A0A087Y376_POEFO Loading...

U6 snRNA-associated Sm-like protein LSm7

Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession A0A087Y376, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 113 aa.

						>A0A087Y376_POEFO|A0A087Y376
FKNNTAKLWFLQDKEKKKKESIFDLSKYIDKTIRVKFQGGREASGVLKGFDPLLNLVLDGTIEYMRDPDDQLKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQHDG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	45.8	Very low	54.9	Low	258 Å²	258	144.5 Å²	144.5	100%	1.132	70%	0.698	S	S	*	*				0	135	0	-60.2	-90.3	0	0	0	108.3
2	K	51	Low	54.7	Low	197 Å²	197	144.1 Å²	144.1	86%	0.857	69%	0.694	S	S	*	*			trans	89.7	101.6	-166	-54.9	173.8	-178.6	-177.9	0	112.5
3	N	51	Low	54.6	Low	150 Å²	150	141.9 Å²	141.9	80%	0.802	69%	0.689	S	S	*	*	S	Bend	trans	174.3	-8.1	151.2	-88.6	0.6	0	0	0	113.4
4	N	56.1	Low	54.5	Low	135 Å²	135	145.1 Å²	145.1	72%	0.722	70%	0.697	S	S	*	*	H	α-helix	trans	-89.9	-27.5	178.2	-138	23.9	0	0	0	113.7	L8	N4-L8 PolarHBondContact O-N 3.2Å
5	T	58.8	Low	54.6	Low	91 Å²	91	146.6 Å²	146.6	56%	0.558	70%	0.703	S	S	*	*	H	α-helix	trans	-68.2	-47.5	-177.3	-25.4	0	0	0	0	111.3	K7 L8 W9	T5-K7 VanDerWaalsContact C-N 3.28Å; T5-K7 PolarHBondContact O-N 3.33Å; T5-L8 VanDerWaalsContact O-CB 3.3Å; T5-L8 WeakPolarHBondContact O-CB 3.45Å; T5-L8 PolarHBondContact O-N 2.67Å; T5-W9 PolarHBondContact O-N 2.72Å; T5-W9 VanDerWaalsContact O-N 3.12Å
6	A	58.7	Low	54.8	Low	50 Å²	50	148.1 Å²	148.1	41%	0.413	71%	0.705	S	S	.	*	H	α-helix	trans	-57.9	-39.4	179.5	0	0	0	0	0	112.5	L8 W9 F10	A6-L8 VanDerWaalsContact C-N 3.29Å; A6-L8 PolarHBondContact O-N 3.44Å; A6-W9 PolarHBondContact O-N 3.12Å; A6-F10 WeakPolarHBondContact O-CD2 3.4Å; A6-F10 PolarHBondContact O-N 3.21Å
7	K	55	Low	55.1	Low	139 Å²	139	150.8 Å²	150.8	60%	0.604	71%	0.714	S	S	*	*	H	α-helix	trans	-64.8	-33.6	177.7	-156.5	175	-174.5	178.6	0	112.3	T5 L11	T5-K7 VanDerWaalsContact C-N 3.28Å; T5-K7 PolarHBondContact O-N 3.33Å; K7-L11 HydrophobicContact CG-CD1 4.46Å; K7-L11 WeakPolarHBondContact O-CD1 3.1Å; K7-L11 WeakPolarHBondContact O-CG 3.07Å; K7-L11 PolarHBondContact O-N 3.4Å
8	L	58.3	Low	55.5	Low	118 Å²	118	152.8 Å²	152.8	62%	0.618	72%	0.719	S	S	*	*	H	α-helix	trans	-68.4	-41.7	174.1	-153.3	75.2	0	0	0	111.4	N4 T5 A6 L11 Q12	N4-L8 PolarHBondContact O-N 3.2Å; T5-L8 VanDerWaalsContact O-CB 3.3Å; T5-L8 WeakPolarHBondContact O-CB 3.45Å; T5-L8 PolarHBondContact O-N 2.67Å; A6-L8 VanDerWaalsContact C-N 3.29Å; A6-L8 PolarHBondContact O-N 3.44Å; L8-L11 PolarHBondContact O-N 2.95Å; L8-Q12 PolarHBondContact O-N 3.01Å
9	W	57.3	Low	55.9	Low	174 Å²	174	155.8 Å²	155.8	66%	0.659	73%	0.729	S	S	*	*	H	α-helix	trans	-63	-42.7	174.8	-66.5	101.1	0	0	0	112.3	T5 A6 L11 Q12	T5-W9 PolarHBondContact O-N 2.72Å; T5-W9 VanDerWaalsContact O-N 3.12Å; A6-W9 PolarHBondContact O-N 3.12Å; W9-L11 PolarHBondContact O-N 2.99Å; W9-Q12 PolarHBondContact O-N 3.28Å
10	F	55.1	Low	56.3	Low	164 Å²	164	156.7 Å²	156.7	72%	0.719	73%	0.733	S	S	*	*	H	α-helix	trans	-71.2	-25.8	179.6	-77.8	-67.8	0	0	0	114.4	A6	A6-F10 WeakPolarHBondContact O-CD2 3.4Å; A6-F10 PolarHBondContact O-N 3.21Å
11	L	56.5	Low	57	Low	114 Å²	114	152.3 Å²	152.3	60%	0.597	72%	0.72	S	S	*	*	H	α-helix	trans	-79.6	-28.5	176.4	-79.3	163.4	0	0	0	112.4	K7 L8 W9 K14	K7-L11 HydrophobicContact CG-CD1 4.46Å; K7-L11 WeakPolarHBondContact O-CD1 3.1Å; K7-L11 WeakPolarHBondContact O-CG 3.07Å; K7-L11 PolarHBondContact O-N 3.4Å; L8-L11 PolarHBondContact O-N 2.95Å; W9-L11 PolarHBondContact O-N 2.99Å; L11-K14 PolarHBondContact O-N 3.44Å
12	Q	52.7	Low	58.8	Low	139 Å²	139	148.8 Å²	148.8	65%	0.65	71%	0.711	S	S	*	*	H	α-helix	trans	-75	-25.5	-176.3	-152.5	164.7	12.2	0	0	113.1	L8 W9 K14	L8-Q12 PolarHBondContact O-N 3.01Å; W9-Q12 PolarHBondContact O-N 3.28Å; Q12-K14 VanDerWaalsContact C-N 3.3Å; Q12-K14 PolarHBondContact O-N 3.45Å
13	D	53.5	Low	60.3	Low	116 Å²	116	143 Å²	143	62%	0.62	69%	0.686	S	S	*	*	G	3₁₀ helix	trans	-75.2	-16.3	176.6	-88.7	-38.2	0	0	0	114	E15	D13-E15 VanDerWaalsContact C-N 3.34Å
14	K	53.5	Low	62.1	Low	187 Å²	187	139.1 Å²	139.1	81%	0.813	67%	0.665	S	S	*	*	G	3₁₀ helix	trans	-83.3	-9	-177	-129.2	-179.5	-178.4	-178.6	0	114	L11 Q12	L11-K14 PolarHBondContact O-N 3.44Å; Q12-K14 VanDerWaalsContact C-N 3.3Å; Q12-K14 PolarHBondContact O-N 3.45Å
15	E	55.2	Low	63.9	Low	167 Å²	167	132.7 Å²	132.7	78%	0.78	63%	0.631	S	S	*	*	G	3₁₀ helix	trans	-112.6	32.9	-179.3	-67.3	-147.8	145.6	0	0	113.9	D13 K17	D13-E15 VanDerWaalsContact C-N 3.34Å; E15-K17 PolarHBondContact O-N 3.25Å
16	K	58.7	Low	65.6	Low	171 Å²	171	131.6 Å²	131.6	74%	0.743	63%	0.627	S	S	*	*			trans	-68.5	89.3	156.4	-77.2	-179.8	-177.9	163.7	0	107.6	K18	K16-K18 PolarHBondContact O-N 3.43Å
17	K	60	Low	67.2	Low	194 Å²	194	135.8 Å²	135.8	84%	0.843	64%	0.636	S	S	*	*			trans	-43	118.4	167.6	-80	-177	176	178.4	0	107.3	E15 K19	E15-K17 PolarHBondContact O-N 3.25Å; K17-K19 PolarHBondContact O-N 3.18Å; K17-K19 VanDerWaalsContact O-N 3.15Å
18	K	61.3	Low	69.2	Low	187 Å²	187	131.7 Å²	131.7	81%	0.813	62%	0.617	S	S	*	*			trans	-51	127.1	172	-86.7	-179	175.2	178.4	0	106.3	K16 E20	K16-K18 PolarHBondContact O-N 3.43Å; K18-E20 PolarHBondContact O-N 3.04Å
19	K	64.6	Low	71	Confident	209 Å²	209	128.9 Å²	128.9	91%	0.909	60%	0.602	S	S	*	*			trans	-65.8	91.3	168.5	-77.6	-176.2	176.6	-178.1	0	106.1	K17 S21	K17-K19 PolarHBondContact O-N 3.18Å; K17-K19 VanDerWaalsContact O-N 3.15Å; K19-S21 PolarHBondContact O-N 3.12Å
20	E	63.3	Low	73	Confident	173 Å²	173	125.6 Å²	125.6	81%	0.808	60%	0.597	S	S	*	*			trans	-65.4	130.4	173.9	-69.2	178.9	178.9	0	0	107.6	K18 I22	K18-E20 PolarHBondContact O-N 3.04Å; E20-I22 PolarHBondContact O-N 3.34Å
21	S	71.1	Confident	75	Confident	65 Å²	65	123.4 Å²	123.4	46%	0.455	59%	0.587	S	S	.	*			trans	-61.1	132.1	171.3	172.2	0	0	0	0	108	K19 F23	K19-S21 PolarHBondContact O-N 3.12Å; S21-F23 PolarHBondContact O-N 3.35Å; S21-F23 VanDerWaalsContact O-N 3.08Å; S21-F23 PolarHBondContact OG-N 2.89Å; S21-F23 VanDerWaalsContact OG-N 3.13Å; S21-F23 PolarHBondContact OG-O 3.34Å
22	I	82.4	Confident	76.9	Confident	184 Å²	184	120.7 Å²	120.7	94%	0.944	58%	0.576	S	S	*	*	S	Bend	trans	-61.4	-14.6	171.8	59.7	168.5	0	0	0	112.3	E20	E20-I22 PolarHBondContact O-N 3.34Å
23	F	82.8	Confident	79.1	Confident	75 Å²	75	114 Å²	114	33%	0.329	55%	0.545	S	S	.	.	S	Bend	trans	-111.8	112.2	-176.9	-164.6	-112.7	0	0	0	110.1	S21 L25 Y28 I94	S21-F23 PolarHBondContact O-N 3.35Å; S21-F23 VanDerWaalsContact O-N 3.08Å; S21-F23 PolarHBondContact OG-N 2.89Å; S21-F23 VanDerWaalsContact OG-N 3.13Å; S21-F23 PolarHBondContact OG-O 3.34Å; F23-L25 HydrophobicContact CD1-CD2 3.88Å; F23-L25 HydrophobicContact CD1-CG 3.87Å; F23-L25 HydrophobicContact CE1-CD2 3.47Å; F23-L25 VanDerWaalsContact CE1-CD2 3.47Å; F23-L25 HydrophobicContact CE1-CG 4.01Å; F23-L25 PolarHBondContact O-N 2.97Å; F23-Y28 HydrophobicContact CE1-CE2 4.35Å; F23-Y28 HydrophobicContact CE2-CE2 4.35Å; F23-Y28 HydrophobicContact CZ-CD2 4.46Å; F23-Y28 AromaticContact CZ-CE2 3.8Å; F23-Y28 HydrophobicContact CZ-CE2 3.8Å; F23-I94 HydrophobicContact CE1-CB 4.32Å; F23-I94 HydrophobicContact CE1-CG2 4.27Å
24	D	89.4	Confident	81.1	Confident	70 Å²	70	110.4 Å²	110.4	37%	0.374	52%	0.522	S	S	.	.			trans	-89.7	98.7	178.4	178.8	18.7	0	0	0	110.7	S26 K27	D24-S26 PolarHBondContact O-N 2.92Å; D24-S26 WeakPolarHBondContact OD1-CB 3.3Å; D24-S26 PolarHBondContact OD1-N 2.8Å; D24-S26 PolarHBondContact OD1-OG 3.17Å; D24-K27 VanDerWaalsContact OD2-CE 3.28Å; D24-K27 WeakPolarHBondContact OD2-CE 3.28Å
25	L	92.9	Very high	83.2	Confident	0 Å²	0	101.5 Å²	101.5	0%	0	48%	0.483	C	S	.	.	G	3₁₀ helix	trans	-72.1	-14.8	177.3	-78.8	170.5	0	0	0	113.4	F23 K27 Y28 L47 F50 L54 L56 I94	F23-L25 HydrophobicContact CD1-CD2 3.88Å; F23-L25 HydrophobicContact CD1-CG 3.87Å; F23-L25 HydrophobicContact CE1-CD2 3.47Å; F23-L25 VanDerWaalsContact CE1-CD2 3.47Å; F23-L25 HydrophobicContact CE1-CG 4.01Å; F23-L25 PolarHBondContact O-N 2.97Å; L25-K27 PolarHBondContact O-N 3.18Å; L25-K27 VanDerWaalsContact O-N 3.15Å; L25-Y28 HydrophobicContact CD2-CD2 4.42Å; L25-Y28 PolarHBondContact O-N 2.84Å; L25-L47 HydrophobicContact CB-CD2 4.26Å; L25-L47 HydrophobicContact CD2-CD2 4.17Å; L25-F50 HydrophobicContact CB-CD1 3.53Å; L25-F50 HydrophobicContact CB-CD2 3.79Å; L25-F50 HydrophobicContact CB-CE1 3.5Å; L25-F50 HydrophobicContact CB-CE2 3.75Å; L25-F50 HydrophobicContact CB-CG 3.69Å; L25-F50 HydrophobicContact CB-CZ 3.62Å; L25-F50 HydrophobicContact CD1-CB 3.85Å; L25-F50 HydrophobicContact CD1-CD1 4.35Å; L25-F50 HydrophobicContact CD1-CD2 3.75Å; L25-F50 HydrophobicContact CD1-CE2 4.43Å; L25-F50 HydrophobicContact CD1-CG 3.71Å; L25-F50 HydrophobicContact CG-CD2 4.4Å; L25-F50 HydrophobicContact CG-CG 4.36Å; L25-L54 HydrophobicContact CD1-CD2 3.7Å; L25-L56 HydrophobicContact CD1-CD2 3.75Å; L25-I94 HydrophobicContact CD1-CD1 4.3Å; L25-I94 HydrophobicContact CD2-CD1 4.08Å; L25-I94 HydrophobicContact CD2-CG2 4.15Å
26	S	94.5	Very high	85.1	Confident	68 Å²	68	97.8 Å²	97.8	48%	0.476	47%	0.465	S	S	.	.	G	3₁₀ helix	trans	-59.8	-30.8	-179.3	-39.8	0	0	0	0	111.7	D24 Y28 I29	D24-S26 PolarHBondContact O-N 2.92Å; D24-S26 WeakPolarHBondContact OD1-CB 3.3Å; D24-S26 PolarHBondContact OD1-N 2.8Å; D24-S26 PolarHBondContact OD1-OG 3.17Å; S26-Y28 PolarHBondContact O-N 2.85Å; S26-I29 PolarHBondContact O-N 3.45Å
27	K	93.9	Very high	86.9	Confident	137 Å²	137	90.9 Å²	90.9	60%	0.596	44%	0.435	S	S	*	.	G	3₁₀ helix	trans	-65.9	-15.8	177.2	-61.9	176.7	-176.8	175.8	0	114.1	D24 L25 K31	D24-K27 VanDerWaalsContact OD2-CE 3.28Å; D24-K27 WeakPolarHBondContact OD2-CE 3.28Å; L25-K27 PolarHBondContact O-N 3.18Å; L25-K27 VanDerWaalsContact O-N 3.15Å; K27-K31 PolarHBondContact O-NZ 3.46Å
28	Y	95.9	Very high	88.6	Confident	53 Å²	53	88.5 Å²	88.5	21%	0.208	43%	0.427	C	S	.	.	G	3₁₀ helix	trans	-112.6	3	-176.7	-55.7	-72.1	0	0	0	113.2	F23 L25 S26 D30 K31 I33 L47 P96	F23-Y28 HydrophobicContact CE1-CE2 4.35Å; F23-Y28 HydrophobicContact CE2-CE2 4.35Å; F23-Y28 HydrophobicContact CZ-CD2 4.46Å; F23-Y28 AromaticContact CZ-CE2 3.8Å; F23-Y28 HydrophobicContact CZ-CE2 3.8Å; L25-Y28 HydrophobicContact CD2-CD2 4.42Å; L25-Y28 PolarHBondContact O-N 2.84Å; S26-Y28 PolarHBondContact O-N 2.85Å; Y28-D30 PolarHBondContact O-N 2.96Å; Y28-K31 WeakPolarHBondContact O-CB 3.49Å; Y28-K31 PolarHBondContact O-N 3.15Å; Y28-I33 HydrophobicContact CG-CG2 4.41Å; Y28-L47 WeakPolarHBondContact O-CB 3.24Å; Y28-P96 HydrophobicContact CD1-CB 4.08Å; Y28-P96 HydrophobicContact CE1-CB 3.72Å; Y28-P96 HydrophobicContact CE1-CG 3.98Å
29	I	97.3	Very high	89.9	Confident	59 Å²	59	82.1 Å²	82.1	30%	0.303	41%	0.414	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.2	137.6	170.5	-69.3	-71.8	0	0	0	109.6	S26 K31 L47 F50	S26-I29 PolarHBondContact O-N 3.45Å; I29-K31 PolarHBondContact O-N 3.05Å; I29-K31 VanDerWaalsContact O-N 3.12Å; I29-L47 HydrophobicContact CD1-CD2 4.29Å; I29-L47 HydrophobicContact CD1-CG 4.16Å; I29-F50 HydrophobicContact CD1-CD1 4.11Å; I29-F50 HydrophobicContact CD1-CE1 4.2Å; I29-F50 HydrophobicContact CG1-CE1 4.35Å
30	D	97.7	Very high	91.2	Very high	105 Å²	105	73.8 Å²	73.8	56%	0.561	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.9	15.5	-175.4	-65.7	-51.2	0	0	0	115	Y28 L47 K48	Y28-D30 PolarHBondContact O-N 2.96Å; D30-L47 PolarHBondContact N-O 3Å; D30-K48 IonicContact OD1-NZ 2.72Å; D30-K48 PolarHBondContact OD1-NZ 3.37Å
31	K	97.6	Very high	92.6	Very high	118 Å²	118	70.7 Å²	70.7	51%	0.513	37%	0.368	S	S	.	.	S	Bend	trans	-108.1	151.1	170.1	-59.8	-178	-174.3	163.2	0	110.6	K27 Y28 I29 I33 V46 L47	K27-K31 PolarHBondContact O-NZ 3.46Å; Y28-K31 WeakPolarHBondContact O-CB 3.49Å; Y28-K31 PolarHBondContact O-N 3.15Å; I29-K31 PolarHBondContact O-N 3.05Å; I29-K31 VanDerWaalsContact O-N 3.12Å; K31-I33 PolarHBondContact O-N 3.42Å; K31-V46 WeakPolarHBondContact O-CA 3.49Å; K31-L47 PolarHBondContact O-N 3.47Å
32	T	97.6	Very high	93.8	Very high	57 Å²	57	67.8 Å²	67.8	35%	0.35	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	126.2	172.4	-47.2	0	0	0	0	109.8	G45 Q97	T32-G45 WeakPolarHBondContact CA-O 3.49Å; T32-Q97 HydrophobicContact CG2-CB 4.22Å; T32-Q97 WeakPolarHBondContact O-CB 3.41Å; T32-Q97 PolarHBondContact O-N 3.42Å; T32-Q97 VanDerWaalsContact O-N 3.1Å
33	I	97.3	Very high	94.5	Very high	0 Å²	0	59.3 Å²	59.3	0%	0	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	153.3	173.3	61.6	169.3	0	0	0	109.4	Y28 K31 V35 S44 G45 L47 L56 L58 I94 C95	Y28-I33 HydrophobicContact CG-CG2 4.41Å; K31-I33 PolarHBondContact O-N 3.42Å; I33-V35 HydrophobicContact CD1-CG2 3.87Å; I33-V35 HydrophobicContact CG1-CG2 4.11Å; I33-S44 VanDerWaalsContact O-CA 3.26Å; I33-S44 WeakPolarHBondContact O-CA 3.31Å; I33-G45 PolarHBondContact N-O 2.95Å; I33-G45 PolarHBondContact O-N 2.78Å; I33-L47 HydrophobicContact CD1-CB 4Å; I33-L47 HydrophobicContact CD1-CD1 4Å; I33-L47 HydrophobicContact CD1-CD2 4.31Å; I33-L47 HydrophobicContact CD1-CG 4.32Å; I33-L47 HydrophobicContact CG1-CB 4.23Å; I33-L56 HydrophobicContact CD1-CD1 4.29Å; I33-L58 HydrophobicContact CD1-CD2 3.89Å; I33-L58 HydrophobicContact CG1-CD2 3.94Å; I33-I94 HydrophobicContact CB-CG2 4.42Å; I33-I94 HydrophobicContact CD1-CG2 3.85Å; I33-C95 CarbonylContact C-O 3.53Å; I33-C95 WeakPolarHBondContact CA-O 3.34Å; I33-C95 WeakPolarHBondContact CB-O 3.49Å
34	R	96.6	Very high	95.2	Very high	39 Å²	39	56 Å²	56	15%	0.147	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	132.6	170.8	-170.9	168.4	-144.1	-131	6	109.2	E42 A43 S44 Y64 C95	R34-E42 WeakPolarHBondContact CD-OE1 3.42Å; R34-E42 HydrophobicContact CG-CG 3.99Å; R34-E42 VanDerWaalsContact CG-OE1 3.32Å; R34-E42 WeakPolarHBondContact CG-OE1 3.18Å; R34-E42 IonicContact CZ-OE1 2.99Å; R34-E42 IonicContact CZ-OE2 3.64Å; R34-E42 IonicContact NE-OE1 3.12Å; R34-E42 PolarHBondContact NE-OE1 3.46Å; R34-E42 VanDerWaalsContact NE-OE1 3.12Å; R34-E42 IonicContact NH1-OE1 2.67Å; R34-E42 PolarHBondContact NH1-OE1 2.86Å; R34-E42 IonicContact NH1-OE2 3.29Å; R34-E42 PolarHBondContact NH1-OE2 3.03Å; R34-E42 IonicContact NH2-OE1 3.87Å; R34-E42 IonicContact NH2-OE2 3.85Å; R34-A43 CarbonylContact C-O 3.51Å; R34-A43 WeakPolarHBondContact CA-O 3.37Å; R34-S44 WeakPolarHBondContact CB-OG 3.47Å; R34-S44 WeakPolarHBondContact CG-OG 3.4Å; R34-Y64 VanDerWaalsContact NE-CE2 3.33Å; R34-Y64 VanDerWaalsContact NH2-CD1 3.31Å; R34-Y64 VanDerWaalsContact NH2-CE2 3.3Å; R34-Y64 VanDerWaalsContact NH2-CG 3.26Å; R34-C95 PolarHBondContact N-O 3.45Å; R34-C95 PolarHBondContact O-N 2.95Å; R34-C95 PolarHBondContact O-SG 3.08Å
35	V	97.1	Very high	95.6	Very high	0 Å²	0	52.8 Å²	52.8	0%	0	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	127.6	-172.1	-172.9	0	0	0	0	109	I33 F37 E42 A43 L56 L58 V91 L93 I94	I33-V35 HydrophobicContact CD1-CG2 3.87Å; I33-V35 HydrophobicContact CG1-CG2 4.11Å; V35-F37 HydrophobicContact CB-CE2 4.26Å; V35-F37 HydrophobicContact CB-CZ 4.28Å; V35-F37 HydrophobicContact CG1-CE1 4.13Å; V35-F37 HydrophobicContact CG1-CE2 3.99Å; V35-F37 HydrophobicContact CG1-CZ 3.71Å; V35-E42 WeakPolarHBondContact O-CA 3.36Å; V35-A43 PolarHBondContact N-O 2.96Å; V35-A43 PolarHBondContact O-N 3.15Å; V35-L56 HydrophobicContact CG1-CD1 4.19Å; V35-L56 HydrophobicContact CG2-CD1 3.84Å; V35-L58 HydrophobicContact CG2-CD1 4.23Å; V35-V91 HydrophobicContact CG1-CG1 3.99Å; V35-V91 HydrophobicContact CG1-CG2 4.15Å; V35-L93 WeakPolarHBondContact CA-O 3.39Å; V35-I94 HydrophobicContact CG1-CG1 4.37Å; V35-I94 HydrophobicContact CG2-CG1 4.48Å
36	K	96	Very high	95.9	Very high	89 Å²	89	54.5 Å²	54.5	39%	0.387	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	141.9	170	-65.6	-175.7	171.6	-174.7	0	109.9	E42 V92 L93	K36-E42 WeakPolarHBondContact CE-OE1 3.27Å; K36-E42 WeakPolarHBondContact CE-OE2 3.18Å; K36-E42 HydrophobicContact CG-CB 4.34Å; K36-E42 HydrophobicContact CG-CG 3.97Å; K36-E42 IonicContact NZ-OE2 3.82Å; K36-V92 VanDerWaalsContact C-CG2 3.49Å; K36-V92 HydrophobicContact CB-CG2 3.76Å; K36-V92 WeakPolarHBondContact O-CG2 3.32Å; K36-V92 PolarHBondContact O-N 3.14Å; K36-L93 HydrophobicContact CB-CB 4.19Å; K36-L93 HydrophobicContact CD-CD2 4.41Å; K36-L93 HydrophobicContact CG-CD2 4.39Å; K36-L93 PolarHBondContact N-O 2.81Å; K36-L93 PolarHBondContact O-N 3.11Å
37	F	96.1	Very high	96.1	Very high	26 Å²	26	51.3 Å²	51.3	11%	0.114	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	154.5	177.3	-59.7	-86.7	0	0	0	111.3	V35 G39 G40 R41 A43 C86 S90 V91	V35-F37 HydrophobicContact CB-CE2 4.26Å; V35-F37 HydrophobicContact CB-CZ 4.28Å; V35-F37 HydrophobicContact CG1-CE1 4.13Å; V35-F37 HydrophobicContact CG1-CE2 3.99Å; V35-F37 HydrophobicContact CG1-CZ 3.71Å; F37-G39 PolarHBondContact O-N 3.15Å; F37-G40 PolarHBondContact O-N 2.83Å; F37-R41 HydrophobicContact CB-CB 4.28Å; F37-R41 HydrophobicContact CD2-CB 4.22Å; F37-R41 PolarHBondContact N-O 2.85Å; F37-A43 HydrophobicContact CE2-CB 4.24Å; F37-C86 HydrophobicContact CE1-CB 3.84Å; F37-C86 HydrophobicContact CZ-CB 3.77Å; F37-S90 CarbonylContact C-O 3.58Å; F37-S90 WeakPolarHBondContact CA-O 3.3Å; F37-V91 HydrophobicContact CD1-CG2 4.2Å; F37-V91 HydrophobicContact CE1-CG2 3.82Å
38	Q	94.5	Very high	96.3	Very high	145 Å²	145	49 Å²	49	68%	0.678	25%	0.253	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.6	137.2	166	-170.3	179.3	21.5	0	0	109.3	G40 S90 V92	Q38-G40 VanDerWaalsContact C-N 3.34Å; Q38-S90 PolarHBondContact N-O 3Å; Q38-V92 HydrophobicContact CB-CG1 4.04Å
39	G	89.8	Confident	96.4	Very high	52 Å²	52	47.3 Å²	47.3	54%	0.536	25%	0.252	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.2	14.2	-174.1	0	0	0	0	0	113.7	F37 R41 R66	F37-G39 PolarHBondContact O-N 3.15Å; G39-R41 PolarHBondContact O-N 3.49Å; G39-R66 PolarHBondContact O-NH1 3.04Å; G39-R66 PolarHBondContact O-NH2 2.88Å
40	G	91	Very high	96.4	Very high	35 Å²	35	48.2 Å²	48.2	36%	0.361	25%	0.254	S	S	.	.	S	Bend	trans	92.2	-11.6	160.9	0	0	0	0	0	116.4	F37 Q38 R66	F37-G40 PolarHBondContact O-N 2.83Å; Q38-G40 VanDerWaalsContact C-N 3.34Å; G40-R66 WeakPolarHBondContact O-CD 3.15Å
41	R	93.8	Very high	96.3	Very high	107 Å²	107	45.7 Å²	45.7	40%	0.404	24%	0.24	S	C	.	.			trans	-60.5	142.5	178.7	-63.1	-177.7	73	-142.1	9.5	110.9	F37 G39 E63	F37-R41 HydrophobicContact CB-CB 4.28Å; F37-R41 HydrophobicContact CD2-CB 4.22Å; F37-R41 PolarHBondContact N-O 2.85Å; G39-R41 PolarHBondContact O-N 3.49Å; R41-E63 IonicContact CZ-OE1 3.1Å; R41-E63 IonicContact NE-OE1 2.74Å; R41-E63 PolarHBondContact NE-OE1 2.82Å; R41-E63 IonicContact NH2-OE1 2.71Å; R41-E63 PolarHBondContact NH2-OE1 3.08Å; R41-E63 IonicContact NH2-OE2 2.94Å; R41-E63 PolarHBondContact NH2-OE2 3.18Å
42	E	95.8	Very high	95.9	Very high	4 Å²	4	45.9 Å²	45.9	2%	0.019	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.7	137.2	178.2	-173.9	156.9	-159.9	0	0	109.8	R34 V35 K36 Y64 L74	R34-E42 WeakPolarHBondContact CD-OE1 3.42Å; R34-E42 HydrophobicContact CG-CG 3.99Å; R34-E42 VanDerWaalsContact CG-OE1 3.32Å; R34-E42 WeakPolarHBondContact CG-OE1 3.18Å; R34-E42 IonicContact CZ-OE1 2.99Å; R34-E42 IonicContact CZ-OE2 3.64Å; R34-E42 IonicContact NE-OE1 3.12Å; R34-E42 PolarHBondContact NE-OE1 3.46Å; R34-E42 VanDerWaalsContact NE-OE1 3.12Å; R34-E42 IonicContact NH1-OE1 2.67Å; R34-E42 PolarHBondContact NH1-OE1 2.86Å; R34-E42 IonicContact NH1-OE2 3.29Å; R34-E42 PolarHBondContact NH1-OE2 3.03Å; R34-E42 IonicContact NH2-OE1 3.87Å; R34-E42 IonicContact NH2-OE2 3.85Å; V35-E42 WeakPolarHBondContact O-CA 3.36Å; K36-E42 WeakPolarHBondContact CE-OE1 3.27Å; K36-E42 WeakPolarHBondContact CE-OE2 3.18Å; K36-E42 HydrophobicContact CG-CB 4.34Å; K36-E42 HydrophobicContact CG-CG 3.97Å; K36-E42 IonicContact NZ-OE2 3.82Å; E42-Y64 HydrophobicContact CB-CD2 4.29Å; E42-Y64 HydrophobicContact CG-CD2 3.95Å; E42-Y64 PolarHBondContact O-N 3.12Å; E42-L74 HydrophobicContact CB-CD2 4.27Å; E42-L74 WeakPolarHBondContact OE2-CD1 3.39Å
43	A	97	Very high	95.6	Very high	7 Å²	7	49.3 Å²	49.3	6%	0.058	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.4	149.8	178	0	0	0	0	0	111.3	R34 V35 F37 T61 I62	R34-A43 CarbonylContact C-O 3.51Å; R34-A43 WeakPolarHBondContact CA-O 3.37Å; V35-A43 PolarHBondContact N-O 2.96Å; V35-A43 PolarHBondContact O-N 3.15Å; F37-A43 HydrophobicContact CE2-CB 4.24Å; A43-T61 HydrophobicContact CB-CG2 4.02Å; A43-I62 CarbonylContact C-O 3.54Å; A43-I62 WeakPolarHBondContact CA-O 3.46Å; A43-I62 WeakPolarHBondContact CB-O 3.41Å
44	S	97.4	Very high	95.5	Very high	4 Å²	4	51.9 Å²	51.9	3%	0.028	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	144.3	171.5	-77.7	0	0	0	0	110.2	I33 R34 T61 I62 Y64 Q97	I33-S44 VanDerWaalsContact O-CA 3.26Å; I33-S44 WeakPolarHBondContact O-CA 3.31Å; R34-S44 WeakPolarHBondContact CB-OG 3.47Å; R34-S44 WeakPolarHBondContact CG-OG 3.4Å; S44-T61 CarbonylContact O-C 3.47Å; S44-T61 VanDerWaalsContact O-CA 3.3Å; S44-T61 WeakPolarHBondContact O-CA 3.14Å; S44-I62 PolarHBondContact N-O 3.5Å; S44-I62 PolarHBondContact O-N 2.94Å; S44-Y64 PolarHBondContact OG-OH 2.92Å; S44-Q97 PolarHBondContact OG-OE1 3.46Å
45	G	98.1	Very high	95.5	Very high	3 Å²	3	52 Å²	52	3%	0.031	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-173.9	168.6	176.6	0	0	0	0	0	111.9	T32 I33	T32-G45 WeakPolarHBondContact CA-O 3.49Å; I33-G45 PolarHBondContact N-O 2.95Å; I33-G45 PolarHBondContact O-N 2.78Å
46	V	98.4	Very high	95.5	Very high	37 Å²	37	52 Å²	52	22%	0.224	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.8	121.5	178.7	-178.6	0	0	0	0	109.2	K31 K48 L58 D59	K31-V46 WeakPolarHBondContact O-CA 3.49Å; V46-K48 HydrophobicContact CG1-CD 4.14Å; V46-K48 PolarHBondContact O-N 3.07Å; V46-L58 WeakPolarHBondContact O-CA 3.48Å; V46-D59 PolarHBondContact N-O 2.84Å; V46-D59 PolarHBondContact O-N 2.82Å
47	L	98.5	Very high	95.7	Very high	0 Å²	0	50 Å²	50	0%	0	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.4	112.7	179.2	-178.1	67.1	0	0	0	110.5	L25 Y28 I29 D30 K31 I33 G49 F50 L56 L58	L25-L47 HydrophobicContact CB-CD2 4.26Å; L25-L47 HydrophobicContact CD2-CD2 4.17Å; Y28-L47 WeakPolarHBondContact O-CB 3.24Å; I29-L47 HydrophobicContact CD1-CD2 4.29Å; I29-L47 HydrophobicContact CD1-CG 4.16Å; D30-L47 PolarHBondContact N-O 3Å; K31-L47 PolarHBondContact O-N 3.47Å; I33-L47 HydrophobicContact CD1-CB 4Å; I33-L47 HydrophobicContact CD1-CD1 4Å; I33-L47 HydrophobicContact CD1-CD2 4.31Å; I33-L47 HydrophobicContact CD1-CG 4.32Å; I33-L47 HydrophobicContact CG1-CB 4.23Å; L47-G49 WeakPolarHBondContact CD1-O 3.07Å; L47-F50 HydrophobicContact CD2-CD1 4.36Å; L47-L56 HydrophobicContact CD1-CB 4.17Å; L47-L56 HydrophobicContact CD1-CD2 4.22Å; L47-L58 HydrophobicContact CB-CD2 4.34Å; L47-L58 HydrophobicContact CD1-CD2 3.99Å
48	K	98.6	Very high	95.8	Very high	89 Å²	89	48.8 Å²	48.8	39%	0.387	28%	0.276	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	-22	177.9	-63.6	-50.4	-166.7	-174.8	0	113.7	D30 V46 V57 D59	D30-K48 IonicContact OD1-NZ 2.72Å; D30-K48 PolarHBondContact OD1-NZ 3.37Å; V46-K48 HydrophobicContact CG1-CD 4.14Å; V46-K48 PolarHBondContact O-N 3.07Å; K48-V57 HydrophobicContact CB-CB 4.36Å; K48-V57 HydrophobicContact CB-CG1 4.1Å; K48-V57 PolarHBondContact N-O 3.42Å; K48-D59 HydrophobicContact CD-CB 4.24Å; K48-D59 HydrophobicContact CG-CB 3.6Å
49	G	97.9	Very high	96	Very high	18 Å²	18	45.1 Å²	45.1	19%	0.186	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-176.5	162.3	-179.9	0	0	0	0	0	112	L47 V57	L47-G49 WeakPolarHBondContact CD1-O 3.07Å; G49-V57 PolarHBondContact O-N 2.96Å
50	F	97.6	Very high	96.4	Very high	78 Å²	78	44.7 Å²	44.7	34%	0.342	26%	0.256	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.8	166.4	175.6	65.4	-82.7	0	0	0	110.5	L25 I29 L47 N55 L56	L25-F50 HydrophobicContact CB-CD1 3.53Å; L25-F50 HydrophobicContact CB-CD2 3.79Å; L25-F50 HydrophobicContact CB-CE1 3.5Å; L25-F50 HydrophobicContact CB-CE2 3.75Å; L25-F50 HydrophobicContact CB-CG 3.69Å; L25-F50 HydrophobicContact CB-CZ 3.62Å; L25-F50 HydrophobicContact CD1-CB 3.85Å; L25-F50 HydrophobicContact CD1-CD1 4.35Å; L25-F50 HydrophobicContact CD1-CD2 3.75Å; L25-F50 HydrophobicContact CD1-CE2 4.43Å; L25-F50 HydrophobicContact CD1-CG 3.71Å; L25-F50 HydrophobicContact CG-CD2 4.4Å; L25-F50 HydrophobicContact CG-CG 4.36Å; I29-F50 HydrophobicContact CD1-CD1 4.11Å; I29-F50 HydrophobicContact CD1-CE1 4.2Å; I29-F50 HydrophobicContact CG1-CE1 4.35Å; L47-F50 HydrophobicContact CD2-CD1 4.36Å; F50-N55 WeakPolarHBondContact CA-O 3.42Å; F50-L56 HydrophobicContact CB-CD2 3.85Å
51	D	94.5	Very high	96.7	Very high	52 Å²	52	43 Å²	43	28%	0.278	24%	0.239	S	C	.	.			trans	-125.5	173.7	173	75.5	12.3	0	0	0	111.9	L53 L54 N55	D51-L53 PolarHBondContact O-N 2.88Å; D51-L53 VanDerWaalsContact O-N 3.14Å; D51-L53 WeakPolarHBondContact OD1-CA 3.35Å; D51-L53 WeakPolarHBondContact OD1-CB 3.42Å; D51-L53 PolarHBondContact OD1-N 3.37Å; D51-L54 PolarHBondContact O-N 3.26Å; D51-L54 PolarHBondContact OD1-N 3.15Å; D51-L54 VanDerWaalsContact OD1-N 3.15Å; D51-N55 PolarHBondContact N-O 2.77Å; D51-N55 PolarHBondContact OD1-N 3.1Å; D51-N55 PolarHBondContact OD1-ND2 2.98Å; D51-N55 WeakPolarHBondContact OD2-CB 3.45Å; D51-N55 PolarHBondContact OD2-ND2 3.14Å
52	P	90.6	Very high	96.9	Very high	121 Å²	121	40.2 Å²	40.2	79%	0.786	23%	0.231	S	C	*	.	T	Hydrogen-bonded Turn	trans	-63.5	-14.5	179	-25.5	36.3	0	0	0	115.4	L54	P52-L54 VanDerWaalsContact C-N 3.27Å
53	L	91.3	Very high	97	Very high	129 Å²	129	40.9 Å²	40.9	68%	0.675	23%	0.234	S	C	*	.	T	Hydrogen-bonded Turn	trans	-90.4	5	174.9	-60	-179	0	0	0	112	D51 N55 G88	D51-L53 PolarHBondContact O-N 2.88Å; D51-L53 VanDerWaalsContact O-N 3.14Å; D51-L53 WeakPolarHBondContact OD1-CA 3.35Å; D51-L53 WeakPolarHBondContact OD1-CB 3.42Å; D51-L53 PolarHBondContact OD1-N 3.37Å; L53-N55 PolarHBondContact O-N 2.82Å; L53-G88 WeakPolarHBondContact O-CA 3.49Å
54	L	94.8	Very high	96.9	Very high	54 Å²	54	42.8 Å²	42.8	28%	0.283	24%	0.241	S	C	.	.			trans	61.3	27.5	-175.3	-53.4	176.1	0	0	0	112.9	L25 D51 P52 L56 G88	L25-L54 HydrophobicContact CD1-CD2 3.7Å; D51-L54 PolarHBondContact O-N 3.26Å; D51-L54 PolarHBondContact OD1-N 3.15Å; D51-L54 VanDerWaalsContact OD1-N 3.15Å; P52-L54 VanDerWaalsContact C-N 3.27Å; L54-L56 WeakPolarHBondContact O-CG 3.41Å; L54-L56 PolarHBondContact O-N 3.19Å; L54-G88 VanDerWaalsContact C-CA 3.45Å; L54-G88 WeakPolarHBondContact O-CA 3.49Å
55	N	96.6	Very high	96.7	Very high	42 Å²	42	46 Å²	46	23%	0.225	26%	0.256	C	S	.	.			trans	-67.4	132.4	160.9	-58.5	-54.7	0	0	0	107.7	F50 D51 L53 C86 G88	F50-N55 WeakPolarHBondContact CA-O 3.42Å; D51-N55 PolarHBondContact N-O 2.77Å; D51-N55 PolarHBondContact OD1-N 3.1Å; D51-N55 PolarHBondContact OD1-ND2 2.98Å; D51-N55 WeakPolarHBondContact OD2-CB 3.45Å; D51-N55 PolarHBondContact OD2-ND2 3.14Å; L53-N55 PolarHBondContact O-N 2.82Å; N55-C86 CarbonylContact C-O 3.6Å; N55-C86 VanDerWaalsContact CA-O 3.24Å; N55-C86 WeakPolarHBondContact CA-O 3.34Å; N55-G88 PolarHBondContact OD1-N 3.04Å
56	L	98.1	Very high	96.4	Very high	0 Å²	0	49 Å²	49	0%	0	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	143.8	-174.7	-46	174.7	0	0	0	109.8	L25 I33 V35 L47 F50 L54 L58 V85 C86 I94	L25-L56 HydrophobicContact CD1-CD2 3.75Å; I33-L56 HydrophobicContact CD1-CD1 4.29Å; V35-L56 HydrophobicContact CG1-CD1 4.19Å; V35-L56 HydrophobicContact CG2-CD1 3.84Å; L47-L56 HydrophobicContact CD1-CB 4.17Å; L47-L56 HydrophobicContact CD1-CD2 4.22Å; F50-L56 HydrophobicContact CB-CD2 3.85Å; L54-L56 WeakPolarHBondContact O-CG 3.41Å; L54-L56 PolarHBondContact O-N 3.19Å; L56-L58 HydrophobicContact CB-CD2 4.36Å; L56-L58 HydrophobicContact CB-CG 4.45Å; L56-V85 CarbonylContact O-C 3.59Å; L56-V85 VanDerWaalsContact O-CA 3.31Å; L56-V85 WeakPolarHBondContact O-CA 3.27Å; L56-C86 HydrophobicContact CB-CB 4Å; L56-C86 HydrophobicContact CG-CB 4.43Å; L56-C86 PolarHBondContact N-O 3.42Å; L56-C86 PolarHBondContact O-N 3.13Å; L56-I94 HydrophobicContact CD1-CD1 3.94Å; L56-I94 HydrophobicContact CD1-CG1 4.33Å; L56-I94 HydrophobicContact CD2-CD1 4.26Å
57	V	98.6	Very high	95.9	Very high	48 Å²	48	49 Å²	49	29%	0.291	27%	0.265	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	116.3	166.8	-175.2	0	0	0	0	107.2	K48 G49 L83 V84	K48-V57 HydrophobicContact CB-CB 4.36Å; K48-V57 HydrophobicContact CB-CG1 4.1Å; K48-V57 PolarHBondContact N-O 3.42Å; G49-V57 PolarHBondContact O-N 2.96Å; V57-L83 HydrophobicContact CG1-CD1 3.79Å; V57-V84 WeakPolarHBondContact CA-O 2.99Å
58	L	98.7	Very high	95.2	Very high	0 Å²	0	54.5 Å²	54.5	0%	0	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	131.4	179.4	-58.6	-175.1	0	0	0	110.1	I33 V35 V46 L47 L56 T61 L83 V84	I33-L58 HydrophobicContact CD1-CD2 3.89Å; I33-L58 HydrophobicContact CG1-CD2 3.94Å; V35-L58 HydrophobicContact CG2-CD1 4.23Å; V46-L58 WeakPolarHBondContact O-CA 3.48Å; L47-L58 HydrophobicContact CB-CD2 4.34Å; L47-L58 HydrophobicContact CD1-CD2 3.99Å; L56-L58 HydrophobicContact CB-CD2 4.36Å; L56-L58 HydrophobicContact CB-CG 4.45Å; L58-T61 WeakPolarHBondContact CB-OG1 3.26Å; L58-T61 HydrophobicContact CD1-CG2 4.43Å; L58-T61 PolarHBondContact O-OG1 2.78Å; L58-L83 CarbonylContact O-C 3.56Å; L58-L83 WeakPolarHBondContact O-CA 3.09Å; L58-V84 HydrophobicContact CB-CG2 4Å; L58-V84 PolarHBondContact N-O 2.95Å; L58-V84 PolarHBondContact O-N 3.37Å
59	D	98.6	Very high	94.7	Very high	68 Å²	68	57.9 Å²	57.9	36%	0.364	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	150.6	174.6	-171.1	20.6	0	0	0	111	V46 K48 T61 L83	V46-D59 PolarHBondContact N-O 2.84Å; V46-D59 PolarHBondContact O-N 2.82Å; K48-D59 HydrophobicContact CD-CB 4.24Å; K48-D59 HydrophobicContact CG-CB 3.6Å; D59-T61 PolarHBondContact O-N 2.8Å; D59-L83 HydrophobicContact CB-CD1 4.09Å
60	G	98.1	Very high	94	Very high	42 Å²	42	60.5 Å²	60.5	43%	0.433	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	57.1	37.6	-175.8	0	0	0	0	0	113.3	G82	G60-G82 PolarHBondContact N-O 3.33Å
61	T	98.5	Very high	93.1	Very high	1 Å²	1	62.7 Å²	62.7	1%	0.006	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.1	133.4	-168.6	-54.1	0	0	0	0	112.3	A43 S44 L58 D59 L81 G82 V84	A43-T61 HydrophobicContact CB-CG2 4.02Å; S44-T61 CarbonylContact O-C 3.47Å; S44-T61 VanDerWaalsContact O-CA 3.3Å; S44-T61 WeakPolarHBondContact O-CA 3.14Å; L58-T61 WeakPolarHBondContact CB-OG1 3.26Å; L58-T61 HydrophobicContact CD1-CG2 4.43Å; L58-T61 PolarHBondContact O-OG1 2.78Å; D59-T61 PolarHBondContact O-N 2.8Å; T61-L81 HydrophobicContact CG2-CD1 4.45Å; T61-L81 PolarHBondContact O-N 2.67Å; T61-G82 VanDerWaalsContact CB-O 3.27Å; T61-G82 WeakPolarHBondContact CB-O 3.34Å; T61-G82 PolarHBondContact N-O 2.85Å; T61-G82 PolarHBondContact O-N 3.36Å; T61-G82 PolarHBondContact OG1-O 2.91Å; T61-V84 HydrophobicContact CG2-CG2 3.86Å; T61-V84 WeakPolarHBondContact OG1-CG2 3.18Å
62	I	97.8	Very high	92.3	Very high	47 Å²	47	68.2 Å²	68.2	24%	0.241	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	122.1	175	-51.9	-175.3	0	0	0	108.3	A43 S44 T78 R79	A43-I62 CarbonylContact C-O 3.54Å; A43-I62 WeakPolarHBondContact CA-O 3.46Å; A43-I62 WeakPolarHBondContact CB-O 3.41Å; S44-I62 PolarHBondContact N-O 3.5Å; S44-I62 PolarHBondContact O-N 2.94Å; I62-T78 HydrophobicContact CG2-CG2 3.95Å; I62-R79 WeakPolarHBondContact CA-O 3.15Å
63	E	97.4	Very high	91.9	Very high	18 Å²	18	68.1 Å²	68.1	8%	0.084	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.4	136.7	167.2	170.4	175.7	-149.8	0	0	110.1	R41 M65 T78 R79 L81	R41-E63 IonicContact CZ-OE1 3.1Å; R41-E63 IonicContact NE-OE1 2.74Å; R41-E63 PolarHBondContact NE-OE1 2.82Å; R41-E63 IonicContact NH2-OE1 2.71Å; R41-E63 PolarHBondContact NH2-OE1 3.08Å; R41-E63 IonicContact NH2-OE2 2.94Å; R41-E63 PolarHBondContact NH2-OE2 3.18Å; E63-M65 HydrophobicContact CG-SD 4.28Å; E63-T78 CarbonylContact O-C 3.43Å; E63-T78 VanDerWaalsContact O-CA 3.24Å; E63-T78 WeakPolarHBondContact O-CA 3.42Å; E63-R79 HydrophobicContact CB-CB 4.37Å; E63-R79 PolarHBondContact N-O 3.29Å; E63-R79 PolarHBondContact O-N 3.1Å; E63-L81 HydrophobicContact CB-CD1 3.91Å; E63-L81 HydrophobicContact CB-CG 4.43Å
64	Y	95.2	Very high	91.5	Very high	48 Å²	48	64.9 Å²	64.9	19%	0.188	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	121.6	171.1	-59	-89.5	0	0	0	109	R34 E42 S44 T78	R34-Y64 VanDerWaalsContact NE-CE2 3.33Å; R34-Y64 VanDerWaalsContact NH2-CD1 3.31Å; R34-Y64 VanDerWaalsContact NH2-CE2 3.3Å; R34-Y64 VanDerWaalsContact NH2-CG 3.26Å; E42-Y64 HydrophobicContact CB-CD2 4.29Å; E42-Y64 HydrophobicContact CG-CD2 3.95Å; E42-Y64 PolarHBondContact O-N 3.12Å; S44-Y64 PolarHBondContact OG-OH 2.92Å; Y64-T78 HydrophobicContact CD1-CG2 3.8Å; Y64-T78 HydrophobicContact CE1-CG2 4.09Å
65	M	93.6	Very high	91.1	Very high	70 Å²	70	64.1 Å²	64.1	35%	0.345	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.9	157.4	-178.7	-56.8	-59	-69.1	0	0	110.3	E63 L74 T75 D77 R79	E63-M65 HydrophobicContact CG-SD 4.28Å; M65-L74 WeakPolarHBondContact O-CA 3.39Å; M65-T75 WeakPolarHBondContact CB-OG1 3.37Å; M65-T75 PolarHBondContact O-N 3.44Å; M65-T75 PolarHBondContact O-OG1 2.89Å; M65-D77 HydrophobicContact CB-CB 3.93Å; M65-D77 WeakPolarHBondContact CB-O 3.36Å; M65-D77 HydrophobicContact CG-CB 3.92Å; M65-D77 WeakPolarHBondContact CG-O 3.31Å; M65-D77 PolarHBondContact N-O 2.76Å; M65-R79 HydrophobicContact SD-CB 4.08Å
66	R	90.6	Very high	90.6	Very high	67 Å²	67	71.3 Å²	71.3	25%	0.253	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	152.2	-178	-67.5	-173.7	-69.5	149.7	-1.9	110.4	G39 G40 Q71 K73 L74	G39-R66 PolarHBondContact O-NH1 3.04Å; G39-R66 PolarHBondContact O-NH2 2.88Å; G40-R66 WeakPolarHBondContact O-CD 3.15Å; R66-Q71 WeakPolarHBondContact CD-O 3.32Å; R66-Q71 PolarHBondContact NH1-O 3.28Å; R66-K73 WeakPolarHBondContact CA-O 3.24Å; R66-L74 HydrophobicContact CG-CD2 4.11Å
67	D	87.9	Confident	90.3	Very high	37 Å²	37	76.7 Å²	76.7	20%	0.198	40%	0.401	C	S	.	.			trans	-64.4	127.9	175.4	-165	-47	0	0	0	108.9	D69 D70 K73 T75	D67-D69 PolarHBondContact O-N 3.38Å; D67-D69 PolarHBondContact OD1-N 2.94Å; D67-D70 HydrophobicContact CB-CB 4.39Å; D67-D70 WeakPolarHBondContact CB-O 3.33Å; D67-D70 CarbonylContact O-C 3.33Å; D67-D70 PolarHBondContact O-N 2.85Å; D67-D70 PolarHBondContact OD1-N 2.94Å; D67-K73 HydrophobicContact CB-CB 4.2Å; D67-K73 PolarHBondContact N-O 3.4Å; D67-T75 HydrophobicContact CB-CG2 4.13Å
68	P	84.4	Confident	90.1	Very high	115 Å²	115	78 Å²	78	75%	0.747	41%	0.41	S	S	*	.	S	Bend	trans	-59.7	-31.6	177	-21.9	32.7	0	0	0	112.9
69	D	87.7	Confident	90	Very high	160 Å²	160	85 Å²	85	86%	0.856	44%	0.436	S	S	*	.	S	Bend	trans	-91.7	-26.1	-175.5	-61.2	-41.2	0	0	0	111.8	D67	D67-D69 PolarHBondContact O-N 3.38Å; D67-D69 PolarHBondContact OD1-N 2.94Å
70	D	84.6	Confident	90	Very high	74 Å²	74	87.8 Å²	87.8	40%	0.396	45%	0.447	S	S	.	.			trans	-132.6	95.3	174.5	-173.3	-5.1	0	0	0	112.5	D67 L72 K73	D67-D70 HydrophobicContact CB-CB 4.39Å; D67-D70 WeakPolarHBondContact CB-O 3.33Å; D67-D70 CarbonylContact O-C 3.33Å; D67-D70 PolarHBondContact O-N 2.85Å; D67-D70 PolarHBondContact OD1-N 2.94Å; D70-L72 PolarHBondContact O-N 2.71Å; D70-L72 WeakPolarHBondContact OD1-CB 3.35Å; D70-L72 PolarHBondContact OD1-N 2.74Å; D70-K73 HydrophobicContact CB-CB 4.15Å; D70-K73 PolarHBondContact O-N 3.03Å
71	Q	77.1	Confident	90	Very high	124 Å²	124	88.7 Å²	88.7	58%	0.579	44%	0.442	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.8	-9.4	-178.8	-70.5	-168.8	47.1	0	0	115.3	R66	R66-Q71 WeakPolarHBondContact CD-O 3.32Å; R66-Q71 PolarHBondContact NH1-O 3.28Å
72	L	77.4	Confident	90	Very high	167 Å²	167	90 Å²	90	87%	0.874	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.1	-13.2	175.2	-59.8	177.8	0	0	0	112.4	D70	D70-L72 PolarHBondContact O-N 2.71Å; D70-L72 WeakPolarHBondContact OD1-CB 3.35Å; D70-L72 PolarHBondContact OD1-N 2.74Å
73	K	82.8	Confident	90	Very high	119 Å²	119	93.5 Å²	93.5	52%	0.517	47%	0.474	S	S	.	.	S	Bend	trans	-99.9	126.5	-178.5	-168.2	-179.3	174.4	-165	0	110.7	R66 D67 D70	R66-K73 WeakPolarHBondContact CA-O 3.24Å; D67-K73 HydrophobicContact CB-CB 4.2Å; D67-K73 PolarHBondContact N-O 3.4Å; D70-K73 HydrophobicContact CB-CB 4.15Å; D70-K73 PolarHBondContact O-N 3.03Å
74	L	83.5	Confident	90	Very high	61 Å²	61	94.1 Å²	94.1	32%	0.319	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.4	141.7	167.1	-63.9	175.5	0	0	0	109.4	E42 M65 R66	E42-L74 HydrophobicContact CB-CD2 4.27Å; E42-L74 WeakPolarHBondContact OE2-CD1 3.39Å; M65-L74 WeakPolarHBondContact O-CA 3.39Å; R66-L74 HydrophobicContact CG-CD2 4.11Å
75	T	86.3	Confident	90.2	Very high	39 Å²	39	97.1 Å²	97.1	24%	0.239	50%	0.502	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	171.9	165.2	63.8	0	0	0	0	109.8	M65 D67 D77	M65-T75 WeakPolarHBondContact CB-OG1 3.37Å; M65-T75 PolarHBondContact O-N 3.44Å; M65-T75 PolarHBondContact O-OG1 2.89Å; D67-T75 HydrophobicContact CB-CG2 4.13Å; T75-D77 PolarHBondContact O-N 2.83Å; T75-D77 PolarHBondContact OG1-N 3.1Å
76	E	86.4	Confident	90.4	Very high	193 Å²	193	94.2 Å²	94.2	90%	0.902	49%	0.489	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.2	-11.7	171.2	-61.6	-171.2	167.7	0	0	112.2
77	D	90.8	Very high	90.7	Very high	112 Å²	112	99.2 Å²	99.2	60%	0.599	51%	0.508	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-71.5	135.2	-179.2	-64.4	-36.7	0	0	0	111.1	M65 T75	M65-D77 HydrophobicContact CB-CB 3.93Å; M65-D77 WeakPolarHBondContact CB-O 3.36Å; M65-D77 HydrophobicContact CG-CB 3.92Å; M65-D77 WeakPolarHBondContact CG-O 3.31Å; M65-D77 PolarHBondContact N-O 2.76Å; T75-D77 PolarHBondContact O-N 2.83Å; T75-D77 PolarHBondContact OG1-N 3.1Å
78	T	95.6	Very high	91.1	Very high	77 Å²	77	97.9 Å²	97.9	47%	0.472	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	152.7	176.7	59.9	0	0	0	0	111.1	I62 E63 Y64	I62-T78 HydrophobicContact CG2-CG2 3.95Å; E63-T78 CarbonylContact O-C 3.43Å; E63-T78 VanDerWaalsContact O-CA 3.24Å; E63-T78 WeakPolarHBondContact O-CA 3.42Å; Y64-T78 HydrophobicContact CD1-CG2 3.8Å; Y64-T78 HydrophobicContact CE1-CG2 4.09Å
79	R	96.8	Very high	91.7	Very high	146 Å²	146	97.1 Å²	97.1	55%	0.551	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.3	125.6	178.5	-176.5	-178.4	-176.6	-175.4	4.2	110.7	I62 E63 M65 L81	I62-R79 WeakPolarHBondContact CA-O 3.15Å; E63-R79 HydrophobicContact CB-CB 4.37Å; E63-R79 PolarHBondContact N-O 3.29Å; E63-R79 PolarHBondContact O-N 3.1Å; M65-R79 HydrophobicContact SD-CB 4.08Å; R79-L81 HydrophobicContact CG-CD2 4.09Å
80	Q	97.8	Very high	92.1	Very high	127 Å²	127	91.5 Å²	91.5	59%	0.593	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.4	129.5	172.9	-65.3	-65.3	-25.7	0	0	110.6
81	L	97.9	Very high	92.7	Very high	61 Å²	61	89.2 Å²	89.2	32%	0.319	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	-17.9	179.2	-58.9	178.7	0	0	0	113	T61 E63 R79 V84	T61-L81 HydrophobicContact CG2-CD1 4.45Å; T61-L81 PolarHBondContact O-N 2.67Å; E63-L81 HydrophobicContact CB-CD1 3.91Å; E63-L81 HydrophobicContact CB-CG 4.43Å; R79-L81 HydrophobicContact CG-CD2 4.09Å; L81-V84 HydrophobicContact CB-CG1 3.64Å; L81-V84 HydrophobicContact CD1-CG1 4.43Å
82	G	98.1	Very high	93.6	Very high	29 Å²	29	87.9 Å²	87.9	30%	0.299	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	72.3	-131.8	-178.5	0	0	0	0	0	112.3	G60 T61	G60-G82 PolarHBondContact N-O 3.33Å; T61-G82 VanDerWaalsContact CB-O 3.27Å; T61-G82 WeakPolarHBondContact CB-O 3.34Å; T61-G82 PolarHBondContact N-O 2.85Å; T61-G82 PolarHBondContact O-N 3.36Å; T61-G82 PolarHBondContact OG1-O 2.91Å
83	L	98.4	Very high	94.4	Very high	119 Å²	119	83.8 Å²	83.8	62%	0.623	44%	0.437	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.5	119.9	178.8	-177.3	66.8	0	0	0	110.7	V57 L58 D59	V57-L83 HydrophobicContact CG1-CD1 3.79Å; L58-L83 CarbonylContact O-C 3.56Å; L58-L83 WeakPolarHBondContact O-CA 3.09Å; D59-L83 HydrophobicContact CB-CD1 4.09Å
84	V	98.3	Very high	95	Very high	32 Å²	32	79.5 Å²	79.5	19%	0.194	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	157	-178.2	-51.5	0	0	0	0	112.3	V57 L58 T61 L81	V57-V84 WeakPolarHBondContact CA-O 2.99Å; L58-V84 HydrophobicContact CB-CG2 4Å; L58-V84 PolarHBondContact N-O 2.95Å; L58-V84 PolarHBondContact O-N 3.37Å; T61-V84 HydrophobicContact CG2-CG2 3.86Å; T61-V84 WeakPolarHBondContact OG1-CG2 3.18Å; L81-V84 HydrophobicContact CB-CG1 3.64Å; L81-V84 HydrophobicContact CD1-CG1 4.43Å
85	V	98.1	Very high	95.5	Very high	110 Å²	110	77.4 Å²	77.4	67%	0.667	41%	0.409	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.5	119.8	166.5	-177.8	0	0	0	0	109	L56	L56-V85 CarbonylContact O-C 3.59Å; L56-V85 VanDerWaalsContact O-CA 3.31Å; L56-V85 WeakPolarHBondContact O-CA 3.27Å
86	C	97.7	Very high	95.8	Very high	10 Å²	10	78 Å²	78	7%	0.068	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	132.3	174.9	-56.2	0	0	0	0	109.8	F37 N55 L56 G88	F37-C86 HydrophobicContact CE1-CB 3.84Å; F37-C86 HydrophobicContact CZ-CB 3.77Å; N55-C86 CarbonylContact C-O 3.6Å; N55-C86 VanDerWaalsContact CA-O 3.24Å; N55-C86 WeakPolarHBondContact CA-O 3.34Å; L56-C86 HydrophobicContact CB-CB 4Å; L56-C86 HydrophobicContact CG-CB 4.43Å; L56-C86 PolarHBondContact N-O 3.42Å; L56-C86 PolarHBondContact O-N 3.13Å; C86-G88 PolarHBondContact O-N 2.73Å
87	R	97.8	Very high	95.9	Very high	171 Å²	171	72.7 Å²	72.7	65%	0.645	39%	0.389	S	S	*	.			trans	-83.1	117.3	179.3	-166.7	-174.8	175.5	108.5	-0.9	110.7	T89 S90	R87-T89 VanDerWaalsContact CD-OG1 3.31Å; R87-T89 WeakPolarHBondContact CD-OG1 3.44Å; R87-T89 WeakPolarHBondContact CG-OG1 3.47Å; R87-T89 PolarHBondContact NE-OG1 3.46Å; R87-T89 PolarHBondContact O-N 2.99Å; R87-S90 PolarHBondContact O-N 2.88Å; R87-S90 VanDerWaalsContact O-N 3.08Å
88	G	96.1	Very high	95.6	Very high	9 Å²	9	74.6 Å²	74.6	9%	0.093	40%	0.399	C	S	.	.	G	3₁₀ helix	trans	-60.8	-28.6	-174.3	0	0	0	0	0	114.8	L53 L54 N55 C86 S90 V91	L53-G88 WeakPolarHBondContact O-CA 3.49Å; L54-G88 VanDerWaalsContact C-CA 3.45Å; L54-G88 WeakPolarHBondContact O-CA 3.49Å; N55-G88 PolarHBondContact OD1-N 3.04Å; C86-G88 PolarHBondContact O-N 2.73Å; G88-S90 PolarHBondContact O-N 3.42Å; G88-S90 VanDerWaalsContact O-N 3.1Å; G88-V91 PolarHBondContact O-N 3.32Å; G88-V91 VanDerWaalsContact O-N 3.1Å
89	T	96.6	Very high	95	Very high	99 Å²	99	74.8 Å²	74.8	61%	0.607	42%	0.416	S	S	*	.	G	3₁₀ helix	trans	-61.1	-22.4	176.5	57.6	0	0	0	0	113.9	R87	R87-T89 VanDerWaalsContact CD-OG1 3.31Å; R87-T89 WeakPolarHBondContact CD-OG1 3.44Å; R87-T89 WeakPolarHBondContact CG-OG1 3.47Å; R87-T89 PolarHBondContact NE-OG1 3.46Å; R87-T89 PolarHBondContact O-N 2.99Å
90	S	96.5	Very high	94.4	Very high	42 Å²	42	72.4 Å²	72.4	29%	0.294	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-105.8	-1.9	-179.2	-58.6	0	0	0	0	112.4	F37 Q38 R87 G88	F37-S90 CarbonylContact C-O 3.58Å; F37-S90 WeakPolarHBondContact CA-O 3.3Å; Q38-S90 PolarHBondContact N-O 3Å; R87-S90 PolarHBondContact O-N 2.88Å; R87-S90 VanDerWaalsContact O-N 3.08Å; G88-S90 PolarHBondContact O-N 3.42Å; G88-S90 VanDerWaalsContact O-N 3.1Å
91	V	96.3	Very high	93.8	Very high	27 Å²	27	74.1 Å²	74.1	16%	0.164	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.9	128	178.3	174.7	0	0	0	0	109.1	V35 F37 G88 I94	V35-V91 HydrophobicContact CG1-CG1 3.99Å; V35-V91 HydrophobicContact CG1-CG2 4.15Å; F37-V91 HydrophobicContact CD1-CG2 4.2Å; F37-V91 HydrophobicContact CE1-CG2 3.82Å; G88-V91 PolarHBondContact O-N 3.32Å; G88-V91 VanDerWaalsContact O-N 3.1Å; V91-I94 HydrophobicContact CG1-CD1 4.01Å; V91-I94 HydrophobicContact CG1-CG1 3.68Å
92	V	96	Very high	93.1	Very high	96 Å²	96	76 Å²	76	58%	0.582	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.9	-29.5	176.4	-66.8	0	0	0	0	112.7	K36 Q38	K36-V92 VanDerWaalsContact C-CG2 3.49Å; K36-V92 HydrophobicContact CB-CG2 3.76Å; K36-V92 WeakPolarHBondContact O-CG2 3.32Å; K36-V92 PolarHBondContact O-N 3.14Å; Q38-V92 HydrophobicContact CB-CG1 4.04Å
93	L	94.4	Very high	92.7	Very high	80 Å²	80	80.2 Å²	80.2	42%	0.419	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.8	140	179.3	-179.6	133.1	0	0	0	110.4	V35 K36 C95	V35-L93 WeakPolarHBondContact CA-O 3.39Å; K36-L93 HydrophobicContact CB-CB 4.19Å; K36-L93 HydrophobicContact CD-CD2 4.41Å; K36-L93 HydrophobicContact CG-CD2 4.39Å; K36-L93 PolarHBondContact N-O 2.81Å; K36-L93 PolarHBondContact O-N 3.11Å; L93-C95 HydrophobicContact CD2-CB 4.09Å
94	I	95.2	Very high	92.1	Very high	30 Å²	30	80 Å²	80	15%	0.154	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	129.8	169.6	-57.9	172.2	0	0	0	106.8	F23 L25 I33 V35 L56 V91	F23-I94 HydrophobicContact CE1-CB 4.32Å; F23-I94 HydrophobicContact CE1-CG2 4.27Å; L25-I94 HydrophobicContact CD1-CD1 4.3Å; L25-I94 HydrophobicContact CD2-CD1 4.08Å; L25-I94 HydrophobicContact CD2-CG2 4.15Å; I33-I94 HydrophobicContact CB-CG2 4.42Å; I33-I94 HydrophobicContact CD1-CG2 3.85Å; V35-I94 HydrophobicContact CG1-CG1 4.37Å; V35-I94 HydrophobicContact CG2-CG1 4.48Å; L56-I94 HydrophobicContact CD1-CD1 3.94Å; L56-I94 HydrophobicContact CD1-CG1 4.33Å; L56-I94 HydrophobicContact CD2-CD1 4.26Å; V91-I94 HydrophobicContact CG1-CD1 4.01Å; V91-I94 HydrophobicContact CG1-CG1 3.68Å
95	C	93.7	Very high	91.6	Very high	17 Å²	17	82.7 Å²	82.7	12%	0.115	48%	0.478	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	142.4	175.8	52.8	0	0	0	0	110.7	I33 R34 L93 M100	I33-C95 CarbonylContact C-O 3.53Å; I33-C95 WeakPolarHBondContact CA-O 3.34Å; I33-C95 WeakPolarHBondContact CB-O 3.49Å; R34-C95 PolarHBondContact N-O 3.45Å; R34-C95 PolarHBondContact O-N 2.95Å; R34-C95 PolarHBondContact O-SG 3.08Å; L93-C95 HydrophobicContact CD2-CB 4.09Å; C95-M100 HydrophobicContact CB-CE 4.21Å; C95-M100 WeakPolarHBondContact SG-CE 3.47Å
96	P	93.9	Very high	91.1	Very high	50 Å²	50	81.8 Å²	81.8	33%	0.325	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.9	140.9	166.5	26.9	-31.6	0	0	0	109	Y28 D98	Y28-P96 HydrophobicContact CD1-CB 4.08Å; Y28-P96 HydrophobicContact CE1-CB 3.72Å; Y28-P96 HydrophobicContact CE1-CG 3.98Å; P96-D98 VanDerWaalsContact C-N 3.31Å
97	Q	87.1	Confident	90.6	Very high	82 Å²	82	89.8 Å²	89.8	38%	0.383	51%	0.509	S	S	.	.	S	Bend	trans	-75.6	-27.5	174.1	-170.8	168.5	-49.9	0	0	111.5	T32 S44 G99 M100	T32-Q97 HydrophobicContact CG2-CB 4.22Å; T32-Q97 WeakPolarHBondContact O-CB 3.41Å; T32-Q97 PolarHBondContact O-N 3.42Å; T32-Q97 VanDerWaalsContact O-N 3.1Å; S44-Q97 PolarHBondContact OG-OE1 3.46Å; Q97-G99 PolarHBondContact O-N 3.43Å; Q97-M100 PolarHBondContact O-N 2.9Å
98	D	86.3	Confident	89.9	Confident	152 Å²	152	87.2 Å²	87.2	81%	0.813	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	126.8	176	-168.7	21.4	0	0	0	110.9	P96 M100	P96-D98 VanDerWaalsContact C-N 3.31Å; D98-M100 VanDerWaalsContact C-N 3.32Å
99	G	82	Confident	88.9	Confident	81 Å²	81	94.5 Å²	94.5	84%	0.835	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.5	4.6	-174.4	0	0	0	0	0	115.8	Q97	Q97-G99 PolarHBondContact O-N 3.43Å
100	M	83.9	Confident	87.4	Confident	96 Å²	96	98 Å²	98	47%	0.473	55%	0.548	S	S	.	.			trans	-88.3	120.4	171.3	178.8	179.1	-96.2	0	0	110.3	C95 Q97 D98	C95-M100 HydrophobicContact CB-CE 4.21Å; C95-M100 WeakPolarHBondContact SG-CE 3.47Å; Q97-M100 PolarHBondContact O-N 2.9Å; D98-M100 VanDerWaalsContact C-N 3.32Å
101	E	86.1	Confident	85.5	Confident	163 Å²	163	104.2 Å²	104.2	76%	0.762	57%	0.572	S	S	*	*			trans	-131.6	139.5	174.1	-174.3	174.4	-173	0	0	110.3	I103	E101-I103 PolarHBondContact O-N 3.33Å
102	A	83.2	Confident	83.5	Confident	100 Å²	100	109.8 Å²	109.8	83%	0.826	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-75.5	116.4	170.9	0	0	0	0	0	108.9
103	I	88.2	Confident	81.2	Confident	118 Å²	118	112.4 Å²	112.4	61%	0.605	65%	0.647	S	S	*	*	P	Polyproline II helix	trans	-103.5	151.3	178	61.9	170	0	0	0	110.8	E101	E101-I103 PolarHBondContact O-N 3.33Å
104	P	87.4	Confident	80.5	Confident	114 Å²	114	114.1 Å²	114.1	74%	0.74	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-60.2	157.5	166.5	28	-34.9	0	0	0	110.1	P106	P104-P106 VanDerWaalsContact O-CD 3.27Å; P104-P106 WeakPolarHBondContact O-CD 3.39Å
105	N	87.3	Confident	79.7	Confident	89 Å²	89	118.5 Å²	118.5	48%	0.476	69%	0.685	S	S	.	*			trans	-56.5	114.8	178	177.2	-8.5	0	0	0	110.1	F107 I108	N105-F107 PolarHBondContact O-N 3.27Å; N105-F107 VanDerWaalsContact O-N 3.14Å; N105-F107 WeakPolarHBondContact OD1-CB 3.42Å; N105-F107 WeakPolarHBondContact OD1-CD2 3.4Å; N105-F107 PolarHBondContact OD1-N 2.99Å; N105-I108 HydrophobicContact CB-CD1 3.74Å; N105-I108 HydrophobicContact CB-CG1 3.87Å; N105-I108 PolarHBondContact O-N 2.94Å
106	P	88.5	Confident	78.9	Confident	92 Å²	92	124.1 Å²	124.1	60%	0.597	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.5	-6	-172.5	31	-36.4	0	0	0	113.4	P104	P104-P106 VanDerWaalsContact O-CD 3.27Å; P104-P106 WeakPolarHBondContact O-CD 3.39Å
107	F	85.5	Confident	78.1	Confident	177 Å²	177	128.5 Å²	128.5	78%	0.776	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.3	-2.7	-179.8	-55.3	-72.2	0	0	0	113.5	N105 Q109	N105-F107 PolarHBondContact O-N 3.27Å; N105-F107 VanDerWaalsContact O-N 3.14Å; N105-F107 WeakPolarHBondContact OD1-CB 3.42Å; N105-F107 WeakPolarHBondContact OD1-CD2 3.4Å; N105-F107 PolarHBondContact OD1-N 2.99Å; F107-Q109 PolarHBondContact O-N 2.98Å; F107-Q109 VanDerWaalsContact O-N 3.14Å
108	I	84.3	Confident	77.5	Confident	117 Å²	117	131.4 Å²	131.4	60%	0.6	76%	0.762	S	S	*	*	S	Bend	trans	-75.9	103.6	170.5	-56.3	176	0	0	0	106.5	N105 Q110	N105-I108 HydrophobicContact CB-CD1 3.74Å; N105-I108 HydrophobicContact CB-CG1 3.87Å; N105-I108 PolarHBondContact O-N 2.94Å; I108-Q110 PolarHBondContact O-N 3.33Å; I108-Q110 VanDerWaalsContact O-N 3.11Å
109	Q	73.6	Confident	76.9	Confident	163 Å²	163	130 Å²	130	76%	0.762	76%	0.759	S	S	*	*			trans	-58	117.5	170	-73.2	176.5	-5.3	0	0	107.7	F107 H111	F107-Q109 PolarHBondContact O-N 2.98Å; F107-Q109 VanDerWaalsContact O-N 3.14Å; Q109-H111 VanDerWaalsContact C-N 3.32Å; Q109-H111 PolarHBondContact O-N 2.89Å
110	Q	65.6	Low	76.6	Confident	173 Å²	173	133.5 Å²	133.5	81%	0.808	75%	0.754	S	S	*	*			trans	-61.6	100	167.2	-69.2	178.2	-3	0	0	106.1	I108 D112	I108-Q110 PolarHBondContact O-N 3.33Å; I108-Q110 VanDerWaalsContact O-N 3.11Å; Q110-D112 PolarHBondContact O-N 2.97Å
111	H	57.4	Low	76	Confident	171 Å²	171	136.4 Å²	136.4	79%	0.792	78%	0.775	S	S	*	*			trans	-67.7	96.2	164	-94.4	84.1	0	0	0	105.6	Q109 G113	Q109-H111 VanDerWaalsContact C-N 3.32Å; Q109-H111 PolarHBondContact O-N 2.89Å; H111-G113 PolarHBondContact O-N 3.14Å
112	D	54.3	Low	75.2	Confident	145 Å²	145	134.2 Å²	134.2	78%	0.775	78%	0.776	S	S	*	*			trans	-56.5	124.6	161.8	-72.6	-36	0	0	0	107.4	Q110	Q110-D112 PolarHBondContact O-N 2.97Å
113	G	46.6	Very low	74.4	Confident	151 Å²	151	137.3 Å²	137.3	100%	1.557	77%	0.772	S	S	*	*			trans	-70	0	179.2	0	0	0	0	0	113.7	H111	H111-G113 PolarHBondContact O-N 3.14Å

Retrieved 113 of 113 residues in 18.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).