A0A087Y3Q7_POEFO Loading...

N-alpha-acetyltransferase 38, NatC auxiliary subunit

AlphaFold DB , UniProt , Accession A0A087Y3Q7, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 109 aa.

						>A0A087Y3Q7_POEFO|A0A087Y3Q7
MIEENGPSAHEQREVSSSSQARQKLEGLLNKNMRIRMTDGRTLVGLFLCTDRDCNVILGSAQEFLKSSDTFSQGEPRVLGLAMIPGHHVVSIEVEADSLEDADGFGANH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.3	Very low	50.3	Low	232 Å²	232	149.2 Å²	149.2	100%	1.143	82%	0.819	S	S	*	*				0	87.8	0	-82.7	167.9	165.5	0	0	105.3
2	I	51.3	Low	50	Low	157 Å²	157	150.4 Å²	150.4	81%	0.805	82%	0.815	S	S	*	*				35.5	101.4	66.2	-38.8	171.7	0	0	0	109.7
3	E	47.5	Very low	50.7	Low	186 Å²	186	155.8 Å²	155.8	87%	0.869	82%	0.816	S	S	*	*				-146.5	113.8	114.1	-68.5	-156.1	146	0	0	109
4	E	59.2	Low	51.3	Low	170 Å²	170	158.2 Å²	158.2	79%	0.794	82%	0.821	S	S	*	*			trans	-73.4	140.1	161.7	-176	-165.3	176.3	0	0	107.9
5	N	52.9	Low	51.7	Low	156 Å²	156	152 Å²	152	83%	0.834	79%	0.793	S	S	*	*			trans	-148.9	106.1	151.9	-93.3	-60.8	0	0	0	108.9
6	G	54.3	Low	53.1	Low	53 Å²	53	146.4 Å²	146.4	55%	0.546	77%	0.771	S	S	.	*			trans	-70.3	-174	-179.9	0	0	0	0	0	114.1	S8	G6-S8 PolarHBondContact O-N 3.24Å
7	P	50.5	Low	54.3	Low	135 Å²	135	143.7 Å²	143.7	88%	0.877	77%	0.767	S	S	*	*			trans	-71.6	118.8	-172.3	29.7	-31.4	0	0	0	109.8	A9	P7-A9 PolarHBondContact O-N 2.89Å
8	S	47.8	Very low	55.4	Low	115 Å²	115	140.3 Å²	140.3	80%	0.804	76%	0.756	S	S	*	*			trans	-71.7	111.2	170.6	177	0	0	0	0	108.9	G6 H10	G6-S8 PolarHBondContact O-N 3.24Å; S8-H10 PolarHBondContact O-N 3.01Å
9	A	53.5	Low	57	Low	85 Å²	85	134.6 Å²	134.6	70%	0.702	73%	0.728	S	S	*	*			trans	-63.1	111.1	175.1	0	0	0	0	0	111.1	P7	P7-A9 PolarHBondContact O-N 2.89Å
10	H	47	Very low	58.8	Low	163 Å²	163	132.6 Å²	132.6	76%	0.755	71%	0.714	S	S	*	*			trans	-150.3	70	147.6	-96	-67.7	0	0	0	108.3	S8 Q12	S8-H10 PolarHBondContact O-N 3.01Å; H10-Q12 PolarHBondContact O-N 2.91Å
11	E	46.6	Very low	60.3	Low	189 Å²	189	128.7 Å²	128.7	88%	0.883	70%	0.7	S	S	*	*			trans	-65.8	86	156.1	-86.1	177.6	110.8	0	0	107.7	R13	E11-R13 PolarHBondContact O-N 3.26Å
12	Q	47.3	Very low	62.8	Low	164 Å²	164	124.6 Å²	124.6	77%	0.766	67%	0.672	S	S	*	*			trans	-64.6	94.6	159.3	-68.9	-179.5	-0.1	0	0	106.3	H10 E14	H10-Q12 PolarHBondContact O-N 2.91Å; Q12-E14 PolarHBondContact O-N 3.2Å
13	R	58.7	Low	64.9	Low	220 Å²	220	122.3 Å²	122.3	83%	0.83	66%	0.657	S	S	*	*			trans	-58.6	103.4	168.8	-83.8	-178.1	175	-177.8	-1	107.4	E11 V15	E11-R13 PolarHBondContact O-N 3.26Å; R13-V15 PolarHBondContact O-N 3.08Å
14	E	58.9	Low	67.1	Low	190 Å²	190	120.6 Å²	120.6	89%	0.888	65%	0.647	S	S	*	*			trans	-62.2	99.3	167.8	-71.4	-166.7	155.4	0	0	108.3	Q12 S16	Q12-E14 PolarHBondContact O-N 3.2Å; E14-S16 PolarHBondContact O-N 3.07Å
15	V	58	Low	68.8	Low	65 Å²	65	116.3 Å²	116.3	39%	0.394	63%	0.629	S	S	.	*			trans	-71.1	98.9	175.4	-177.7	0	0	0	0	106.8	R13 S19 Q20	R13-V15 PolarHBondContact O-N 3.08Å; V15-S19 WeakPolarHBondContact CG1-OG 2.94Å; V15-Q20 HydrophobicContact CB-CG 4.45Å; V15-Q20 HydrophobicContact CG1-CG 3.72Å; V15-Q20 PolarHBondContact O-NE2 3.01Å; V15-Q20 VanDerWaalsContact O-NE2 3.07Å
16	S	73.4	Confident	70.8	Confident	63 Å²	63	112.7 Å²	112.7	44%	0.441	61%	0.607	S	S	.	*			trans	-50.8	150.1	178.4	67.4	0	0	0	0	111.5	E14 S18 S19 Q20	E14-S16 PolarHBondContact O-N 3.07Å; S16-S18 PolarHBondContact O-N 3.17Å; S16-S18 VanDerWaalsContact O-N 3.08Å; S16-S18 PolarHBondContact OG-OG 2.9Å; S16-S18 VanDerWaalsContact OG-OG 3.11Å; S16-S19 PolarHBondContact N-OG 3.11Å; S16-S19 VanDerWaalsContact N-OG 3.17Å; S16-S19 PolarHBondContact O-N 2.99Å; S16-S19 PolarHBondContact O-OG 3.37Å; S16-S19 PolarHBondContact OG-OG 2.91Å; S16-Q20 PolarHBondContact O-N 3.18Å
17	S	73.7	Confident	72.8	Confident	100 Å²	100	112.3 Å²	112.3	70%	0.699	60%	0.603	S	S	*	*	H	α-helix	trans	-53.1	-34.2	-179	58.4	0	0	0	0	113.8	Q20 A21	S17-Q20 PolarHBondContact O-N 2.66Å; S17-A21 PolarHBondContact O-N 3.27Å
18	S	74.5	Confident	75	Confident	83 Å²	83	108.5 Å²	108.5	58%	0.58	58%	0.575	S	S	*	*	H	α-helix	trans	-65.8	-37.5	175.9	59.9	0	0	0	0	112.6	S16 A21 R22	S16-S18 PolarHBondContact O-N 3.17Å; S16-S18 VanDerWaalsContact O-N 3.08Å; S16-S18 PolarHBondContact OG-OG 2.9Å; S16-S18 VanDerWaalsContact OG-OG 3.11Å; S18-A21 PolarHBondContact O-N 3.45Å; S18-R22 WeakPolarHBondContact O-CB 3.44Å; S18-R22 PolarHBondContact O-N 3.43Å
19	S	86.2	Confident	77.3	Confident	31 Å²	31	106.4 Å²	106.4	22%	0.217	56%	0.555	C	S	.	*	H	α-helix	trans	-71.3	-33.6	176.3	61.3	0	0	0	0	112.5	V15 S16 R22 Q23	V15-S19 WeakPolarHBondContact CG1-OG 2.94Å; S16-S19 PolarHBondContact N-OG 3.11Å; S16-S19 VanDerWaalsContact N-OG 3.17Å; S16-S19 PolarHBondContact O-N 2.99Å; S16-S19 PolarHBondContact O-OG 3.37Å; S16-S19 PolarHBondContact OG-OG 2.91Å; S19-R22 PolarHBondContact O-N 2.99Å; S19-Q23 VanDerWaalsContact O-CG 3.25Å; S19-Q23 WeakPolarHBondContact O-CG 3.25Å; S19-Q23 PolarHBondContact O-N 2.95Å
20	Q	92.3	Very high	79.4	Confident	95 Å²	95	107.7 Å²	107.7	44%	0.444	55%	0.55	S	S	.	.	H	α-helix	trans	-67.5	-41.9	171.3	-61.9	-178.1	33.3	0	0	112.2	V15 S16 S17 R22 Q23 K24	V15-Q20 HydrophobicContact CB-CG 4.45Å; V15-Q20 HydrophobicContact CG1-CG 3.72Å; V15-Q20 PolarHBondContact O-NE2 3.01Å; V15-Q20 VanDerWaalsContact O-NE2 3.07Å; S16-Q20 PolarHBondContact O-N 3.18Å; S17-Q20 PolarHBondContact O-N 2.66Å; Q20-R22 VanDerWaalsContact C-N 3.34Å; Q20-Q23 PolarHBondContact O-N 2.93Å; Q20-K24 WeakPolarHBondContact O-CG 3.5Å; Q20-K24 PolarHBondContact O-N 3.31Å
21	A	91.1	Very high	81.8	Confident	51 Å²	51	102.2 Å²	102.2	42%	0.421	52%	0.524	S	S	.	.	H	α-helix	trans	-63	-41.2	175.8	0	0	0	0	0	111.8	S17 S18 K24 L25	S17-A21 PolarHBondContact O-N 3.27Å; S18-A21 PolarHBondContact O-N 3.45Å; A21-K24 WeakPolarHBondContact O-CB 3.33Å; A21-K24 PolarHBondContact O-N 2.96Å; A21-L25 PolarHBondContact O-N 3.37Å
22	R	93.1	Very high	84.2	Confident	146 Å²	146	96.1 Å²	96.1	55%	0.551	50%	0.497	S	S	*	.	H	α-helix	trans	-60.4	-48.4	174.2	-163.9	-177.4	93	80	14.5	111.5	S18 S19 Q20 K24 L25 E26	S18-R22 WeakPolarHBondContact O-CB 3.44Å; S18-R22 PolarHBondContact O-N 3.43Å; S19-R22 PolarHBondContact O-N 2.99Å; Q20-R22 VanDerWaalsContact C-N 3.34Å; R22-K24 VanDerWaalsContact C-N 3.29Å; R22-K24 PolarHBondContact O-N 2.66Å; R22-L25 PolarHBondContact O-N 3.49Å; R22-L25 VanDerWaalsContact O-N 3.15Å; R22-E26 VanDerWaalsContact CZ-CD 3.45Å; R22-E26 IonicContact CZ-OE1 2.93Å; R22-E26 IonicContact CZ-OE2 3.55Å; R22-E26 IonicContact NH1-OE1 2.66Å; R22-E26 PolarHBondContact NH1-OE1 2.97Å; R22-E26 IonicContact NH1-OE2 2.68Å; R22-E26 IonicContact NH2-OE1 2.69Å; R22-E26 PolarHBondContact NH2-OE1 3.48Å; R22-E26 IonicContact NH2-OE2 2.69Å; R22-E26 PolarHBondContact NH2-OE2 2.95Å; R22-E26 WeakPolarHBondContact O-CG 3.48Å; R22-E26 PolarHBondContact O-N 3.37Å
23	Q	95.6	Very high	86.7	Confident	109 Å²	109	88.6 Å²	88.6	51%	0.509	46%	0.462	S	S	.	.	H	α-helix	trans	-59.7	-39.4	177.2	-73.8	167.4	11.7	0	0	112.2	S19 Q20 E26 G27	S19-Q23 VanDerWaalsContact O-CG 3.25Å; S19-Q23 WeakPolarHBondContact O-CG 3.25Å; S19-Q23 PolarHBondContact O-N 2.95Å; Q20-Q23 PolarHBondContact O-N 2.93Å; Q23-E26 PolarHBondContact O-N 3.2Å; Q23-G27 PolarHBondContact O-N 3.41Å
24	K	93.9	Very high	88.5	Confident	149 Å²	149	83.2 Å²	83.2	65%	0.648	44%	0.442	S	S	*	.	H	α-helix	trans	-60.9	-47.8	173.8	-72.8	174.7	-176.1	-178.4	0	111.5	Q20 A21 R22 E26 G27 L28	Q20-K24 WeakPolarHBondContact O-CG 3.5Å; Q20-K24 PolarHBondContact O-N 3.31Å; A21-K24 WeakPolarHBondContact O-CB 3.33Å; A21-K24 PolarHBondContact O-N 2.96Å; R22-K24 VanDerWaalsContact C-N 3.29Å; R22-K24 PolarHBondContact O-N 2.66Å; K24-E26 VanDerWaalsContact C-N 3.34Å; K24-E26 PolarHBondContact O-N 2.69Å; K24-G27 PolarHBondContact O-N 3.32Å; K24-L28 WeakPolarHBondContact O-CG 3.41Å; K24-L28 PolarHBondContact O-N 3.26Å
25	L	95.1	Very high	90.4	Very high	81 Å²	81	74.2 Å²	74.2	42%	0.424	40%	0.4	S	S	.	.	H	α-helix	trans	-63.3	-39.5	177.2	-70.7	174.4	0	0	0	112.3	A21 R22 G27 L28 T50	A21-L25 PolarHBondContact O-N 3.37Å; R22-L25 PolarHBondContact O-N 3.49Å; R22-L25 VanDerWaalsContact O-N 3.15Å; L25-G27 VanDerWaalsContact C-N 3.32Å; L25-G27 PolarHBondContact O-N 3.18Å; L25-L28 HydrophobicContact CD2-CD1 4.44Å; L25-L28 WeakPolarHBondContact O-CB 3.39Å; L25-L28 PolarHBondContact O-N 3.04Å; L25-L28 VanDerWaalsContact O-N 3.11Å; L25-T50 HydrophobicContact CD1-CG2 4.33Å; L25-T50 HydrophobicContact CD2-CG2 4.3Å
26	E	95.8	Very high	92.3	Very high	80 Å²	80	75.8 Å²	75.8	37%	0.374	40%	0.398	S	S	.	.	H	α-helix	trans	-61.1	-41.6	174.7	-73.5	179.5	140.7	0	0	111.8	R22 Q23 K24 L28 L29	R22-E26 VanDerWaalsContact CZ-CD 3.45Å; R22-E26 IonicContact CZ-OE1 2.93Å; R22-E26 IonicContact CZ-OE2 3.55Å; R22-E26 IonicContact NH1-OE1 2.66Å; R22-E26 PolarHBondContact NH1-OE1 2.97Å; R22-E26 IonicContact NH1-OE2 2.68Å; R22-E26 IonicContact NH2-OE1 2.69Å; R22-E26 PolarHBondContact NH2-OE1 3.48Å; R22-E26 IonicContact NH2-OE2 2.69Å; R22-E26 PolarHBondContact NH2-OE2 2.95Å; R22-E26 WeakPolarHBondContact O-CG 3.48Å; R22-E26 PolarHBondContact O-N 3.37Å; Q23-E26 PolarHBondContact O-N 3.2Å; K24-E26 VanDerWaalsContact C-N 3.34Å; K24-E26 PolarHBondContact O-N 2.69Å; E26-L28 PolarHBondContact O-N 3.26Å; E26-L29 WeakPolarHBondContact O-CB 3.39Å; E26-L29 WeakPolarHBondContact O-CG 3.11Å; E26-L29 PolarHBondContact O-N 3.26Å; E26-L29 VanDerWaalsContact O-N 3.16Å
27	G	95.6	Very high	93.4	Very high	45 Å²	45	73.4 Å²	73.4	46%	0.464	38%	0.381	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.1	-11.6	175.7	0	0	0	0	0	114.6	Q23 K24 L25 K31	Q23-G27 PolarHBondContact O-N 3.41Å; K24-G27 PolarHBondContact O-N 3.32Å; L25-G27 VanDerWaalsContact C-N 3.32Å; L25-G27 PolarHBondContact O-N 3.18Å; G27-K31 WeakPolarHBondContact O-CE 3.37Å
28	L	96.6	Very high	94.5	Very high	55 Å²	55	72.5 Å²	72.5	29%	0.288	37%	0.371	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91	-16.7	175.1	-67.3	178.6	0	0	0	113.2	K24 L25 E26 K31 M33 F47 V94	K24-L28 WeakPolarHBondContact O-CG 3.41Å; K24-L28 PolarHBondContact O-N 3.26Å; L25-L28 HydrophobicContact CD2-CD1 4.44Å; L25-L28 WeakPolarHBondContact O-CB 3.39Å; L25-L28 PolarHBondContact O-N 3.04Å; L25-L28 VanDerWaalsContact O-N 3.11Å; E26-L28 PolarHBondContact O-N 3.26Å; L28-K31 HydrophobicContact CD2-CD 4.45Å; L28-K31 WeakPolarHBondContact O-CB 3.34Å; L28-K31 PolarHBondContact O-N 3.35Å; L28-M33 HydrophobicContact CB-CE 3.64Å; L28-M33 HydrophobicContact CD1-CE 4.09Å; L28-M33 HydrophobicContact CD2-CE 4.31Å; L28-M33 HydrophobicContact CG-CE 4.23Å; L28-F47 HydrophobicContact CB-CD1 3.99Å; L28-F47 HydrophobicContact CB-CE1 4.07Å; L28-F47 WeakPolarHBondContact O-CD1 3.2Å; L28-V94 HydrophobicContact CD2-CG1 4.18Å; L28-V94 HydrophobicContact CD2-CG2 3.97Å
29	L	97.3	Very high	95.4	Very high	70 Å²	70	72.8 Å²	72.8	37%	0.366	37%	0.366	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.7	142.7	-178.2	-64.5	173.8	0	0	0	111.4	E26 K31 F47 L48	E26-L29 WeakPolarHBondContact O-CB 3.39Å; E26-L29 WeakPolarHBondContact O-CG 3.11Å; E26-L29 PolarHBondContact O-N 3.26Å; E26-L29 VanDerWaalsContact O-N 3.16Å; L29-K31 PolarHBondContact O-N 2.71Å; L29-K31 VanDerWaalsContact O-N 3.11Å; L29-F47 HydrophobicContact CD2-CD1 3.95Å; L29-F47 HydrophobicContact CD2-CE1 3.77Å; L29-L48 VanDerWaalsContact CD2-O 3.27Å; L29-L48 WeakPolarHBondContact CD2-O 3.37Å
30	N	97	Very high	95.6	Very high	112 Å²	112	72.3 Å²	72.3	60%	0.599	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.2	11.9	-177.3	-54.2	-58.4	0	0	0	115.1	F47	N30-F47 PolarHBondContact N-O 3.12Å
31	K	97.4	Very high	95.7	Very high	48 Å²	48	71.6 Å²	71.6	21%	0.209	36%	0.359	C	S	.	.			trans	-83	145.2	167.8	-63.8	-173	174	-76.9	0	110.1	G27 L28 L29 M33 F47 V94 D97	G27-K31 WeakPolarHBondContact O-CE 3.37Å; L28-K31 HydrophobicContact CD2-CD 4.45Å; L28-K31 WeakPolarHBondContact O-CB 3.34Å; L28-K31 PolarHBondContact O-N 3.35Å; L29-K31 PolarHBondContact O-N 2.71Å; L29-K31 VanDerWaalsContact O-N 3.11Å; K31-M33 PolarHBondContact O-N 2.95Å; K31-F47 PolarHBondContact O-N 3.15Å; K31-V94 HydrophobicContact CB-CG1 3.77Å; K31-V94 HydrophobicContact CD-CG1 3.68Å; K31-V94 HydrophobicContact CG-CG1 4.37Å; K31-D97 IonicContact NZ-OD1 3.49Å; K31-D97 PolarHBondContact NZ-OD1 3.39Å; K31-D97 IonicContact NZ-OD2 3Å; K31-D97 PolarHBondContact NZ-OD2 2.87Å
32	N	97.6	Very high	96	Very high	62 Å²	62	70.6 Å²	70.6	33%	0.332	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.4	132	168.1	-86.5	-33.2	0	0	0	109.6	G45 L46 E95	N32-G45 WeakPolarHBondContact CA-O 3.05Å; N32-L46 WeakPolarHBondContact OD1-CD2 3.46Å; N32-E95 HydrophobicContact CB-CB 3.9Å; N32-E95 WeakPolarHBondContact CB-OE2 3.34Å; N32-E95 PolarHBondContact ND2-OE2 3.03Å; N32-E95 PolarHBondContact O-N 3.15Å
33	M	98.1	Very high	96.2	Very high	5 Å²	5	63.9 Å²	63.9	3%	0.025	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	141.7	175.8	-69.8	-167.6	-178.1	0	0	111.1	L28 K31 I35 V44 G45 F47 L58 I92 E93 V94	L28-M33 HydrophobicContact CB-CE 3.64Å; L28-M33 HydrophobicContact CD1-CE 4.09Å; L28-M33 HydrophobicContact CD2-CE 4.31Å; L28-M33 HydrophobicContact CG-CE 4.23Å; K31-M33 PolarHBondContact O-N 2.95Å; M33-I35 HydrophobicContact CB-CG1 4.42Å; M33-V44 VanDerWaalsContact O-CA 3.3Å; M33-V44 WeakPolarHBondContact O-CA 3.36Å; M33-G45 PolarHBondContact N-O 3Å; M33-G45 PolarHBondContact O-N 3.08Å; M33-G45 VanDerWaalsContact O-N 3.11Å; M33-F47 HydrophobicContact CE-CB 3.54Å; M33-F47 HydrophobicContact CE-CD1 3.48Å; M33-F47 VanDerWaalsContact CE-CD1 3.48Å; M33-F47 HydrophobicContact CE-CD2 4.02Å; M33-F47 HydrophobicContact CE-CE1 4.14Å; M33-F47 HydrophobicContact CE-CG 3.4Å; M33-F47 HydrophobicContact CG-CB 3.87Å; M33-F47 HydrophobicContact SD-CB 3.54Å; M33-F47 VanDerWaalsContact SD-CB 3.54Å; M33-F47 HydrophobicContact SD-CD1 4.3Å; M33-F47 HydrophobicContact SD-CD2 3.76Å; M33-F47 HydrophobicContact SD-CG 3.61Å; M33-L58 HydrophobicContact CB-CD2 4.46Å; M33-I92 HydrophobicContact CB-CG2 4.26Å; M33-I92 HydrophobicContact CG-CG2 4.16Å; M33-I92 HydrophobicContact SD-CG2 3.47Å; M33-I92 WeakPolarHBondContact SD-CG2 3.41Å; M33-E93 CarbonylContact C-O 3.59Å; M33-E93 VanDerWaalsContact CA-O 3.23Å; M33-E93 WeakPolarHBondContact CA-O 3.27Å; M33-V94 HydrophobicContact CE-CG2 4.01Å; M33-V94 HydrophobicContact CG-CG2 4.25Å
34	R	97.9	Very high	96.3	Very high	108 Å²	108	60.9 Å²	60.9	41%	0.408	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	119.2	166.9	-178.2	175.5	87.6	147.8	3.7	109.1	T42 L43 V44 I92 E93	R34-T42 HydrophobicContact CG-CG2 3.5Å; R34-L43 CarbonylContact C-O 3.52Å; R34-L43 WeakPolarHBondContact CA-O 3.46Å; R34-V44 HydrophobicContact CB-CG2 4.24Å; R34-V44 HydrophobicContact CG-CG2 4.06Å; R34-I92 WeakPolarHBondContact O-CA 3.29Å; R34-E93 HydrophobicContact CB-CB 4.31Å; R34-E93 IonicContact CZ-OE1 2.75Å; R34-E93 IonicContact CZ-OE2 3.11Å; R34-E93 PolarHBondContact N-O 3.37Å; R34-E93 IonicContact NE-OE1 3.37Å; R34-E93 IonicContact NE-OE2 2.76Å; R34-E93 PolarHBondContact NE-OE2 3.48Å; R34-E93 IonicContact NH2-OE1 2.8Å; R34-E93 PolarHBondContact NH2-OE1 3.07Å; R34-E93 IonicContact NH2-OE2 3.56Å; R34-E93 PolarHBondContact NH2-OE2 2.79Å; R34-E93 PolarHBondContact O-N 3.01Å
35	I	98.2	Very high	96.5	Very high	0 Å²	0	53.9 Å²	53.9	0%	0	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	120.9	-177.8	-57.7	-175.2	0	0	0	109.4	M33 T42 L43 V56 L58 I84 V89 S91 I92	M33-I35 HydrophobicContact CB-CG1 4.42Å; I35-T42 CarbonylContact O-C 3.49Å; I35-T42 WeakPolarHBondContact O-CA 3.37Å; I35-L43 PolarHBondContact N-O 3.34Å; I35-L43 PolarHBondContact O-N 2.99Å; I35-V56 HydrophobicContact CD1-CB 4.16Å; I35-V56 HydrophobicContact CD1-CG1 3.71Å; I35-V56 HydrophobicContact CD1-CG2 4.29Å; I35-L58 HydrophobicContact CD1-CD1 4.14Å; I35-L58 HydrophobicContact CD1-CD2 4.15Å; I35-L58 HydrophobicContact CD1-CG 4.34Å; I35-I84 HydrophobicContact CB-CD1 4.09Å; I35-I84 HydrophobicContact CD1-CD1 3.7Å; I35-I84 HydrophobicContact CG1-CD1 4.41Å; I35-I84 HydrophobicContact CG2-CD1 4.06Å; I35-I84 HydrophobicContact CG2-CG2 4.41Å; I35-V89 HydrophobicContact CG2-CG1 4.15Å; I35-V89 HydrophobicContact CG2-CG2 4.17Å; I35-S91 WeakPolarHBondContact CA-O 3.37Å; I35-I92 HydrophobicContact CD1-CD1 4.44Å; I35-I92 HydrophobicContact CD1-CG1 4.38Å; I35-I92 HydrophobicContact CG1-CG1 4.13Å; I35-I92 HydrophobicContact CG1-CG2 4.29Å
36	R	97.4	Very high	96.7	Very high	98 Å²	98	52.6 Å²	52.6	37%	0.37	28%	0.276	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	133	172.4	-59	-167.5	-46.6	-105.3	0.4	109.6	V90 S91 E93	R36-V90 HydrophobicContact CB-CB 4.35Å; R36-V90 WeakPolarHBondContact O-CB 3.3Å; R36-V90 PolarHBondContact O-N 2.82Å; R36-S91 WeakPolarHBondContact CG-OG 3.17Å; R36-S91 PolarHBondContact N-O 2.83Å; R36-S91 PolarHBondContact NE-OG 3.48Å; R36-S91 VanDerWaalsContact NE-OG 3.12Å; R36-S91 PolarHBondContact NH1-OG 3.1Å; R36-S91 PolarHBondContact NH2-OG 3.44Å; R36-S91 VanDerWaalsContact NH2-OG 3.15Å; R36-E93 IonicContact NH1-OE1 3.2Å; R36-E93 PolarHBondContact NH1-OE1 2.71Å; R36-E93 VanDerWaalsContact NH1-OE1 3.11Å
37	M	97.1	Very high	96.8	Very high	14 Å²	14	49.1 Å²	49.1	7%	0.069	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	158.9	179.8	-63.3	-172.8	69.3	0	0	112.5	D39 G40 R41 L43 I84 H88	M37-D39 WeakPolarHBondContact CB-OD1 3.33Å; M37-D39 PolarHBondContact O-N 2.96Å; M37-G40 PolarHBondContact O-N 3.19Å; M37-G40 VanDerWaalsContact O-N 3.14Å; M37-R41 HydrophobicContact CB-CB 4.46Å; M37-R41 PolarHBondContact N-O 3.48Å; M37-R41 HydrophobicContact SD-CB 4.48Å; M37-L43 HydrophobicContact CG-CD1 4.22Å; M37-L43 HydrophobicContact SD-CD1 3.5Å; M37-L43 VanDerWaalsContact SD-CD1 3.5Å; M37-I84 HydrophobicContact CE-CG2 4.12Å; M37-I84 HydrophobicContact CG-CG2 4.4Å; M37-I84 HydrophobicContact SD-CG2 4.31Å; M37-H88 CarbonylContact C-O 3.56Å; M37-H88 WeakPolarHBondContact CA-O 3.34Å; M37-H88 HydrophobicContact CE-CB 3.75Å
38	T	96.8	Very high	96.9	Very high	81 Å²	81	50.2 Å²	50.2	50%	0.497	25%	0.254	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.8	-26	179	52.7	0	0	0	0	113.9	G40 H88 V90	T38-G40 PolarHBondContact O-N 3.39Å; T38-H88 PolarHBondContact N-O 2.84Å; T38-H88 PolarHBondContact OG1-ND1 2.77Å; T38-V90 HydrophobicContact CG2-CG2 3.7Å
39	D	93.3	Very high	97	Very high	88 Å²	88	50.3 Å²	50.3	47%	0.471	26%	0.259	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.7	3.5	177.9	65.1	10.7	0	0	0	113.3	M37 R41	M37-D39 WeakPolarHBondContact CB-OD1 3.33Å; M37-D39 PolarHBondContact O-N 2.96Å; D39-R41 WeakPolarHBondContact OD1-CB 3.15Å; D39-R41 WeakPolarHBondContact OD1-CG 3.39Å; D39-R41 PolarHBondContact OD1-N 3.11Å; D39-R41 IonicContact OD1-NE 2.81Å; D39-R41 PolarHBondContact OD1-NE 3.04Å; D39-R41 IonicContact OD2-CZ 3.13Å; D39-R41 IonicContact OD2-NE 2.71Å; D39-R41 PolarHBondContact OD2-NE 2.87Å; D39-R41 IonicContact OD2-NH2 3.06Å; D39-R41 PolarHBondContact OD2-NH2 3.16Å
40	G	91.6	Very high	97.1	Very high	21 Å²	21	49.4 Å²	49.4	22%	0.216	26%	0.256	C	S	.	.	S	Bend	trans	92	-10.6	-179.8	0	0	0	0	0	114.3	M37 T38 K66	M37-G40 PolarHBondContact O-N 3.19Å; M37-G40 VanDerWaalsContact O-N 3.14Å; T38-G40 PolarHBondContact O-N 3.39Å; G40-K66 WeakPolarHBondContact O-CB 3.47Å
41	R	93.8	Very high	97.1	Very high	80 Å²	80	47.8 Å²	47.8	30%	0.302	25%	0.248	S	C	.	.			trans	-66.5	149.4	175.3	-66.5	-176.7	-70.2	163.8	-2.7	111.5	M37 D39 L43 E63 F64	M37-R41 HydrophobicContact CB-CB 4.46Å; M37-R41 PolarHBondContact N-O 3.48Å; M37-R41 HydrophobicContact SD-CB 4.48Å; D39-R41 WeakPolarHBondContact OD1-CB 3.15Å; D39-R41 WeakPolarHBondContact OD1-CG 3.39Å; D39-R41 PolarHBondContact OD1-N 3.11Å; D39-R41 IonicContact OD1-NE 2.81Å; D39-R41 PolarHBondContact OD1-NE 3.04Å; D39-R41 IonicContact OD2-CZ 3.13Å; D39-R41 IonicContact OD2-NE 2.71Å; D39-R41 PolarHBondContact OD2-NE 2.87Å; D39-R41 IonicContact OD2-NH2 3.06Å; D39-R41 PolarHBondContact OD2-NH2 3.16Å; R41-L43 HydrophobicContact CB-CD1 4.11Å; R41-E63 IonicContact NH1-OE2 3.95Å; R41-E63 PolarHBondContact NH1-OE2 2.93Å; R41-E63 VanDerWaalsContact NH1-OE2 3.13Å; R41-F64 WeakPolarHBondContact CA-O 3.37Å
42	T	96.4	Very high	97	Very high	30 Å²	30	56.3 Å²	56.3	18%	0.184	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	126.3	168	-61.2	0	0	0	0	108.3	R34 I35 V44 F64	R34-T42 HydrophobicContact CG-CG2 3.5Å; I35-T42 CarbonylContact O-C 3.49Å; I35-T42 WeakPolarHBondContact O-CA 3.37Å; T42-V44 HydrophobicContact CG2-CG2 4.46Å; T42-F64 PolarHBondContact N-O 2.95Å; T42-F64 PolarHBondContact O-N 2.95Å
43	L	97.9	Very high	97	Very high	5 Å²	5	58.6 Å²	58.6	3%	0.026	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	138.7	173.9	-80.7	71	0	0	0	109.5	R34 I35 M37 R41 L58 Q62 E63 L79 A82 I84	R34-L43 CarbonylContact C-O 3.52Å; R34-L43 WeakPolarHBondContact CA-O 3.46Å; I35-L43 PolarHBondContact N-O 3.34Å; I35-L43 PolarHBondContact O-N 2.99Å; M37-L43 HydrophobicContact CG-CD1 4.22Å; M37-L43 HydrophobicContact SD-CD1 3.5Å; M37-L43 VanDerWaalsContact SD-CD1 3.5Å; R41-L43 HydrophobicContact CB-CD1 4.11Å; L43-L58 HydrophobicContact CB-CD1 4.03Å; L43-Q62 VanDerWaalsContact CA-O 3.3Å; L43-Q62 WeakPolarHBondContact CA-O 3.46Å; L43-E63 HydrophobicContact CD1-CB 4.16Å; L43-E63 HydrophobicContact CG-CB 4.16Å; L43-L79 HydrophobicContact CD2-CD1 4.23Å; L43-A82 HydrophobicContact CD2-CB 4.12Å; L43-I84 HydrophobicContact CB-CD1 4.08Å; L43-I84 HydrophobicContact CD2-CD1 3.78Å; L43-I84 HydrophobicContact CD2-CG1 3.8Å; L43-I84 HydrophobicContact CG-CD1 4.5Å
44	V	97.9	Very high	96.9	Very high	46 Å²	46	62 Å²	62	28%	0.279	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	133.9	174.1	-177.9	0	0	0	0	108.6	M33 R34 T42 A61 Q62 F64	M33-V44 VanDerWaalsContact O-CA 3.3Å; M33-V44 WeakPolarHBondContact O-CA 3.36Å; R34-V44 HydrophobicContact CB-CG2 4.24Å; R34-V44 HydrophobicContact CG-CG2 4.06Å; T42-V44 HydrophobicContact CG2-CG2 4.46Å; V44-A61 CarbonylContact O-C 3.57Å; V44-A61 WeakPolarHBondContact O-CA 3.47Å; V44-Q62 PolarHBondContact N-O 3.11Å; V44-Q62 PolarHBondContact O-N 2.83Å; V44-F64 HydrophobicContact CB-CE2 4.13Å; V44-F64 HydrophobicContact CG2-CD2 4.25Å; V44-F64 HydrophobicContact CG2-CE2 3.84Å
45	G	98.3	Very high	97	Very high	2 Å²	2	58.7 Å²	58.7	2%	0.021	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	176.1	-178.9	177.3	0	0	0	0	0	112.9	N32 M33 G59	N32-G45 WeakPolarHBondContact CA-O 3.05Å; M33-G45 PolarHBondContact N-O 3Å; M33-G45 PolarHBondContact O-N 3.08Å; M33-G45 VanDerWaalsContact O-N 3.11Å; G45-G59 CarbonylContact C-O 3.55Å; G45-G59 WeakPolarHBondContact CA-O 3.46Å
46	L	98.4	Very high	97	Very high	55 Å²	55	58.8 Å²	58.8	29%	0.288	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.4	124.6	-179.6	-64.2	170.7	0	0	0	110.7	N32 L48 L58 G59	N32-L46 WeakPolarHBondContact OD1-CD2 3.46Å; L46-L48 HydrophobicContact CB-CD2 4.33Å; L46-L48 PolarHBondContact O-N 3.11Å; L46-L58 CarbonylContact O-C 3.56Å; L46-L58 VanDerWaalsContact O-CA 3.25Å; L46-L58 WeakPolarHBondContact O-CA 3.43Å; L46-G59 PolarHBondContact N-O 3.37Å; L46-G59 PolarHBondContact O-N 2.8Å
47	F	98.6	Very high	97	Very high	7 Å²	7	56.3 Å²	56.3	3%	0.031	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	110.3	176.2	178.9	-117.6	0	0	0	111.6	L28 L29 N30 K31 M33 C49 T50 V56	L28-F47 HydrophobicContact CB-CD1 3.99Å; L28-F47 HydrophobicContact CB-CE1 4.07Å; L28-F47 WeakPolarHBondContact O-CD1 3.2Å; L29-F47 HydrophobicContact CD2-CD1 3.95Å; L29-F47 HydrophobicContact CD2-CE1 3.77Å; N30-F47 PolarHBondContact N-O 3.12Å; K31-F47 PolarHBondContact O-N 3.15Å; M33-F47 HydrophobicContact CE-CB 3.54Å; M33-F47 HydrophobicContact CE-CD1 3.48Å; M33-F47 VanDerWaalsContact CE-CD1 3.48Å; M33-F47 HydrophobicContact CE-CD2 4.02Å; M33-F47 HydrophobicContact CE-CE1 4.14Å; M33-F47 HydrophobicContact CE-CG 3.4Å; M33-F47 HydrophobicContact CG-CB 3.87Å; M33-F47 HydrophobicContact SD-CB 3.54Å; M33-F47 VanDerWaalsContact SD-CB 3.54Å; M33-F47 HydrophobicContact SD-CD1 4.3Å; M33-F47 HydrophobicContact SD-CD2 3.76Å; M33-F47 HydrophobicContact SD-CG 3.61Å; F47-C49 VanDerWaalsContact CE2-O 3.23Å; F47-C49 WeakPolarHBondContact CE2-O 3.23Å; F47-T50 HydrophobicContact CE2-CG2 4.44Å; F47-T50 HydrophobicContact CZ-CG2 3.78Å; F47-V56 HydrophobicContact CD2-CG1 3.67Å; F47-V56 HydrophobicContact CE2-CG1 3.84Å; F47-V56 HydrophobicContact CE2-CG2 4.35Å
48	L	98.6	Very high	97.1	Very high	67 Å²	67	55.7 Å²	55.7	35%	0.351	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.8	-38.7	-176.1	-61.2	-174.5	0	0	0	113	L29 L46 I57 L81	L29-L48 VanDerWaalsContact CD2-O 3.27Å; L29-L48 WeakPolarHBondContact CD2-O 3.37Å; L46-L48 HydrophobicContact CB-CD2 4.33Å; L46-L48 PolarHBondContact O-N 3.11Å; L48-I57 HydrophobicContact CB-CB 4.46Å; L48-I57 HydrophobicContact CB-CG2 4.27Å; L48-I57 HydrophobicContact CD1-CG2 4.26Å; L48-I57 PolarHBondContact N-O 2.94Å; L48-L81 HydrophobicContact CD1-CD1 3.87Å
49	C	98.3	Very high	97.2	Very high	58 Å²	58	52.2 Å²	52.2	39%	0.392	28%	0.276	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.7	168.1	174.8	64	0	0	0	0	112.4	F47 I57	F47-C49 VanDerWaalsContact CE2-O 3.23Å; F47-C49 WeakPolarHBondContact CE2-O 3.23Å; C49-I57 PolarHBondContact O-N 2.68Å; C49-I57 VanDerWaalsContact O-N 3.08Å; C49-I57 WeakPolarHBondContact SG-CG1 3.23Å
50	T	98.3	Very high	97.4	Very high	51 Å²	51	52.1 Å²	52.1	31%	0.313	28%	0.282	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	169.8	167.9	-166.5	0	0	0	0	110.7	L25 F47 N55	L25-T50 HydrophobicContact CD1-CG2 4.33Å; L25-T50 HydrophobicContact CD2-CG2 4.3Å; F47-T50 HydrophobicContact CE2-CG2 4.44Å; F47-T50 HydrophobicContact CZ-CG2 3.78Å; T50-N55 WeakPolarHBondContact CA-O 3.43Å; T50-N55 WeakPolarHBondContact CB-O 3.38Å; T50-N55 PolarHBondContact OG1-O 2.76Å
51	D	97.1	Very high	97.8	Very high	78 Å²	78	51.1 Å²	51.1	42%	0.417	27%	0.272	S	S	.	.			trans	-128.9	-168.8	176.3	67.4	17	0	0	0	112	D53 C54 N55	D51-D53 VanDerWaalsContact C-N 3.27Å; D51-D53 PolarHBondContact O-N 3.34Å; D51-D53 PolarHBondContact OD1-N 3.14Å; D51-C54 PolarHBondContact O-N 2.82Å; D51-C54 PolarHBondContact OD1-N 2.78Å; D51-N55 PolarHBondContact N-O 2.82Å; D51-N55 WeakPolarHBondContact OD1-CB 3.46Å; D51-N55 PolarHBondContact OD1-N 2.88Å; D51-N55 PolarHBondContact OD1-ND2 2.96Å; D51-N55 WeakPolarHBondContact OD2-CB 3.39Å; D51-N55 PolarHBondContact OD2-ND2 2.69Å
52	R	95.8	Very high	98	Very high	227 Å²	227	50.8 Å²	50.8	86%	0.857	27%	0.274	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.4	-30.6	-178.8	-170.4	-172.1	-55.7	123.3	3.1	113	C54	R52-C54 PolarHBondContact O-N 3.06Å
53	D	97.4	Very high	98	Very high	109 Å²	109	50.1 Å²	50.1	58%	0.583	27%	0.268	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.4	12.1	-175.8	-58.5	-33.9	0	0	0	111.5	D51 N55 G86	D51-D53 VanDerWaalsContact C-N 3.27Å; D51-D53 PolarHBondContact O-N 3.34Å; D51-D53 PolarHBondContact OD1-N 3.14Å; D53-N55 PolarHBondContact O-N 3.31Å; D53-G86 WeakPolarHBondContact O-CA 3.41Å
54	C	96.6	Very high	97.8	Very high	77 Å²	77	53 Å²	53	52%	0.52	28%	0.281	S	S	.	.			trans	59.6	25	-176.6	-54.5	0	0	0	0	113.1	D51 R52 G86	D51-C54 PolarHBondContact O-N 2.82Å; D51-C54 PolarHBondContact OD1-N 2.78Å; R52-C54 PolarHBondContact O-N 3.06Å; C54-G86 WeakPolarHBondContact O-CA 3.3Å
55	N	98.6	Very high	97.3	Very high	39 Å²	39	56.7 Å²	56.7	21%	0.209	30%	0.298	C	S	.	.			trans	-63.5	143.4	167.4	-59	-47.8	0	0	0	108.5	T50 D51 D53 I84 P85 G86	T50-N55 WeakPolarHBondContact CA-O 3.43Å; T50-N55 WeakPolarHBondContact CB-O 3.38Å; T50-N55 PolarHBondContact OG1-O 2.76Å; D51-N55 PolarHBondContact N-O 2.82Å; D51-N55 WeakPolarHBondContact OD1-CB 3.46Å; D51-N55 PolarHBondContact OD1-N 2.88Å; D51-N55 PolarHBondContact OD1-ND2 2.96Å; D51-N55 WeakPolarHBondContact OD2-CB 3.39Å; D51-N55 PolarHBondContact OD2-ND2 2.69Å; D53-N55 PolarHBondContact O-N 3.31Å; N55-I84 WeakPolarHBondContact CA-O 3.42Å; N55-P85 WeakPolarHBondContact OD1-CA 3.27Å; N55-G86 PolarHBondContact OD1-N 3.23Å
56	V	98.7	Very high	96.1	Very high	2 Å²	2	64.9 Å²	64.9	1%	0.012	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	134.5	-178	177.1	0	0	0	0	110	I35 F47 L58 M83 I84 I92	I35-V56 HydrophobicContact CD1-CB 4.16Å; I35-V56 HydrophobicContact CD1-CG1 3.71Å; I35-V56 HydrophobicContact CD1-CG2 4.29Å; F47-V56 HydrophobicContact CD2-CG1 3.67Å; F47-V56 HydrophobicContact CE2-CG1 3.84Å; F47-V56 HydrophobicContact CE2-CG2 4.35Å; V56-L58 HydrophobicContact CG1-CD2 3.85Å; V56-L58 HydrophobicContact CG1-CG 4.15Å; V56-M83 CarbonylContact O-C 3.52Å; V56-M83 WeakPolarHBondContact O-CA 3.39Å; V56-I84 HydrophobicContact CB-CB 4.4Å; V56-I84 PolarHBondContact N-O 2.85Å; V56-I84 PolarHBondContact O-N 3.11Å; V56-I92 HydrophobicContact CG2-CD1 4.44Å
57	I	98.7	Very high	94.6	Very high	46 Å²	46	63.6 Å²	63.6	24%	0.236	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	123.3	167.1	-55.5	-58.3	0	0	0	109.1	L48 C49 L81 A82 M83	L48-I57 HydrophobicContact CB-CB 4.46Å; L48-I57 HydrophobicContact CB-CG2 4.27Å; L48-I57 HydrophobicContact CD1-CG2 4.26Å; L48-I57 PolarHBondContact N-O 2.94Å; C49-I57 PolarHBondContact O-N 2.68Å; C49-I57 VanDerWaalsContact O-N 3.08Å; C49-I57 WeakPolarHBondContact SG-CG1 3.23Å; I57-L81 HydrophobicContact CG2-CD1 3.66Å; I57-L81 HydrophobicContact CG2-CG 4.36Å; I57-A82 WeakPolarHBondContact CA-O 3.49Å; I57-M83 HydrophobicContact CD1-CB 3.66Å; I57-M83 HydrophobicContact CD1-CG 3.69Å
58	L	98.8	Very high	92.7	Very high	0 Å²	0	68.7 Å²	68.7	0%	0	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	130.1	172.4	-64.6	-174.4	0	0	0	111.2	M33 I35 L43 L46 V56 A61 L81 A82 I84	M33-L58 HydrophobicContact CB-CD2 4.46Å; I35-L58 HydrophobicContact CD1-CD1 4.14Å; I35-L58 HydrophobicContact CD1-CD2 4.15Å; I35-L58 HydrophobicContact CD1-CG 4.34Å; L43-L58 HydrophobicContact CB-CD1 4.03Å; L46-L58 CarbonylContact O-C 3.56Å; L46-L58 VanDerWaalsContact O-CA 3.25Å; L46-L58 WeakPolarHBondContact O-CA 3.43Å; V56-L58 HydrophobicContact CG1-CD2 3.85Å; V56-L58 HydrophobicContact CG1-CG 4.15Å; L58-A61 HydrophobicContact CB-CB 3.91Å; L58-L81 WeakPolarHBondContact O-CA 3.43Å; L58-A82 PolarHBondContact N-O 2.95Å; L58-A82 PolarHBondContact O-N 2.75Å; L58-I84 HydrophobicContact CD1-CD1 3.73Å; L58-I84 HydrophobicContact CG-CD1 4.07Å
59	G	98.6	Very high	90.7	Very high	8 Å²	8	70.4 Å²	70.4	8%	0.082	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	158.7	166.6	0	0	0	0	0	112.1	G45 L46 A61 G80	G45-G59 CarbonylContact C-O 3.55Å; G45-G59 WeakPolarHBondContact CA-O 3.46Å; L46-G59 PolarHBondContact N-O 3.37Å; L46-G59 PolarHBondContact O-N 2.8Å; G59-A61 PolarHBondContact O-N 2.82Å; G59-G80 CarbonylContact C-O 3.35Å
60	S	98.2	Very high	88.6	Confident	86 Å²	86	74.1 Å²	74.1	60%	0.601	40%	0.396	S	S	*	.	E	Extended strand (participates in β ladder)	trans	46	34.1	-173.8	-58.8	0	0	0	0	113.7	G80	S60-G80 CarbonylContact C-O 3.51Å; S60-G80 VanDerWaalsContact CA-O 3.29Å; S60-G80 WeakPolarHBondContact CA-O 3.33Å; S60-G80 PolarHBondContact N-O 2.84Å
61	A	98.4	Very high	86.5	Confident	0 Å²	0	81.5 Å²	81.5	0%	0	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.9	143.1	-167	0	0	0	0	0	112.4	V44 L58 G59 L79 G80 A82	V44-A61 CarbonylContact O-C 3.57Å; V44-A61 WeakPolarHBondContact O-CA 3.47Å; L58-A61 HydrophobicContact CB-CB 3.91Å; G59-A61 PolarHBondContact O-N 2.82Å; A61-L79 HydrophobicContact CB-CB 4.3Å; A61-L79 PolarHBondContact O-N 2.9Å; A61-G80 PolarHBondContact N-O 3.43Å; A61-G80 PolarHBondContact O-N 3.24Å; A61-A82 HydrophobicContact CB-CB 3.75Å
62	Q	98	Very high	84.5	Confident	74 Å²	74	81 Å²	81	35%	0.346	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	140.8	172.5	-62.5	178.6	26.1	0	0	109.5	L43 V44 F64 P76 R77	L43-Q62 VanDerWaalsContact CA-O 3.3Å; L43-Q62 WeakPolarHBondContact CA-O 3.46Å; V44-Q62 PolarHBondContact N-O 3.11Å; V44-Q62 PolarHBondContact O-N 2.83Å; Q62-F64 HydrophobicContact CB-CE2 4.04Å; Q62-P76 HydrophobicContact CB-CB 4.16Å; Q62-R77 CarbonylContact C-O 3.58Å; Q62-R77 WeakPolarHBondContact CA-O 3.21Å
63	E	96.1	Very high	82.9	Confident	16 Å²	16	76.6 Å²	76.6	8%	0.075	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	138.3	172.3	68	172.9	-173.5	0	0	112.3	R41 L43 R77 L79	R41-E63 IonicContact NH1-OE2 3.95Å; R41-E63 PolarHBondContact NH1-OE2 2.93Å; R41-E63 VanDerWaalsContact NH1-OE2 3.13Å; L43-E63 HydrophobicContact CD1-CB 4.16Å; L43-E63 HydrophobicContact CG-CB 4.16Å; E63-R77 HydrophobicContact CG-CB 3.78Å; E63-R77 HydrophobicContact CG-CG 4.48Å; E63-R77 PolarHBondContact N-O 3.13Å; E63-R77 PolarHBondContact O-N 2.89Å; E63-R77 WeakPolarHBondContact OE1-CD 3.34Å; E63-R77 IonicContact OE1-NH1 3.23Å; E63-R77 PolarHBondContact OE1-NH1 2.83Å; E63-L79 HydrophobicContact CB-CD1 4.02Å; E63-L79 HydrophobicContact CB-CG 4.47Å; E63-L79 HydrophobicContact CG-CD1 4.16Å; E63-L79 HydrophobicContact CG-CD2 4.14Å; E63-L79 HydrophobicContact CG-CG 4.23Å
64	F	94	Very high	81.6	Confident	65 Å²	65	74 Å²	74	29%	0.285	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	126.3	175.5	-60.1	-101.5	0	0	0	108.2	R41 T42 V44 Q62 P76	R41-F64 WeakPolarHBondContact CA-O 3.37Å; T42-F64 PolarHBondContact N-O 2.95Å; T42-F64 PolarHBondContact O-N 2.95Å; V44-F64 HydrophobicContact CB-CE2 4.13Å; V44-F64 HydrophobicContact CG2-CD2 4.25Å; V44-F64 HydrophobicContact CG2-CE2 3.84Å; Q62-F64 HydrophobicContact CB-CE2 4.04Å; F64-P76 HydrophobicContact CD1-CB 3.95Å; F64-P76 HydrophobicContact CD2-CB 4.41Å; F64-P76 HydrophobicContact CE1-CB 3.51Å; F64-P76 HydrophobicContact CE1-CG 3.76Å; F64-P76 HydrophobicContact CE2-CB 4Å; F64-P76 HydrophobicContact CG-CB 4.38Å; F64-P76 HydrophobicContact CZ-CB 3.53Å; F64-P76 HydrophobicContact CZ-CG 3.85Å
65	L	87.4	Confident	81	Confident	123 Å²	123	79.2 Å²	79.2	64%	0.644	43%	0.432	S	S	*	.			trans	-82.5	143.4	173.3	-68.4	105.8	0	0	0	110.1	S67	L65-S67 PolarHBondContact O-N 3.2Å
66	K	74.8	Confident	80.7	Confident	174 Å²	174	79.7 Å²	79.7	76%	0.757	44%	0.437	S	S	*	.			trans	-69.4	99.7	167.8	-158.1	174.7	-175.5	-176.6	0	107.9	G40 S68	G40-K66 WeakPolarHBondContact O-CB 3.47Å; K66-S68 PolarHBondContact O-N 2.71Å
67	S	64.9	Low	80.5	Confident	29 Å²	29	87.2 Å²	87.2	20%	0.203	47%	0.465	C	S	.	.			trans	-66.5	128.4	173.8	78.3	0	0	0	0	108.9	L65 D69 S72 Q73	L65-S67 PolarHBondContact O-N 3.2Å; S67-D69 VanDerWaalsContact CB-O 3.27Å; S67-D69 WeakPolarHBondContact CB-O 3.25Å; S67-D69 PolarHBondContact OG-O 2.76Å; S67-S72 WeakPolarHBondContact CB-O 3.36Å; S67-Q73 PolarHBondContact OG-NE2 2.86Å
68	S	59.1	Low	80.4	Confident	114 Å²	114	90.2 Å²	90.2	80%	0.797	49%	0.485	S	S	*	.	S	Bend	trans	-70.1	-23	166.2	50.5	0	0	0	0	111.3	K66	K66-S68 PolarHBondContact O-N 2.71Å
69	D	56.8	Low	80.4	Confident	102 Å²	102	93 Å²	93	55%	0.545	50%	0.5	S	S	.	.	S	Bend	trans	-110.2	123.2	-178.1	-58.7	-46.3	0	0	0	109.5	S67 F71 S72	S67-D69 VanDerWaalsContact CB-O 3.27Å; S67-D69 WeakPolarHBondContact CB-O 3.25Å; S67-D69 PolarHBondContact OG-O 2.76Å; D69-F71 PolarHBondContact O-N 2.81Å; D69-S72 PolarHBondContact O-N 2.92Å; D69-S72 PolarHBondContact O-OG 2.84Å
70	T	54.6	Low	80.4	Confident	136 Å²	136	94.1 Å²	94.1	83%	0.834	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62	-10.5	-178.4	46.3	0	0	0	0	113.8
71	F	53.9	Low	80.4	Confident	207 Å²	207	96 Å²	96	91%	0.908	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.9	-10.3	-178.3	-107.3	-94.1	0	0	0	114.6	D69	D69-F71 PolarHBondContact O-N 2.81Å
72	S	54.4	Low	80.4	Confident	68 Å²	68	96.6 Å²	96.6	48%	0.476	52%	0.519	S	S	.	.			trans	-129.5	46	-172.5	42.3	0	0	0	0	111.8	S67 D69 G74	S67-S72 WeakPolarHBondContact CB-O 3.36Å; D69-S72 PolarHBondContact O-N 2.92Å; D69-S72 PolarHBondContact O-OG 2.84Å; S72-G74 PolarHBondContact O-N 3Å
73	Q	63.4	Low	80.4	Confident	133 Å²	133	99.3 Å²	99.3	62%	0.621	53%	0.533	S	S	*	.			trans	-64.6	77	153.5	-65.3	-69.9	-21.4	0	0	106.9	S67	S67-Q73 PolarHBondContact OG-NE2 2.86Å
74	G	69.7	Low	80.5	Confident	55 Å²	55	98.6 Å²	98.6	57%	0.567	53%	0.53	S	S	*	.	P	Polyproline II helix	trans	-61.7	163	-179.8	0	0	0	0	0	110.8	S72	S72-G74 PolarHBondContact O-N 3Å
75	E	84.3	Confident	80.7	Confident	187 Å²	187	97 Å²	97	87%	0.874	53%	0.526	S	S	*	.	P	Polyproline II helix	trans	-56.9	141.1	175.2	-66.4	-168.7	156	0	0	110.8
76	P	92.3	Very high	81.2	Confident	48 Å²	48	91.7 Å²	91.7	31%	0.312	50%	0.501	S	S	.	.	P	Polyproline II helix	trans	-59.7	142.4	176.8	20.4	-28.9	0	0	0	111.4	Q62 F64	Q62-P76 HydrophobicContact CB-CB 4.16Å; F64-P76 HydrophobicContact CD1-CB 3.95Å; F64-P76 HydrophobicContact CD2-CB 4.41Å; F64-P76 HydrophobicContact CE1-CB 3.51Å; F64-P76 HydrophobicContact CE1-CG 3.76Å; F64-P76 HydrophobicContact CE2-CB 4Å; F64-P76 HydrophobicContact CG-CB 4.38Å; F64-P76 HydrophobicContact CZ-CB 3.53Å; F64-P76 HydrophobicContact CZ-CG 3.85Å
77	R	94.3	Very high	82.4	Confident	161 Å²	161	90.1 Å²	90.1	61%	0.608	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.5	123.8	171	-177.2	-170.9	-178.3	-172.3	1.2	109.5	Q62 E63 L79	Q62-R77 CarbonylContact C-O 3.58Å; Q62-R77 WeakPolarHBondContact CA-O 3.21Å; E63-R77 HydrophobicContact CG-CB 3.78Å; E63-R77 HydrophobicContact CG-CG 4.48Å; E63-R77 PolarHBondContact N-O 3.13Å; E63-R77 PolarHBondContact O-N 2.89Å; E63-R77 WeakPolarHBondContact OE1-CD 3.34Å; E63-R77 IonicContact OE1-NH1 3.23Å; E63-R77 PolarHBondContact OE1-NH1 2.83Å; R77-L79 HydrophobicContact CG-CD2 4.31Å
78	V	97.1	Very high	83.9	Confident	108 Å²	108	91.9 Å²	91.9	66%	0.655	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.3	127.8	174	-177	0	0	0	0	110
79	L	97.8	Very high	85.8	Confident	59 Å²	59	88.2 Å²	88.2	31%	0.309	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	-29.2	177.3	-57.3	-176.9	0	0	0	112.5	L43 A61 E63 R77 L81 A82	L43-L79 HydrophobicContact CD2-CD1 4.23Å; A61-L79 HydrophobicContact CB-CB 4.3Å; A61-L79 PolarHBondContact O-N 2.9Å; E63-L79 HydrophobicContact CB-CD1 4.02Å; E63-L79 HydrophobicContact CB-CG 4.47Å; E63-L79 HydrophobicContact CG-CD1 4.16Å; E63-L79 HydrophobicContact CG-CD2 4.14Å; E63-L79 HydrophobicContact CG-CG 4.23Å; R77-L79 HydrophobicContact CG-CD2 4.31Å; L79-L81 PolarHBondContact O-N 2.8Å; L79-L81 VanDerWaalsContact O-N 3.1Å; L79-A82 HydrophobicContact CD1-CB 4.08Å
80	G	98.3	Very high	87.8	Confident	32 Å²	32	87.2 Å²	87.2	33%	0.33	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	79.7	-80.8	-174.3	0	0	0	0	0	111.4	G59 S60 A61	G59-G80 CarbonylContact C-O 3.35Å; S60-G80 CarbonylContact C-O 3.51Å; S60-G80 VanDerWaalsContact CA-O 3.29Å; S60-G80 WeakPolarHBondContact CA-O 3.33Å; S60-G80 PolarHBondContact N-O 2.84Å; A61-G80 PolarHBondContact N-O 3.43Å; A61-G80 PolarHBondContact O-N 3.24Å
81	L	98.3	Very high	89.8	Confident	125 Å²	125	81.9 Å²	81.9	65%	0.654	44%	0.439	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117.5	128.7	176.7	-171.7	72.7	0	0	0	109.6	L48 I57 L58 L79	L48-L81 HydrophobicContact CD1-CD1 3.87Å; I57-L81 HydrophobicContact CG2-CD1 3.66Å; I57-L81 HydrophobicContact CG2-CG 4.36Å; L58-L81 WeakPolarHBondContact O-CA 3.43Å; L79-L81 PolarHBondContact O-N 2.8Å; L79-L81 VanDerWaalsContact O-N 3.1Å
82	A	98.1	Very high	91.9	Very high	12 Å²	12	75.7 Å²	75.7	10%	0.099	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	140.2	-178.1	0	0	0	0	0	112.1	L43 I57 L58 A61 L79	L43-A82 HydrophobicContact CD2-CB 4.12Å; I57-A82 WeakPolarHBondContact CA-O 3.49Å; L58-A82 PolarHBondContact N-O 2.95Å; L58-A82 PolarHBondContact O-N 2.75Å; A61-A82 HydrophobicContact CB-CB 3.75Å; L79-A82 HydrophobicContact CD1-CB 4.08Å
83	M	98.3	Very high	94	Very high	131 Å²	131	76 Å²	76	65%	0.645	41%	0.409	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.8	129.1	168.1	-178.4	-175	82.5	0	0	109.4	V56 I57	V56-M83 CarbonylContact O-C 3.52Å; V56-M83 WeakPolarHBondContact O-CA 3.39Å; I57-M83 HydrophobicContact CD1-CB 3.66Å; I57-M83 HydrophobicContact CD1-CG 3.69Å
84	I	98.6	Very high	95.6	Very high	1 Å²	1	72.4 Å²	72.4	1%	0.005	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	115.7	176.3	-58.1	162.8	0	0	0	107.7	I35 M37 L43 N55 V56 L58 G86 V89	I35-I84 HydrophobicContact CB-CD1 4.09Å; I35-I84 HydrophobicContact CD1-CD1 3.7Å; I35-I84 HydrophobicContact CG1-CD1 4.41Å; I35-I84 HydrophobicContact CG2-CD1 4.06Å; I35-I84 HydrophobicContact CG2-CG2 4.41Å; M37-I84 HydrophobicContact CE-CG2 4.12Å; M37-I84 HydrophobicContact CG-CG2 4.4Å; M37-I84 HydrophobicContact SD-CG2 4.31Å; L43-I84 HydrophobicContact CB-CD1 4.08Å; L43-I84 HydrophobicContact CD2-CD1 3.78Å; L43-I84 HydrophobicContact CD2-CG1 3.8Å; L43-I84 HydrophobicContact CG-CD1 4.5Å; N55-I84 WeakPolarHBondContact CA-O 3.42Å; V56-I84 HydrophobicContact CB-CB 4.4Å; V56-I84 PolarHBondContact N-O 2.85Å; V56-I84 PolarHBondContact O-N 3.11Å; L58-I84 HydrophobicContact CD1-CD1 3.73Å; L58-I84 HydrophobicContact CG-CD1 4.07Å; I84-G86 PolarHBondContact O-N 2.89Å; I84-V89 HydrophobicContact CG2-CG2 3.75Å
85	P	98.6	Very high	96.7	Very high	31 Å²	31	75.1 Å²	75.1	20%	0.201	39%	0.394	C	S	.	.			trans	-62.9	133.9	173.8	-22.5	34.1	0	0	0	111.3	N55 H87 H88	N55-P85 WeakPolarHBondContact OD1-CA 3.27Å; P85-H87 VanDerWaalsContact C-N 3.26Å; P85-H87 WeakPolarHBondContact CB-CE1 3.4Å; P85-H87 PolarHBondContact O-N 3.2Å; P85-H88 PolarHBondContact O-N 3.04Å
86	G	98.4	Very high	96.8	Very high	12 Å²	12	70 Å²	70	12%	0.124	38%	0.384	C	S	.	.	G	3₁₀ helix	trans	-59.4	-33.5	-173.2	0	0	0	0	0	114.3	D53 C54 N55 I84 H88 V89	D53-G86 WeakPolarHBondContact O-CA 3.41Å; C54-G86 WeakPolarHBondContact O-CA 3.3Å; N55-G86 PolarHBondContact OD1-N 3.23Å; I84-G86 PolarHBondContact O-N 2.89Å; G86-H88 PolarHBondContact O-N 2.85Å; G86-V89 WeakPolarHBondContact O-CB 3.45Å; G86-V89 PolarHBondContact O-N 2.82Å
87	H	98.4	Very high	96.1	Very high	142 Å²	142	73.4 Å²	73.4	66%	0.657	40%	0.399	S	S	*	.	G	3₁₀ helix	trans	-68.1	-13.9	177.1	63.9	-95.8	0	0	0	114.3	P85	P85-H87 VanDerWaalsContact C-N 3.26Å; P85-H87 WeakPolarHBondContact CB-CE1 3.4Å; P85-H87 PolarHBondContact O-N 3.2Å
88	H	98.3	Very high	94.7	Very high	65 Å²	65	70.1 Å²	70.1	30%	0.301	40%	0.402	S	S	.	.	G	3₁₀ helix	trans	-93.6	-8.3	172.7	-72.9	-50.1	0	0	0	113	M37 T38 P85 G86 V90	M37-H88 CarbonylContact C-O 3.56Å; M37-H88 WeakPolarHBondContact CA-O 3.34Å; M37-H88 HydrophobicContact CE-CB 3.75Å; T38-H88 PolarHBondContact N-O 2.84Å; T38-H88 PolarHBondContact OG1-ND1 2.77Å; P85-H88 PolarHBondContact O-N 3.04Å; G86-H88 PolarHBondContact O-N 2.85Å; H88-V90 PolarHBondContact O-N 3.1Å
89	V	98.3	Very high	92.8	Very high	38 Å²	38	72 Å²	72	23%	0.23	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75	119.9	-179.9	177.4	0	0	0	0	109.9	I35 I84 G86 I92	I35-V89 HydrophobicContact CG2-CG1 4.15Å; I35-V89 HydrophobicContact CG2-CG2 4.17Å; I84-V89 HydrophobicContact CG2-CG2 3.75Å; G86-V89 WeakPolarHBondContact O-CB 3.45Å; G86-V89 PolarHBondContact O-N 2.82Å; V89-I92 HydrophobicContact CG1-CD1 4.08Å; V89-I92 HydrophobicContact CG1-CG1 3.71Å
90	V	97.9	Very high	90.9	Very high	80 Å²	80	77.8 Å²	77.8	49%	0.485	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.6	-39.6	174.6	176	0	0	0	0	111	R36 T38 H88	R36-V90 HydrophobicContact CB-CB 4.35Å; R36-V90 WeakPolarHBondContact O-CB 3.3Å; R36-V90 PolarHBondContact O-N 2.82Å; T38-V90 HydrophobicContact CG2-CG2 3.7Å; H88-V90 PolarHBondContact O-N 3.1Å
91	S	97.9	Very high	88.5	Confident	24 Å²	24	82.8 Å²	82.8	17%	0.168	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.1	154.9	176.4	66.2	0	0	0	0	111.1	I35 R36	I35-S91 WeakPolarHBondContact CA-O 3.37Å; R36-S91 WeakPolarHBondContact CG-OG 3.17Å; R36-S91 PolarHBondContact N-O 2.83Å; R36-S91 PolarHBondContact NE-OG 3.48Å; R36-S91 VanDerWaalsContact NE-OG 3.12Å; R36-S91 PolarHBondContact NH1-OG 3.1Å; R36-S91 PolarHBondContact NH2-OG 3.44Å; R36-S91 VanDerWaalsContact NH2-OG 3.15Å
92	I	97.9	Very high	86.3	Confident	78 Å²	78	81.4 Å²	81.4	40%	0.4	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	131	171.8	-54.7	-177.4	0	0	0	107.5	M33 R34 I35 V56 V89	M33-I92 HydrophobicContact CB-CG2 4.26Å; M33-I92 HydrophobicContact CG-CG2 4.16Å; M33-I92 HydrophobicContact SD-CG2 3.47Å; M33-I92 WeakPolarHBondContact SD-CG2 3.41Å; R34-I92 WeakPolarHBondContact O-CA 3.29Å; I35-I92 HydrophobicContact CD1-CD1 4.44Å; I35-I92 HydrophobicContact CD1-CG1 4.38Å; I35-I92 HydrophobicContact CG1-CG1 4.13Å; I35-I92 HydrophobicContact CG1-CG2 4.29Å; V56-I92 HydrophobicContact CG2-CD1 4.44Å; V89-I92 HydrophobicContact CG1-CD1 4.08Å; V89-I92 HydrophobicContact CG1-CG1 3.71Å
93	E	97.9	Very high	84	Confident	73 Å²	73	88.8 Å²	88.8	34%	0.341	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	139.3	171.5	-64.9	162.7	-146	0	0	107.9	M33 R34 R36	M33-E93 CarbonylContact C-O 3.59Å; M33-E93 VanDerWaalsContact CA-O 3.23Å; M33-E93 WeakPolarHBondContact CA-O 3.27Å; R34-E93 HydrophobicContact CB-CB 4.31Å; R34-E93 IonicContact CZ-OE1 2.75Å; R34-E93 IonicContact CZ-OE2 3.11Å; R34-E93 PolarHBondContact N-O 3.37Å; R34-E93 IonicContact NE-OE1 3.37Å; R34-E93 IonicContact NE-OE2 2.76Å; R34-E93 PolarHBondContact NE-OE2 3.48Å; R34-E93 IonicContact NH2-OE1 2.8Å; R34-E93 PolarHBondContact NH2-OE1 3.07Å; R34-E93 IonicContact NH2-OE2 3.56Å; R34-E93 PolarHBondContact NH2-OE2 2.79Å; R34-E93 PolarHBondContact O-N 3.01Å; R36-E93 IonicContact NH1-OE1 3.2Å; R36-E93 PolarHBondContact NH1-OE1 2.71Å; R36-E93 VanDerWaalsContact NH1-OE1 3.11Å
94	V	96.8	Very high	81.7	Confident	59 Å²	59	85.3 Å²	85.3	36%	0.358	49%	0.494	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.6	132.3	-176.2	-170.9	0	0	0	0	107.5	L28 K31 M33 A96	L28-V94 HydrophobicContact CD2-CG1 4.18Å; L28-V94 HydrophobicContact CD2-CG2 3.97Å; K31-V94 HydrophobicContact CB-CG1 3.77Å; K31-V94 HydrophobicContact CD-CG1 3.68Å; K31-V94 HydrophobicContact CG-CG1 4.37Å; M33-V94 HydrophobicContact CE-CG2 4.01Å; M33-V94 HydrophobicContact CG-CG2 4.25Å; V94-A96 PolarHBondContact O-N 3Å
95	E	92.5	Very high	79.4	Confident	111 Å²	111	95 Å²	95	52%	0.519	54%	0.536	S	S	.	.			trans	-61.1	128	171.2	-172.6	167	-142.2	0	0	109	N32	N32-E95 HydrophobicContact CB-CB 3.9Å; N32-E95 WeakPolarHBondContact CB-OE2 3.34Å; N32-E95 PolarHBondContact ND2-OE2 3.03Å; N32-E95 PolarHBondContact O-N 3.15Å
96	A	86.9	Confident	77.1	Confident	81 Å²	81	97.3 Å²	97.3	67%	0.669	57%	0.566	S	S	*	*			trans	-69.6	143.9	174.3	0	0	0	0	0	108.7	V94 S98	V94-A96 PolarHBondContact O-N 3Å; A96-S98 PolarHBondContact O-N 3.22Å
97	D	77.3	Confident	74.7	Confident	118 Å²	118	100.7 Å²	100.7	63%	0.631	59%	0.593	S	S	*	*			trans	-64.3	107	171.6	-61.2	-37.4	0	0	0	107.3	K31 L99	K31-D97 IonicContact NZ-OD1 3.49Å; K31-D97 PolarHBondContact NZ-OD1 3.39Å; K31-D97 IonicContact NZ-OD2 3Å; K31-D97 PolarHBondContact NZ-OD2 2.87Å; D97-L99 PolarHBondContact O-N 3.01Å
98	S	64.8	Low	72.2	Confident	93 Å²	93	101.9 Å²	101.9	65%	0.65	60%	0.604	S	S	*	*			trans	-62.4	105.2	167.9	-45	0	0	0	0	106.4	A96 E100	A96-S98 PolarHBondContact O-N 3.22Å; S98-E100 PolarHBondContact O-N 2.75Å
99	L	57.5	Low	69.7	Low	148 Å²	148	110.9 Å²	110.9	78%	0.775	65%	0.646	S	S	*	*			trans	-69.1	74.5	161.9	-63.7	173.2	0	0	0	106.9	D97 D101	D97-L99 PolarHBondContact O-N 3.01Å; L99-D101 PolarHBondContact O-N 3.42Å; L99-D101 VanDerWaalsContact O-N 3.1Å
100	E	56.9	Low	68.3	Low	180 Å²	180	114.5 Å²	114.5	84%	0.841	67%	0.666	S	S	*	*			trans	-75.6	89.1	155.5	-70.3	-170.8	169.7	0	0	105.3	S98	S98-E100 PolarHBondContact O-N 2.75Å
101	D	48.5	Very low	66.7	Low	137 Å²	137	116.3 Å²	116.3	73%	0.733	68%	0.676	S	S	*	*			trans	-51	146.7	173.7	-77.1	-54	0	0	0	111	L99 D103	L99-D101 PolarHBondContact O-N 3.42Å; L99-D101 VanDerWaalsContact O-N 3.1Å; D101-D103 PolarHBondContact O-N 3.24Å
102	A	52	Low	65	Low	96 Å²	96	121.4 Å²	121.4	79%	0.793	70%	0.704	S	S	*	*			trans	-43.8	118.6	173.6	0	0	0	0	0	112.9
103	D	49.4	Very low	63.1	Low	166 Å²	166	124 Å²	124	89%	0.888	72%	0.722	S	S	*	*			trans	-134.2	108.4	154.7	-107.5	-26.4	0	0	0	111.1	D101	D101-D103 PolarHBondContact O-N 3.24Å
104	G	50.2	Low	60.9	Low	58 Å²	58	127.2 Å²	127.2	60%	0.598	75%	0.746	S	S	*	*			trans	27.2	123.8	151.6	0	0	0	0	0	120.7
105	F	50.4	Low	58.5	Low	204 Å²	204	131.7 Å²	131.7	90%	0.895	77%	0.772	S	S	*	*				-158	93.9	101.8	-102.2	-77.4	0	0	0	109.2	A107	F105-A107 PolarHBondContact O-N 3.47Å
106	G	50.4	Low	56.1	Low	81 Å²	81	133.2 Å²	133.2	84%	0.835	79%	0.79	S	S	*	*			trans	-68.9	117.3	144.4	0	0	0	0	0	107.5
107	A	48.8	Very low	53.7	Low	83 Å²	83	137.2 Å²	137.2	69%	0.686	80%	0.799	S	S	*	*			trans	-134.5	103.6	160.6	0	0	0	0	0	107.3	F105 H109	F105-A107 PolarHBondContact O-N 3.47Å; A107-H109 PolarHBondContact O-N 3.46Å
108	N	45.6	Very low	51.7	Low	166 Å²	166	138.8 Å²	138.8	89%	0.888	81%	0.813	S	S	*	*			trans	-53.6	129.3	160.6	-61.4	-67.8	0	0	0	109
109	H	46.1	Very low	50.5	Low	254 Å²	254	143 Å²	143	100%	1.176	83%	0.828	S	S	*	*				-158.5	0	128.9	-143.2	-63.6	0	0	0	111.8	A107	A107-H109 PolarHBondContact O-N 3.46Å

Retrieved 109 of 109 residues in 84.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).