13 T18 L19 L20	L12-V16 HydrophobicContact CD1-CG2 4.44Å; L12-V16 WeakPolarHBondContact O-CG2 3.48Å; L12-V16 PolarHBondContact O-N 2.98Å; T13-V16 PolarHBondContact O-N 3.47Å; V16-T18 VanDerWaalsContact C-N 3.33Å; V16-T18 PolarHBondContact O-N 2.94Å; V16-L19 PolarHBondContact O-N 3.25Å; V16-L20 HydrophobicContact CG1-CD1 4.01Å; V16-L20 HydrophobicContact CG1-CG 4.37Å; V16-L20 WeakPolarHBondContact O-CG 3.32Å; V16-L20 PolarHBondContact O-N 3.31Å
17	Q	97.4	Very high	94.8	Very high	130 Å²	130	104.8 Å²	104.8	61%	0.607	54%	0.537	S	S	*	.	H	α-helix	trans	-61.5	-42.5	178	-171.5	169.9	24.5	0	0	111.8	T13 N14 V15 L20 Q21	T13-Q17 WeakPolarHBondContact O-CB 3.29Å; T13-Q17 PolarHBondContact O-N 3.03Å; N14-Q17 PolarHBondContact O-N 3.08Å; V15-Q17 VanDerWaalsContact C-N 3.33Å; V15-Q17 PolarHBondContact O-N 2.75Å; Q17-L20 PolarHBondContact O-N 3.01Å; Q17-Q21 PolarHBondContact O-N 3.43Å
18	T	97.8	Very high	95.9	Very high	76 Å²	76	102.5 Å²	102.5	47%	0.466	53%	0.528	S	S	.	.	H	α-helix	trans	-62.9	-43.1	176.3	-56.7	0	0	0	0	111.5	N14 V15 V16 Q21 Q22	N14-T18 WeakPolarHBondContact O-CB 3.39Å; N14-T18 PolarHBondContact O-N 3.36Å; N14-T18 PolarHBondContact O-OG1 2.91Å; V15-T18 PolarHBondContact O-N 3.01Å; V16-T18 VanDerWaalsContact C-N 3.33Å; V16-T18 PolarHBondContact O-N 2.94Å; T18-Q21 PolarHBondContact O-N 3.35Å; T18-Q22 WeakPolarHBondContact O-CG 3.32Å; T18-Q22 PolarHBondContact O-N 2.93Å
19	L	98	Very high	96.6	Very high	99 Å²	99	102.5 Å²	102.5	52%	0.518	53%	0.525	S	S	.	.	H	α-helix	trans	-63.8	-42.9	177.7	-101.2	68.2	0	0	0	112.2	V15 V16 Q21 Q22 M23	V15-L19 HydrophobicContact CG1-CD1 4.1Å; V15-L19 WeakPolarHBondContact O-CD1 3.45Å; V15-L19 PolarHBondContact O-N 3.01Å; V16-L19 PolarHBondContact O-N 3.25Å; L19-Q21 VanDerWaalsContact C-N 3.34Å; L19-Q22 PolarHBondContact O-N 2.88Å; L19-M23 PolarHBondContact O-N 3.13Å
20	L	98.3	Very high	97	Very high	108 Å²	108	103.4 Å²	103.4	57%	0.565	53%	0.526	S	S	*	.	H	α-helix	trans	-64.3	-41.1	177.7	-71	175.4	0	0	0	111.2	V16 Q17 M23 Q24	V16-L20 HydrophobicContact CG1-CD1 4.01Å; V16-L20 HydrophobicContact CG1-CG 4.37Å; V16-L20 WeakPolarHBondContact O-CG 3.32Å; V16-L20 PolarHBondContact O-N 3.31Å; Q17-L20 PolarHBondContact O-N 3.01Å; L20-M23 PolarHBondContact O-N 3.12Å; L20-Q24 PolarHBondContact O-N 3.44Å
21	Q	98.3	Very high	97.4	Very high	93 Å²	93	99 Å²	99	44%	0.435	51%	0.508	S	S	.	.	H	α-helix	trans	-61.3	-47.3	174.9	-170.1	62.4	56	0	0	111.2	Q17 T18 L19 M23 Q24 D25	Q17-Q21 PolarHBondContact O-N 3.43Å; T18-Q21 PolarHBondContact O-N 3.35Å; L19-Q21 VanDerWaalsContact C-N 3.34Å; Q21-M23 VanDerWaalsContact C-N 3.3Å; Q21-M23 PolarHBondContact O-N 2.82Å; Q21-Q24 WeakPolarHBondContact O-CB 3.36Å; Q21-Q24 PolarHBondContact O-N 2.83Å; Q21-Q24 VanDerWaalsContact O-N 3.11Å; Q21-D25 PolarHBondContact NE2-OD1 2.98Å; Q21-D25 PolarHBondContact O-N 3.49Å
22	Q	98.1	Very high	97.6	Very high	118 Å²	118	98.2 Å²	98.2	55%	0.551	50%	0.504	S	S	*	.	H	α-helix	trans	-60.3	-38.5	177.2	-73.7	177.1	-14.2	0	0	112.7	T18 L19 K26	T18-Q22 WeakPolarHBondContact O-CG 3.32Å; T18-Q22 PolarHBondContact O-N 2.93Å; L19-Q22 PolarHBondContact O-N 2.88Å; Q22-K26 WeakPolarHBondContact O-CB 3.45Å; Q22-K26 PolarHBondContact O-N 3.31Å
23	M	97.9	Very high	97.8	Very high	143 Å²	143	98.7 Å²	98.7	70%	0.704	50%	0.503	S	S	*	.	H	α-helix	trans	-64.1	-44.2	173.9	-87.5	-166.6	172	0	0	111.8	L19 L20 Q21 K26 F27	L19-M23 PolarHBondContact O-N 3.13Å; L20-M23 PolarHBondContact O-N 3.12Å; Q21-M23 VanDerWaalsContact C-N 3.3Å; Q21-M23 PolarHBondContact O-N 2.82Å; M23-K26 PolarHBondContact O-N 3.27Å; M23-F27 WeakPolarHBondContact O-CB 3.37Å; M23-F27 PolarHBondContact O-N 3.48Å
24	Q	98.4	Very high	98	Very high	121 Å²	121	99.9 Å²	99.9	57%	0.565	51%	0.505	S	S	*	.	H	α-helix	trans	-62.2	-47.7	178.2	-172.9	174.3	23.8	0	0	111.2	L20 Q21 K26 F27 Q28	L20-Q24 PolarHBondContact O-N 3.44Å; Q21-Q24 WeakPolarHBondContact O-CB 3.36Å; Q21-Q24 PolarHBondContact O-N 2.83Å; Q21-Q24 VanDerWaalsContact O-N 3.11Å; Q24-K26 VanDerWaalsContact C-N 3.29Å; Q24-K26 PolarHBondContact O-N 3.37Å; Q24-F27 PolarHBondContact O-N 2.95Å; Q24-Q28 WeakPolarHBondContact O-CB 3.32Å; Q24-Q28 PolarHBondContact O-N 3.05Å
25	D	98.6	Very high	98.1	Very high	84 Å²	84	100 Å²	100	45%	0.449	51%	0.505	S	S	.	.	H	α-helix	trans	-60.8	-40.8	179.5	-63.5	-13.1	0	0	0	111.2	Q21 Q28 T29	Q21-D25 PolarHBondContact NE2-OD1 2.98Å; Q21-D25 PolarHBondContact O-N 3.49Å; D25-Q28 PolarHBondContact O-N 2.95Å; D25-T29 WeakPolarHBondContact O-CB 3.48Å; D25-T29 PolarHBondContact O-N 3.31Å; D25-T29 PolarHBondContact O-OG1 3.14Å
26	K	98.3	Very high	98.2	Very high	136 Å²	136	97.5 Å²	97.5	59%	0.591	50%	0.495	S	S	*	.	H	α-helix	trans	-67.1	-42	177.1	-169.1	177.5	-174	-172.3	0	111.9	Q22 M23 Q24 T29 M30	Q22-K26 WeakPolarHBondContact O-CB 3.45Å; Q22-K26 PolarHBondContact O-N 3.31Å; M23-K26 PolarHBondContact O-N 3.27Å; Q24-K26 VanDerWaalsContact C-N 3.29Å; Q24-K26 PolarHBondContact O-N 3.37Å; K26-T29 PolarHBondContact O-N 2.98Å; K26-M30 HydrophobicContact CD-CE 4.34Å; K26-M30 HydrophobicContact CG-CE 4.09Å; K26-M30 WeakPolarHBondContact O-CG 3.48Å; K26-M30 PolarHBondContact O-N 2.92Å
27	F	98.4	Very high	98.3	Very high	143 Å²	143	102.5 Å²	102.5	63%	0.627	51%	0.507	S	S	*	.	H	α-helix	trans	-66.3	-40.8	177.2	-174.2	-95.1	0	0	0	111.7	M23 Q24 M30 S31	M23-F27 WeakPolarHBondContact O-CB 3.37Å; M23-F27 PolarHBondContact O-N 3.48Å; Q24-F27 PolarHBondContact O-N 2.95Å; F27-M30 PolarHBondContact O-N 3.48Å; F27-S31 WeakPolarHBondContact CE1-OG 3.42Å; F27-S31 WeakPolarHBondContact O-CB 3.26Å; F27-S31 PolarHBondContact O-N 3.47Å; F27-S31 PolarHBondContact O-OG 3.06Å
28	Q	98.6	Very high	98.4	Very high	99 Å²	99	101 Å²	101	46%	0.463	50%	0.502	S	S	.	.	H	α-helix	trans	-61.5	-48.9	175	-170.8	62.4	50.3	0	0	110.6	Q24 D25 M30 S31 D32	Q24-Q28 WeakPolarHBondContact O-CB 3.32Å; Q24-Q28 PolarHBondContact O-N 3.05Å; D25-Q28 PolarHBondContact O-N 2.95Å; Q28-M30 VanDerWaalsContact C-N 3.31Å; Q28-M30 PolarHBondContact O-N 2.96Å; Q28-S31 WeakPolarHBondContact O-CA 3.41Å; Q28-S31 WeakPolarHBondContact O-CB 3.45Å; Q28-S31 PolarHBondContact O-N 3Å; Q28-D32 PolarHBondContact NE2-OD1 2.9Å; Q28-D32 PolarHBondContact O-N 3.42Å
29	T	98.4	Very high	98.4	Very high	77 Å²	77	101.9 Å²	101.9	47%	0.472	50%	0.504	S	S	.	.	H	α-helix	trans	-57.5	-43.4	177.4	-57.1	0	0	0	0	112	D25 K26 Q33	D25-T29 WeakPolarHBondContact O-CB 3.48Å; D25-T29 PolarHBondContact O-N 3.31Å; D25-T29 PolarHBondContact O-OG1 3.14Å; K26-T29 PolarHBondContact O-N 2.98Å; T29-Q33 WeakPolarHBondContact O-CG 3.47Å; T29-Q33 PolarHBondContact O-N 2.79Å; T29-Q33 VanDerWaalsContact O-N 3.14Å
30	M	98.3	Very high	98.4	Very high	94 Å²	94	102.7 Å²	102.7	46%	0.463	51%	0.505	S	S	.	.	H	α-helix	trans	-65.1	-40.3	175.7	-74.8	-178.3	-176	0	0	112	K26 F27 Q28 Q33 I34	K26-M30 HydrophobicContact CD-CE 4.34Å; K26-M30 HydrophobicContact CG-CE 4.09Å; K26-M30 WeakPolarHBondContact O-CG 3.48Å; K26-M30 PolarHBondContact O-N 2.92Å; F27-M30 PolarHBondContact O-N 3.48Å; Q28-M30 VanDerWaalsContact C-N 3.31Å; Q28-M30 PolarHBondContact O-N 2.96Å; M30-Q33 PolarHBondContact O-N 3.16Å; M30-I34 WeakPolarHBondContact O-CG1 3.48Å; M30-I34 PolarHBondContact O-N 2.98Å
31	S	98.4	Very high	98.4	Very high	29 Å²	29	103.2 Å²	103.2	20%	0.203	51%	0.506	C	S	.	.	H	α-helix	trans	-63.4	-45	178.1	-59.4	0	0	0	0	111.1	F27 Q28 Q33 I34 I35	F27-S31 WeakPolarHBondContact CE1-OG 3.42Å; F27-S31 WeakPolarHBondContact O-CB 3.26Å; F27-S31 PolarHBondContact O-N 3.47Å; F27-S31 PolarHBondContact O-OG 3.06Å; Q28-S31 WeakPolarHBondContact O-CA 3.41Å; Q28-S31 WeakPolarHBondContact O-CB 3.45Å; Q28-S31 PolarHBondContact O-N 3Å; S31-Q33 VanDerWaalsContact C-N 3.3Å; S31-Q33 PolarHBondContact O-N 2.98Å; S31-I34 PolarHBondContact O-N 3.26Å; S31-I34 VanDerWaalsContact O-N 3.12Å; S31-I35 WeakPolarHBondContact O-CG1 3.46Å; S31-I35 PolarHBondContact O-N 3.1Å
32	D	98.6	Very high	98.4	Very high	84 Å²	84	101.5 Å²	101.5	45%	0.449	50%	0.504	S	S	.	.	H	α-helix	trans	-61.7	-38.6	178	-61.7	-18.4	0	0	0	111.4	Q28 I35 G36	Q28-D32 PolarHBondContact NE2-OD1 2.9Å; Q28-D32 PolarHBondContact O-N 3.42Å; D32-I35 PolarHBondContact O-N 2.85Å; D32-G36 PolarHBondContact O-N 3.03Å
33	Q	98.6	Very high	98.5	Very high	122 Å²	122	99.7 Å²	99.7	57%	0.57	50%	0.501	S	S	*	.	H	α-helix	trans	-65.2	-38.7	174.2	-74	178.7	-6.3	0	0	113	T29 M30 S31 R37	T29-Q33 WeakPolarHBondContact O-CG 3.47Å; T29-Q33 PolarHBondContact O-N 2.79Å; T29-Q33 VanDerWaalsContact O-N 3.14Å; M30-Q33 PolarHBondContact O-N 3.16Å; S31-Q33 VanDerWaalsContact C-N 3.3Å; S31-Q33 PolarHBondContact O-N 2.98Å; Q33-R37 WeakPolarHBondContact O-CG 3.41Å; Q33-R37 PolarHBondContact O-N 3.01Å; Q33-R37 VanDerWaalsContact O-N 3.14Å
34	I	98.4	Very high	98.5	Very high	104 Å²	104	100.8 Å²	100.8	53%	0.533	50%	0.497	S	S	.	.	H	α-helix	trans	-67.1	-46	177.1	-70	166.9	0	0	0	109.9	M30 S31 G36 R37 I38	M30-I34 WeakPolarHBondContact O-CG1 3.48Å; M30-I34 PolarHBondContact O-N 2.98Å; S31-I34 PolarHBondContact O-N 3.26Å; S31-I34 VanDerWaalsContact O-N 3.12Å; I34-G36 VanDerWaalsContact C-N 3.35Å; I34-G36 PolarHBondContact O-N 3.31Å; I34-R37 PolarHBondContact O-N 3.46Å; I34-I38 HydrophobicContact CG2-CD1 3.9Å; I34-I38 WeakPolarHBondContact O-CG1 3.31Å; I34-I38 PolarHBondContact O-N 3.12Å
35	I	98.4	Very high	98.5	Very high	88 Å²	88	99 Å²	99	45%	0.451	49%	0.491	S	S	.	.	H	α-helix	trans	-59.3	-47.5	177.2	-66.6	165.8	0	0	0	110	S31 D32 R37 I38 D39	S31-I35 WeakPolarHBondContact O-CG1 3.46Å; S31-I35 PolarHBondContact O-N 3.1Å; D32-I35 PolarHBondContact O-N 2.85Å; I35-R37 VanDerWaalsContact C-N 3.28Å; I35-R37 PolarHBondContact O-N 2.85Å; I35-I38 WeakPolarHBondContact O-CA 3.49Å; I35-I38 WeakPolarHBondContact O-CB 3.42Å; I35-I38 PolarHBondContact O-N 3.07Å; I35-D39 PolarHBondContact O-N 3.36Å
36	G	98.7	Very high	98.5	Very high	28 Å²	28	99.2 Å²	99.2	29%	0.289	49%	0.492	S	S	.	.	H	α-helix	trans	-57.8	-39.1	177.5	0	0	0	0	0	113.3	D32 I34 D39 E40	D32-G36 PolarHBondContact O-N 3.03Å; I34-G36 VanDerWaalsContact C-N 3.35Å; I34-G36 PolarHBondContact O-N 3.31Å; G36-D39 PolarHBondContact O-N 3.14Å; G36-E40 WeakPolarHBondContact O-CG 3.37Å; G36-E40 PolarHBondContact O-N 2.89Å
37	R	98.5	Very high	98.5	Very high	176 Å²	176	97 Å²	97	66%	0.664	49%	0.487	S	S	*	.	H	α-helix	trans	-67.2	-36.1	174.2	-73.2	178.4	177.6	-162.5	0.3	112.9	Q33 I34 I35 M41	Q33-R37 WeakPolarHBondContact O-CG 3.41Å; Q33-R37 PolarHBondContact O-N 3.01Å; Q33-R37 VanDerWaalsContact O-N 3.14Å; I34-R37 PolarHBondContact O-N 3.46Å; I35-R37 VanDerWaalsContact C-N 3.28Å; I35-R37 PolarHBondContact O-N 2.85Å; R37-M41 WeakPolarHBondContact O-CB 3.36Å; R37-M41 VanDerWaalsContact O-CG 3.31Å; R37-M41 WeakPolarHBondContact O-CG 3.4Å; R37-M41 PolarHBondContact O-N 2.92Å
38	I	98.6	Very high	98.5	Very high	98 Å²	98	95.2 Å²	95.2	50%	0.503	48%	0.483	S	S	.	.	H	α-helix	trans	-66	-43.4	176.2	-69.3	167	0	0	0	109.9	I34 I35 E40 M41 S42	I34-I38 HydrophobicContact CG2-CD1 3.9Å; I34-I38 WeakPolarHBondContact O-CG1 3.31Å; I34-I38 PolarHBondContact O-N 3.12Å; I35-I38 WeakPolarHBondContact O-CA 3.49Å; I35-I38 WeakPolarHBondContact O-CB 3.42Å; I35-I38 PolarHBondContact O-N 3.07Å; I38-E40 PolarHBondContact O-N 3.06Å; I38-M41 CarbonylContact O-C 3.59Å; I38-M41 PolarHBondContact O-N 3.14Å; I38-M41 VanDerWaalsContact O-N 3.16Å; I38-S42 PolarHBondContact O-N 3.37Å
39	D	98.4	Very high	98.4	Very high	95 Å²	95	96.4 Å²	96.4	51%	0.508	49%	0.489	S	S	.	.	H	α-helix	trans	-62.8	-42.3	178.1	-64.6	-21.8	0	0	0	111.6	I35 G36 S42 T43	I35-D39 PolarHBondContact O-N 3.36Å; G36-D39 PolarHBondContact O-N 3.14Å; D39-S42 WeakPolarHBondContact O-CB 3.35Å; D39-S42 PolarHBondContact O-N 3.22Å; D39-T43 PolarHBondContact O-N 2.78Å; D39-T43 PolarHBondContact O-OG1 3.01Å
40	E	98.6	Very high	98.4	Very high	116 Å²	116	99.2 Å²	99.2	54%	0.542	49%	0.494	S	S	.	.	H	α-helix	trans	-61.1	-42.9	172.5	-75	178.5	-157.7	0	0	112.1	G36 I38 T43 R44	G36-E40 WeakPolarHBondContact O-CG 3.37Å; G36-E40 PolarHBondContact O-N 2.89Å; I38-E40 PolarHBondContact O-N 3.06Å; E40-T43 PolarHBondContact O-N 3.4Å; E40-R44 WeakPolarHBondContact O-CG 3.41Å; E40-R44 PolarHBondContact O-N 3.36Å; E40-R44 VanDerWaalsContact O-N 3.12Å
41	M	98.6	Very high	98.3	Very high	120 Å²	120	99.1 Å²	99.1	59%	0.591	50%	0.496	S	S	*	.	H	α-helix	trans	-65.3	-40.3	176	-76.1	179.9	63.3	0	0	111.7	R37 I38 R44 I45	R37-M41 WeakPolarHBondContact O-CB 3.36Å; R37-M41 VanDerWaalsContact O-CG 3.31Å; R37-M41 WeakPolarHBondContact O-CG 3.4Å; R37-M41 PolarHBondContact O-N 2.92Å; I38-M41 CarbonylContact O-C 3.59Å; I38-M41 PolarHBondContact O-N 3.14Å; I38-M41 VanDerWaalsContact O-N 3.16Å; M41-R44 PolarHBondContact O-N 3.37Å; M41-I45 VanDerWaalsContact O-CG1 3.32Å; M41-I45 WeakPolarHBondContact O-CG1 3.49Å; M41-I45 PolarHBondContact O-N 2.83Å
42	S	98.4	Very high	98.2	Very high	57 Å²	57	102.4 Å²	102.4	40%	0.399	51%	0.51	S	S	.	.	H	α-helix	trans	-59	-48.8	176	-167	0	0	0	0	110.6	I38 D39 R44 I45 D46	I38-S42 PolarHBondContact O-N 3.37Å; D39-S42 WeakPolarHBondContact O-CB 3.35Å; D39-S42 PolarHBondContact O-N 3.22Å; S42-R44 VanDerWaalsContact C-N 3.29Å; S42-R44 PolarHBondContact O-N 3.47Å; S42-I45 WeakPolarHBondContact O-CB 3.41Å; S42-I45 PolarHBondContact O-N 2.93Å; S42-D46 VanDerWaalsContact O-CG 3.3Å; S42-D46 PolarHBondContact O-N 3.49Å
43	T	98.6	Very high	97.9	Very high	79 Å²	79	100.7 Å²	100.7	49%	0.485	51%	0.508	S	S	.	.	H	α-helix	trans	-58.7	-42	178.1	-53.6	0	0	0	0	111.6	D39 E40 I45 D46 D47	D39-T43 PolarHBondContact O-N 2.78Å; D39-T43 PolarHBondContact O-OG1 3.01Å; E40-T43 PolarHBondContact O-N 3.4Å; T43-I45 VanDerWaalsContact C-N 3.33Å; T43-I45 PolarHBondContact O-N 2.88Å; T43-D46 PolarHBondContact O-N 2.89Å; T43-D47 PolarHBondContact O-N 3.36Å
44	R	98.6	Very high	97.8	Very high	166 Å²	166	98.5 Å²	98.5	63%	0.626	50%	0.5	S	S	*	.	H	α-helix	trans	-67.1	-33.6	176.9	-71.1	177.1	-173.4	-168.5	5.7	112.8	E40 M41 S42 L48	E40-R44 WeakPolarHBondContact O-CG 3.41Å; E40-R44 PolarHBondContact O-N 3.36Å; E40-R44 VanDerWaalsContact O-N 3.12Å; M41-R44 PolarHBondContact O-N 3.37Å; S42-R44 VanDerWaalsContact C-N 3.29Å; S42-R44 PolarHBondContact O-N 3.47Å; R44-L48 WeakPolarHBondContact O-CB 3.42Å; R44-L48 VanDerWaalsContact O-CG 3.26Å; R44-L48 WeakPolarHBondContact O-CG 3.41Å; R44-L48 PolarHBondContact O-N 2.95Å
45	I	98.6	Very high	97.6	Very high	84 Å²	84	98.7 Å²	98.7	43%	0.431	50%	0.501	S	S	.	.	H	α-helix	trans	-66.6	-47.3	174.9	-70.9	164.8	0	0	0	109.4	M41 S42 T43 D47 L48 E49	M41-I45 VanDerWaalsContact O-CG1 3.32Å; M41-I45 WeakPolarHBondContact O-CG1 3.49Å; M41-I45 PolarHBondContact O-N 2.83Å; S42-I45 WeakPolarHBondContact O-CB 3.41Å; S42-I45 PolarHBondContact O-N 2.93Å; T43-I45 VanDerWaalsContact C-N 3.33Å; T43-I45 PolarHBondContact O-N 2.88Å; I45-D47 VanDerWaalsContact C-N 3.28Å; I45-D47 PolarHBondContact O-N 3.11Å; I45-L48 CarbonylContact O-C 3.58Å; I45-L48 WeakPolarHBondContact O-CA 3.36Å; I45-L48 WeakPolarHBondContact O-CB 3.49Å; I45-L48 PolarHBondContact O-N 3.3Å; I45-E49 HydrophobicContact CG2-CG 4.25Å; I45-E49 WeakPolarHBondContact O-CG 3.33Å; I45-E49 PolarHBondContact O-N 2.92Å
46	D	98.1	Very high	97.2	Very high	88 Å²	88	98.6 Å²	98.6	47%	0.471	50%	0.5	S	S	.	.	H	α-helix	trans	-57	-43.2	177.5	-60.6	-25	0	0	0	111.3	S42 T43 E49 K50	S42-D46 VanDerWaalsContact O-CG 3.3Å; S42-D46 PolarHBondContact O-N 3.49Å; T43-D46 PolarHBondContact O-N 2.89Å; D46-E49 PolarHBondContact O-N 2.81Å; D46-K50 WeakPolarHBondContact O-CB 3.45Å; D46-K50 PolarHBondContact O-N 2.97Å
47	D	98.4	Very high	96.9	Very high	90 Å²	90	102.6 Å²	102.6	48%	0.481	52%	0.519	S	S	.	.	H	α-helix	trans	-63.1	-41.8	175	-75.2	-24.3	0	0	0	112	T43 I45 K50 N51	T43-D47 PolarHBondContact O-N 3.36Å; I45-D47 VanDerWaalsContact C-N 3.28Å; I45-D47 PolarHBondContact O-N 3.11Å; D47-K50 PolarHBondContact O-N 3.34Å; D47-N51 PolarHBondContact O-N 3.38Å; D47-N51 PolarHBondContact O-ND2 2.82Å
48	L	98.4	Very high	96.5	Very high	106 Å²	106	101.7 Å²	101.7	56%	0.555	52%	0.522	S	S	*	.	H	α-helix	trans	-65.8	-43.4	177.2	-76.9	171.5	0	0	0	111.9	R44 I45 K50 N51 I52	R44-L48 WeakPolarHBondContact O-CB 3.42Å; R44-L48 VanDerWaalsContact O-CG 3.26Å; R44-L48 WeakPolarHBondContact O-CG 3.41Å; R44-L48 PolarHBondContact O-N 2.95Å; I45-L48 CarbonylContact O-C 3.58Å; I45-L48 WeakPolarHBondContact O-CA 3.36Å; I45-L48 WeakPolarHBondContact O-CB 3.49Å; I45-L48 PolarHBondContact O-N 3.3Å; L48-K50 VanDerWaalsContact C-N 3.3Å; L48-K50 PolarHBondContact O-N 3.19Å; L48-N51 PolarHBondContact O-N 2.95Å; L48-I52 VanDerWaalsContact O-CG1 3.29Å; L48-I52 WeakPolarHBondContact O-CG1 3.32Å; L48-I52 PolarHBondContact O-N 3.26Å
49	E	97.1	Very high	96	Very high	123 Å²	123	100.5 Å²	100.5	58%	0.575	53%	0.527	S	S	*	.	H	α-helix	trans	-58.9	-44.2	176.2	-72.6	-177.8	166.4	0	0	110.9	I45 D46 I52 A53	I45-E49 HydrophobicContact CG2-CG 4.25Å; I45-E49 WeakPolarHBondContact O-CG 3.33Å; I45-E49 PolarHBondContact O-N 2.92Å; D46-E49 PolarHBondContact O-N 2.81Å; E49-I52 PolarHBondContact O-N 3.44Å; E49-A53 WeakPolarHBondContact O-CB 3.41Å; E49-A53 PolarHBondContact O-N 2.95Å
50	K	97.3	Very high	95.1	Very high	136 Å²	136	98.8 Å²	98.8	59%	0.591	53%	0.532	S	S	*	.	H	α-helix	trans	-61.6	-48	174.8	-177.2	175.1	179.3	170.3	0	112.4	D46 D47 L48 I52 A53 D54	D46-K50 WeakPolarHBondContact O-CB 3.45Å; D46-K50 PolarHBondContact O-N 2.97Å; D47-K50 PolarHBondContact O-N 3.34Å; L48-K50 VanDerWaalsContact C-N 3.3Å; L48-K50 PolarHBondContact O-N 3.19Å; K50-I52 VanDerWaalsContact C-N 3.28Å; K50-I52 PolarHBondContact O-N 3.39Å; K50-A53 PolarHBondContact O-N 2.98Å; K50-D54 PolarHBondContact O-N 3.3Å
51	N	96.8	Very high	93.7	Very high	93 Å²	93	96.7 Å²	96.7	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-61.3	-37.8	178.9	-78.5	-65.4	0	0	0	111.9	D47 L48 L55	D47-N51 PolarHBondContact O-N 3.38Å; D47-N51 PolarHBondContact O-ND2 2.82Å; L48-N51 PolarHBondContact O-N 2.95Å; N51-L55 WeakPolarHBondContact O-CB 3.46Å; N51-L55 WeakPolarHBondContact O-CD1 3.35Å; N51-L55 VanDerWaalsContact O-CG 3.32Å; N51-L55 WeakPolarHBondContact O-CG 3.4Å; N51-L55 PolarHBondContact O-N 2.96Å
52	I	95.8	Very high	92	Very high	97 Å²	97	99.3 Å²	99.3	50%	0.497	54%	0.538	S	S	.	.	H	α-helix	trans	-66.6	-45.5	175.7	-69.5	166.8	0	0	0	110.6	L48 E49 K50 D54 L55 M56	L48-I52 VanDerWaalsContact O-CG1 3.29Å; L48-I52 WeakPolarHBondContact O-CG1 3.32Å; L48-I52 PolarHBondContact O-N 3.26Å; E49-I52 PolarHBondContact O-N 3.44Å; K50-I52 VanDerWaalsContact C-N 3.28Å; K50-I52 PolarHBondContact O-N 3.39Å; I52-D54 VanDerWaalsContact C-N 3.32Å; I52-D54 PolarHBondContact O-N 3.46Å; I52-L55 PolarHBondContact O-N 3.46Å; I52-M56 HydrophobicContact CG2-CG 4.25Å; I52-M56 HydrophobicContact CG2-SD 4.08Å; I52-M56 WeakPolarHBondContact O-CG 3.41Å; I52-M56 PolarHBondContact O-N 3.26Å
53	A	93.9	Very high	90.1	Very high	49 Å²	49	104.6 Å²	104.6	41%	0.405	56%	0.556	S	S	.	*	H	α-helix	trans	-59.5	-43.2	177.2	0	0	0	0	0	111.9	E49 K50 M56 T57	E49-A53 WeakPolarHBondContact O-CB 3.41Å; E49-A53 PolarHBondContact O-N 2.95Å; K50-A53 PolarHBondContact O-N 2.98Å; A53-M56 PolarHBondContact O-N 3.31Å; A53-T57 WeakPolarHBondContact O-CB 3.36Å; A53-T57 PolarHBondContact O-N 3.44Å; A53-T57 PolarHBondContact O-OG1 2.96Å
54	D	95.1	Very high	88.1	Confident	76 Å²	76	108.2 Å²	108.2	41%	0.406	57%	0.571	S	S	.	*	H	α-helix	trans	-63	-42.8	175.7	-72.2	-19.3	0	0	0	111.3	K50 I52 T57 Q58	K50-D54 PolarHBondContact O-N 3.3Å; I52-D54 VanDerWaalsContact C-N 3.32Å; I52-D54 PolarHBondContact O-N 3.46Å; D54-T57 PolarHBondContact O-N 2.88Å; D54-Q58 WeakPolarHBondContact O-CB 3.28Å; D54-Q58 VanDerWaalsContact O-CG 3.26Å; D54-Q58 WeakPolarHBondContact O-CG 3.38Å; D54-Q58 PolarHBondContact O-N 3.02Å
55	L	94.8	Very high	85.9	Confident	107 Å²	107	108.1 Å²	108.1	56%	0.56	58%	0.578	S	S	*	*	H	α-helix	trans	-64.9	-44.4	176.5	-81.2	163.1	0	0	0	112.6	N51 I52 T57 Q58 A59	N51-L55 WeakPolarHBondContact O-CB 3.46Å; N51-L55 WeakPolarHBondContact O-CD1 3.35Å; N51-L55 VanDerWaalsContact O-CG 3.32Å; N51-L55 WeakPolarHBondContact O-CG 3.4Å; N51-L55 PolarHBondContact O-N 2.96Å; I52-L55 PolarHBondContact O-N 3.46Å; L55-T57 VanDerWaalsContact C-N 3.32Å; L55-T57 PolarHBondContact O-N 2.94Å; L55-Q58 PolarHBondContact O-N 3.42Å; L55-A59 VanDerWaalsContact O-CB 3.28Å; L55-A59 WeakPolarHBondContact O-CB 3.36Å; L55-A59 PolarHBondContact O-N 3.31Å
56	M	90.2	Very high	83.8	Confident	86 Å²	86	108.7 Å²	108.7	42%	0.424	60%	0.595	S	S	.	*	H	α-helix	trans	-61.9	-42.3	176.9	-72.6	-173.5	73.4	0	0	111.1	I52 A53 A59 G60 V61	I52-M56 HydrophobicContact CG2-CG 4.25Å; I52-M56 HydrophobicContact CG2-SD 4.08Å; I52-M56 WeakPolarHBondContact O-CG 3.41Å; I52-M56 PolarHBondContact O-N 3.26Å; A53-M56 PolarHBondContact O-N 3.31Å; M56-A59 PolarHBondContact O-N 2.85Å; M56-G60 PolarHBondContact O-N 2.93Å; M56-V61 HydrophobicContact CE-CG1 4.03Å; M56-V61 PolarHBondContact O-N 2.94Å; M56-V61 VanDerWaalsContact O-N 3.08Å
57	T	91.2	Very high	81.7	Confident	112 Å²	112	108.3 Å²	108.3	69%	0.687	60%	0.604	S	S	*	*	H	α-helix	trans	-62.2	-46.5	175.2	-56.2	0	0	0	0	111.3	A53 D54 L55 A59 G60	A53-T57 WeakPolarHBondContact O-CB 3.36Å; A53-T57 PolarHBondContact O-N 3.44Å; A53-T57 PolarHBondContact O-OG1 2.96Å; D54-T57 PolarHBondContact O-N 2.88Å; L55-T57 VanDerWaalsContact C-N 3.32Å; L55-T57 PolarHBondContact O-N 2.94Å; T57-A59 VanDerWaalsContact C-N 3.35Å; T57-A59 PolarHBondContact O-N 3.31Å; T57-G60 PolarHBondContact O-N 3.24Å; T57-G60 VanDerWaalsContact O-N 3.17Å
58	Q	90.7	Very high	79.7	Confident	157 Å²	157	109.7 Å²	109.7	73%	0.734	62%	0.618	S	S	*	*	H	α-helix	trans	-65.5	-35.6	177.9	-75.2	173.1	40.3	0	0	113.2	D54 L55 G60	D54-Q58 WeakPolarHBondContact O-CB 3.28Å; D54-Q58 VanDerWaalsContact O-CG 3.26Å; D54-Q58 WeakPolarHBondContact O-CG 3.38Å; D54-Q58 PolarHBondContact O-N 3.02Å; L55-Q58 PolarHBondContact O-N 3.42Å; Q58-G60 PolarHBondContact O-N 3.15Å
59	A	88.7	Confident	78	Confident	73 Å²	73	113.5 Å²	113.5	60%	0.603	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.1	-5.8	177	0	0	0	0	0	113	L55 M56 T57 V61	L55-A59 VanDerWaalsContact O-CB 3.28Å; L55-A59 WeakPolarHBondContact O-CB 3.36Å; L55-A59 PolarHBondContact O-N 3.31Å; M56-A59 PolarHBondContact O-N 2.85Å; T57-A59 VanDerWaalsContact C-N 3.35Å; T57-A59 PolarHBondContact O-N 3.31Å; A59-V61 HydrophobicContact CB-CG2 3.87Å; A59-V61 PolarHBondContact O-N 3.12Å
60	G	78.6	Confident	76.3	Confident	59 Å²	59	116.4 Å²	116.4	61%	0.608	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	66	24	-177.1	0	0	0	0	0	112.9	M56 T57 Q58 E62	M56-G60 PolarHBondContact O-N 2.93Å; T57-G60 PolarHBondContact O-N 3.24Å; T57-G60 VanDerWaalsContact O-N 3.17Å; Q58-G60 PolarHBondContact O-N 3.15Å; G60-E62 VanDerWaalsContact C-N 3.35Å; G60-E62 PolarHBondContact O-N 3.33Å; G60-E62 VanDerWaalsContact O-N 3.07Å
61	V	70.7	Confident	74.4	Confident	73 Å²	73	115.9 Å²	115.9	44%	0.442	65%	0.654	S	S	.	*			trans	-80.9	88.8	176.7	-177	0	0	0	0	107.1	M56 A59 E63	M56-V61 HydrophobicContact CE-CG1 4.03Å; M56-V61 PolarHBondContact O-N 2.94Å; M56-V61 VanDerWaalsContact O-N 3.08Å; A59-V61 HydrophobicContact CB-CG2 3.87Å; A59-V61 PolarHBondContact O-N 3.12Å; V61-E63 PolarHBondContact O-N 3.43Å
62	E	62.8	Low	72.7	Confident	175 Å²	175	121.1 Å²	121.1	82%	0.818	67%	0.672	S	S	*	*			trans	-59.2	134	164	-70.7	177.3	169.9	0	0	108.2	G60 I64	G60-E62 VanDerWaalsContact C-N 3.35Å; G60-E62 PolarHBondContact O-N 3.33Å; G60-E62 VanDerWaalsContact O-N 3.07Å; E62-I64 PolarHBondContact O-N 3.02Å
63	E	57.6	Low	71	Confident	168 Å²	168	125.5 Å²	125.5	79%	0.785	69%	0.691	S	S	*	*			trans	-49.2	105	-179.9	-157.5	169.6	-157.8	0	0	108.9	V61 E65	V61-E63 PolarHBondContact O-N 3.43Å; E63-E65 PolarHBondContact O-N 3.14Å
64	I	56	Low	69.3	Low	154 Å²	154	128.6 Å²	128.6	79%	0.79	71%	0.709	S	S	*	*			trans	-69.7	88.1	167.4	-56	171.7	0	0	0	103.6	E62 A66	E62-I64 PolarHBondContact O-N 3.02Å; I64-A66 VanDerWaalsContact C-N 3.33Å; I64-A66 PolarHBondContact O-N 3.49Å
65	E	53.5	Low	67.4	Low	165 Å²	165	134 Å²	134	77%	0.771	73%	0.732	S	S	*	*			trans	-48.8	106.1	167.1	-81	-171.6	151	0	0	106.2	E63 A67	E63-E65 PolarHBondContact O-N 3.14Å; E65-A67 PolarHBondContact O-N 3.43Å
66	A	53.6	Low	65.9	Low	96 Å²	96	132.4 Å²	132.4	79%	0.793	74%	0.742	S	S	*	*			trans	-68.4	78.3	171.7	0	0	0	0	0	107.2	I64 P68	I64-A66 VanDerWaalsContact C-N 3.33Å; I64-A66 PolarHBondContact O-N 3.49Å; A66-P68 VanDerWaalsContact O-CD 3.32Å; A66-P68 WeakPolarHBondContact O-CD 3.32Å
67	A	54	Low	64.2	Low	80 Å²	80	137.8 Å²	137.8	66%	0.661	79%	0.788	S	S	*	*			trans	-61.7	119.3	160.8	0	0	0	0	0	106.2	E65 E69	E65-A67 PolarHBondContact O-N 3.43Å; A67-E69 PolarHBondContact O-N 3.2Å
68	P	57.8	Low	62.9	Low	119 Å²	119	139.1 Å²	139.1	77%	0.773	79%	0.793	S	S	*	*			trans	-69	103.9	174.2	28.3	-30.3	0	0	0	107	A66 K70	A66-P68 VanDerWaalsContact O-CD 3.32Å; A66-P68 WeakPolarHBondContact O-CD 3.32Å; P68-K70 VanDerWaalsContact C-N 3.34Å; P68-K70 PolarHBondContact O-N 2.85Å
69	E	60.9	Low	61.4	Low	186 Å²	186	138.1 Å²	138.1	87%	0.869	80%	0.796	S	S	*	*			trans	-57.3	99.7	164.7	-84.6	-105.2	139.8	0	0	107.5	A67	A67-E69 PolarHBondContact O-N 3.2Å
70	K	61.7	Low	59.9	Low	183 Å²	183	141.7 Å²	141.7	80%	0.796	81%	0.806	S	S	*	*			trans	-58.4	128.2	170.2	-71.3	-175.9	-176.7	178.9	0	107.8	P68 K72	P68-K70 VanDerWaalsContact C-N 3.34Å; P68-K70 PolarHBondContact O-N 2.85Å; K70-K72 PolarHBondContact O-N 3.38Å; K70-K72 VanDerWaalsContact O-N 3.13Å
71	P	57.3	Low	58.8	Low	125 Å²	125	146.6 Å²	146.6	81%	0.812	82%	0.818	S	S	*	*			trans	-59	121.3	174.4	-20.4	31	0	0	0	109.3	E73	P71-E73 PolarHBondContact O-N 2.91Å
72	K	62.5	Low	58	Low	204 Å²	204	151.2 Å²	151.2	89%	0.887	84%	0.841	S	S	*	*			trans	-66.8	101.7	167.2	-72.6	-176.3	179.5	173.5	0	107.4	K70 S74	K70-K72 PolarHBondContact O-N 3.38Å; K70-K72 VanDerWaalsContact O-N 3.13Å; K72-S74 PolarHBondContact O-N 3.04Å
73	E	58.5	Low	57.7	Low	189 Å²	189	149.6 Å²	149.6	88%	0.883	84%	0.843	S	S	*	*			trans	-59	104.9	168	-119.4	177.7	142.8	0	0	108.2	P71 Q75	P71-E73 PolarHBondContact O-N 2.91Å; E73-Q75 PolarHBondContact O-N 3.16Å; E73-Q75 VanDerWaalsContact O-N 3.14Å
74	S	59.4	Low	57.7	Low	113 Å²	113	148.3 Å²	148.3	79%	0.79	85%	0.847	S	S	*	*			trans	-62.6	108.2	168.9	168.8	0	0	0	0	107.9	K72 G76	K72-S74 PolarHBondContact O-N 3.04Å; S74-G76 PolarHBondContact O-N 3.09Å; S74-G76 VanDerWaalsContact O-N 3.1Å
75	Q	55	Low	57.8	Low	190 Å²	190	147.8 Å²	147.8	89%	0.888	85%	0.852	S	S	*	*			trans	-53	115	168.2	-74.1	178	-15.9	0	0	109.1	E73	E73-Q75 PolarHBondContact O-N 3.16Å; E73-Q75 VanDerWaalsContact O-N 3.14Å
76	G	62.8	Low	58.2	Low	74 Å²	74	146.4 Å²	146.4	76%	0.763	86%	0.858	S	S	*	*			trans	-77	128.4	169.9	0	0	0	0	0	109.9	S74	S74-G76 PolarHBondContact O-N 3.09Å; S74-G76 VanDerWaalsContact O-N 3.1Å
77	S	55	Low	58.6	Low	198 Å²	198	151 Å²	151	100%	1.385	86%	0.864	S	S	*	*			trans	-59.5	0	168.1	-54.3	0	0	0	0	113.4

Retrieved 77 of 77 residues in 72.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).