A0A087Y3X0_POEFO Loading...

Midkine

Secreted protein that functions as cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors. Regulates many processes like inflammatory response, cell proliferation, cell adhesion, cell growth, cell survival, tissue regeneration, cell differentiation and cell migration.

AlphaFold DB , UniProt , Accession A0A087Y3X0, Species POEFO (Poecilia formosa, Amazon molly), Gene MDK, Length 97 aa.

						>A0A087Y3X0_POEFO|A0A087Y3X0|MDK
MRSLFSVTLLLLLALTLAVEANKRAKHHKGGKSDKSRPSECTAAETQYGKCVPDQGDCGDGLREATCKDRTDKIHCRIPCNWKKDISETRTQGSRGH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.2	Low	72.9	Confident	177 Å²	177	121 Å²	121	87%	0.872	62%	0.624	S	S	*	*				0	-64.1	0	-59	-79.2	-104.2	0	0	111.8	S3 L4 F5	M1-S3 PolarHBondContact O-N 3.15Å; M1-L4 PolarHBondContact O-N 3.31Å; M1-L4 VanDerWaalsContact O-N 3.15Å; M1-F5 WeakPolarHBondContact O-CD2 3.18Å; M1-F5 PolarHBondContact O-N 3.32Å
2	R	62.4	Low	73.4	Confident	230 Å²	230	120.1 Å²	120.1	87%	0.868	62%	0.62	S	S	*	*	H	α-helix	trans	-56.7	-40	-177.2	-72.2	178.9	167.6	178.3	-4.7	115.6	F5 S6	R2-F5 PolarHBondContact O-N 2.87Å; R2-S6 PolarHBondContact O-N 2.98Å; R2-S6 VanDerWaalsContact O-N 3.15Å
3	S	63.6	Low	73.7	Confident	87 Å²	87	118.7 Å²	118.7	61%	0.608	61%	0.614	S	S	*	*	H	α-helix	trans	-66.5	-36.5	178.4	177.5	0	0	0	0	112.4	M1 F5 S6 V7	M1-S3 PolarHBondContact O-N 3.15Å; S3-F5 PolarHBondContact O-N 2.98Å; S3-S6 PolarHBondContact O-N 3.44Å; S3-V7 WeakPolarHBondContact O-CG2 3.26Å; S3-V7 PolarHBondContact O-N 3.24Å
4	L	67.6	Low	73.7	Confident	121 Å²	121	114.1 Å²	114.1	63%	0.634	60%	0.602	S	S	*	*	H	α-helix	trans	-65.8	-41.7	178.1	-58	177.4	0	0	0	111.3	M1 S6 V7 T8	M1-L4 PolarHBondContact O-N 3.31Å; M1-L4 VanDerWaalsContact O-N 3.15Å; L4-S6 VanDerWaalsContact C-N 3.33Å; L4-S6 PolarHBondContact O-N 3.48Å; L4-V7 PolarHBondContact O-N 3.18Å; L4-T8 PolarHBondContact O-N 3.3Å; L4-T8 PolarHBondContact O-OG1 3.03Å
5	F	69	Low	73.6	Confident	144 Å²	144	113.6 Å²	113.6	63%	0.632	60%	0.599	S	S	*	*	H	α-helix	trans	-62.8	-37.5	174.4	-75.3	-74.2	0	0	0	112.8	M1 R2 S3 T8 L9	M1-F5 WeakPolarHBondContact O-CD2 3.18Å; M1-F5 PolarHBondContact O-N 3.32Å; R2-F5 PolarHBondContact O-N 2.87Å; S3-F5 PolarHBondContact O-N 2.98Å; F5-T8 WeakPolarHBondContact CA-OG1 3.42Å; F5-T8 PolarHBondContact O-OG1 3.06Å; F5-L9 VanDerWaalsContact O-CB 3.29Å; F5-L9 WeakPolarHBondContact O-CB 3.39Å; F5-L9 PolarHBondContact O-N 2.95Å
6	S	75.5	Confident	73.3	Confident	67 Å²	67	111.4 Å²	111.4	47%	0.469	59%	0.592	S	S	.	*	H	α-helix	trans	-67.4	-39	176.5	-169.8	0	0	0	0	111.9	R2 S3 L4 L10	R2-S6 PolarHBondContact O-N 2.98Å; R2-S6 VanDerWaalsContact O-N 3.15Å; S3-S6 PolarHBondContact O-N 3.44Å; L4-S6 VanDerWaalsContact C-N 3.33Å; L4-S6 PolarHBondContact O-N 3.48Å; S6-L10 WeakPolarHBondContact O-CB 3.39Å; S6-L10 WeakPolarHBondContact O-CD1 3.34Å; S6-L10 VanDerWaalsContact O-CG 3.26Å; S6-L10 WeakPolarHBondContact O-CG 3.29Å; S6-L10 PolarHBondContact O-N 3.15Å
7	V	79.4	Confident	72.8	Confident	88 Å²	88	111 Å²	111	53%	0.533	59%	0.589	S	S	.	*	H	α-helix	trans	-70.6	-42.6	179.6	174.1	0	0	0	0	110.8	S3 L4 L10 L11	S3-V7 WeakPolarHBondContact O-CG2 3.26Å; S3-V7 PolarHBondContact O-N 3.24Å; L4-V7 PolarHBondContact O-N 3.18Å; V7-L10 PolarHBondContact O-N 3.43Å; V7-L11 WeakPolarHBondContact O-CB 3.47Å; V7-L11 PolarHBondContact O-N 3.5Å
8	T	80.8	Confident	72	Confident	76 Å²	76	107.8 Å²	107.8	47%	0.466	58%	0.581	S	S	.	*	H	α-helix	trans	-66.1	-38.2	175.9	37.5	0	0	0	0	112.6	L4 F5 L11 L12	L4-T8 PolarHBondContact O-N 3.3Å; L4-T8 PolarHBondContact O-OG1 3.03Å; F5-T8 WeakPolarHBondContact CA-OG1 3.42Å; F5-T8 PolarHBondContact O-OG1 3.06Å; T8-L11 PolarHBondContact O-N 3.38Å; T8-L12 VanDerWaalsContact O-CD1 3.3Å; T8-L12 WeakPolarHBondContact O-CD1 3.3Å; T8-L12 PolarHBondContact O-N 3.36Å
9	L	82.1	Confident	71.4	Confident	125 Å²	125	107.2 Å²	107.2	65%	0.654	58%	0.581	S	S	*	*	H	α-helix	trans	-65.6	-43	176.3	-171.9	66.7	0	0	0	112	F5 L11 L12 L13	F5-L9 VanDerWaalsContact O-CB 3.29Å; F5-L9 WeakPolarHBondContact O-CB 3.39Å; F5-L9 PolarHBondContact O-N 2.95Å; L9-L11 VanDerWaalsContact C-N 3.3Å; L9-L11 PolarHBondContact O-N 3.33Å; L9-L12 PolarHBondContact O-N 3.47Å; L9-L13 WeakPolarHBondContact O-CB 3.32Å; L9-L13 PolarHBondContact O-N 3.24Å
10	L	81.2	Confident	70.5	Confident	112 Å²	112	108.9 Å²	108.9	59%	0.586	59%	0.585	S	S	*	*	H	α-helix	trans	-61.5	-39.8	174.5	-76.8	167.6	0	0	0	111.7	S6 V7 L13 A14	S6-L10 WeakPolarHBondContact O-CB 3.39Å; S6-L10 WeakPolarHBondContact O-CD1 3.34Å; S6-L10 VanDerWaalsContact O-CG 3.26Å; S6-L10 WeakPolarHBondContact O-CG 3.29Å; S6-L10 PolarHBondContact O-N 3.15Å; V7-L10 PolarHBondContact O-N 3.43Å; L10-L13 PolarHBondContact O-N 3.05Å; L10-A14 PolarHBondContact O-N 3.36Å
11	L	81.5	Confident	69.4	Low	104 Å²	104	107.1 Å²	107.1	55%	0.545	59%	0.585	S	S	.	*	H	α-helix	trans	-66.4	-43.8	178.1	-169.7	64.3	0	0	0	111.8	V7 T8 L9 L13 A14 L15	V7-L11 WeakPolarHBondContact O-CB 3.47Å; V7-L11 PolarHBondContact O-N 3.5Å; T8-L11 PolarHBondContact O-N 3.38Å; L9-L11 VanDerWaalsContact C-N 3.3Å; L9-L11 PolarHBondContact O-N 3.33Å; L11-L13 VanDerWaalsContact C-N 3.33Å; L11-L13 PolarHBondContact O-N 3.45Å; L11-A14 PolarHBondContact O-N 3.02Å; L11-L15 HydrophobicContact CG-CD1 4.22Å; L11-L15 WeakPolarHBondContact O-CD1 3.3Å; L11-L15 WeakPolarHBondContact O-CG 3.41Å; L11-L15 PolarHBondContact O-N 3.09Å; L11-L15 VanDerWaalsContact O-N 3.09Å
12	L	78.1	Confident	69	Low	110 Å²	110	105.2 Å²	105.2	58%	0.576	58%	0.579	S	S	*	*	H	α-helix	trans	-60.4	-42.9	174.4	-99.9	78.5	0	0	0	111.7	T8 L9 A14 L15 T16	T8-L12 VanDerWaalsContact O-CD1 3.3Å; T8-L12 WeakPolarHBondContact O-CD1 3.3Å; T8-L12 PolarHBondContact O-N 3.36Å; L9-L12 PolarHBondContact O-N 3.47Å; L12-A14 PolarHBondContact O-N 3.17Å; L12-L15 PolarHBondContact O-N 3.41Å; L12-T16 PolarHBondContact O-N 3Å; L12-T16 PolarHBondContact O-OG1 3.4Å
13	L	77.6	Confident	68.3	Low	102 Å²	102	102.7 Å²	102.7	53%	0.534	57%	0.574	S	S	.	*	H	α-helix	trans	-64.1	-40.8	179.4	-168.7	64.9	0	0	0	111.8	L9 L10 L11 L15 T16 L17	L9-L13 WeakPolarHBondContact O-CB 3.32Å; L9-L13 PolarHBondContact O-N 3.24Å; L10-L13 PolarHBondContact O-N 3.05Å; L11-L13 VanDerWaalsContact C-N 3.33Å; L11-L13 PolarHBondContact O-N 3.45Å; L13-L15 PolarHBondContact O-N 3.47Å; L13-T16 WeakPolarHBondContact CA-OG1 3.49Å; L13-T16 PolarHBondContact O-N 2.8Å; L13-T16 PolarHBondContact O-OG1 3.28Å; L13-L17 HydrophobicContact CG-CD1 4.36Å; L13-L17 VanDerWaalsContact O-CG 3.3Å; L13-L17 WeakPolarHBondContact O-CG 3.4Å; L13-L17 PolarHBondContact O-N 3.48Å; L13-L17 VanDerWaalsContact O-N 3.08Å
14	A	74	Confident	67.6	Low	55 Å²	55	109.7 Å²	109.7	46%	0.455	59%	0.587	S	S	.	*	H	α-helix	trans	-62.5	-40.4	175.4	0	0	0	0	0	112.5	L10 L11 L12 L17 A18	L10-A14 PolarHBondContact O-N 3.36Å; L11-A14 PolarHBondContact O-N 3.02Å; L12-A14 PolarHBondContact O-N 3.17Å; A14-L17 PolarHBondContact O-N 3.48Å; A14-A18 PolarHBondContact O-N 3.11Å; A14-A18 VanDerWaalsContact O-N 3.11Å
15	L	72.3	Confident	66.6	Low	106 Å²	106	107.5 Å²	107.5	56%	0.555	59%	0.586	S	S	*	*	H	α-helix	trans	-65.1	-41.3	177	-74.5	153.7	0	0	0	111.8	L11 L12 L13 A18 V19	L11-L15 HydrophobicContact CG-CD1 4.22Å; L11-L15 WeakPolarHBondContact O-CD1 3.3Å; L11-L15 WeakPolarHBondContact O-CG 3.41Å; L11-L15 PolarHBondContact O-N 3.09Å; L11-L15 VanDerWaalsContact O-N 3.09Å; L12-L15 PolarHBondContact O-N 3.41Å; L13-L15 PolarHBondContact O-N 3.47Å; L15-A18 PolarHBondContact O-N 3.02Å; L15-V19 WeakPolarHBondContact O-CG2 3.46Å; L15-V19 PolarHBondContact O-N 3.08Å; L15-V19 VanDerWaalsContact O-N 3.17Å
16	T	69.4	Low	65.4	Low	78 Å²	78	111 Å²	111	48%	0.479	60%	0.602	S	S	.	*	H	α-helix	trans	-66.8	-39.6	177.6	48.1	0	0	0	0	112.7	L12 L13 A18 V19 E20	L12-T16 PolarHBondContact O-N 3Å; L12-T16 PolarHBondContact O-OG1 3.4Å; L13-T16 WeakPolarHBondContact CA-OG1 3.49Å; L13-T16 PolarHBondContact O-N 2.8Å; L13-T16 PolarHBondContact O-OG1 3.28Å; T16-A18 VanDerWaalsContact C-N 3.35Å; T16-A18 PolarHBondContact O-N 3.07Å; T16-V19 PolarHBondContact O-N 3.49Å; T16-E20 PolarHBondContact O-N 3.48Å
17	L	63.2	Low	64	Low	105 Å²	105	115 Å²	115	55%	0.55	61%	0.612	S	S	.	*	H	α-helix	trans	-64.8	-37.9	176.2	-69.6	166.3	0	0	0	112.1	L13 A14 V19 E20 A21	L13-L17 HydrophobicContact CG-CD1 4.36Å; L13-L17 VanDerWaalsContact O-CG 3.3Å; L13-L17 WeakPolarHBondContact O-CG 3.4Å; L13-L17 PolarHBondContact O-N 3.48Å; L13-L17 VanDerWaalsContact O-N 3.08Å; A14-L17 PolarHBondContact O-N 3.48Å; L17-V19 VanDerWaalsContact C-N 3.33Å; L17-V19 PolarHBondContact O-N 3.24Å; L17-E20 PolarHBondContact O-N 3.15Å; L17-A21 PolarHBondContact O-N 3.47Å; L17-A21 VanDerWaalsContact O-N 3.15Å
18	A	59.8	Low	62.4	Low	54 Å²	54	118.7 Å²	118.7	45%	0.446	62%	0.623	S	S	.	*	H	α-helix	trans	-66.3	-34	175.6	0	0	0	0	0	112.6	A14 L15 T16 N22	A14-A18 PolarHBondContact O-N 3.11Å; A14-A18 VanDerWaalsContact O-N 3.11Å; L15-A18 PolarHBondContact O-N 3.02Å; T16-A18 VanDerWaalsContact C-N 3.35Å; T16-A18 PolarHBondContact O-N 3.07Å; A18-N22 PolarHBondContact O-ND2 3.24Å
19	V	59.9	Low	60.5	Low	96 Å²	96	124.4 Å²	124.4	58%	0.582	64%	0.642	S	S	*	*	H	α-helix	trans	-73.8	-37.6	177.3	168.1	0	0	0	0	111.9	L15 T16 L17 N22	L15-V19 WeakPolarHBondContact O-CG2 3.46Å; L15-V19 PolarHBondContact O-N 3.08Å; L15-V19 VanDerWaalsContact O-N 3.17Å; T16-V19 PolarHBondContact O-N 3.49Å; L17-V19 VanDerWaalsContact C-N 3.33Å; L17-V19 PolarHBondContact O-N 3.24Å; V19-N22 PolarHBondContact O-N 2.81Å
20	E	53.4	Low	58.4	Low	140 Å²	140	121.7 Å²	121.7	65%	0.654	64%	0.644	S	S	*	*	H	α-helix	trans	-70.7	-33.1	177.5	-73.8	-170.8	170.4	0	0	113.1	T16 L17 N22 K23	T16-E20 PolarHBondContact O-N 3.48Å; L17-E20 PolarHBondContact O-N 3.15Å; E20-N22 PolarHBondContact O-N 2.9Å; E20-K23 PolarHBondContact O-N 2.94Å; E20-K23 VanDerWaalsContact O-N 3.11Å
21	A	48.1	Very low	56.5	Low	72 Å²	72	119.8 Å²	119.8	60%	0.595	65%	0.652	S	S	*	*	H	α-helix	trans	-63.7	-21.9	172.2	0	0	0	0	0	113.2	L17	L17-A21 PolarHBondContact O-N 3.47Å; L17-A21 VanDerWaalsContact O-N 3.15Å
22	N	50.8	Low	54.4	Low	137 Å²	137	122.9 Å²	122.9	73%	0.733	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.7	-10.5	176.1	-79.5	-76	0	0	0	113.8	A18 V19 E20	A18-N22 PolarHBondContact O-ND2 3.24Å; V19-N22 PolarHBondContact O-N 2.81Å; E20-N22 PolarHBondContact O-N 2.9Å
23	K	47.8	Very low	52.8	Low	178 Å²	178	122.7 Å²	122.7	77%	0.774	67%	0.669	S	S	*	*	S	Bend	trans	-93.7	0.9	178.9	-94	-173.1	176.3	-171.1	0	115	E20	E20-K23 PolarHBondContact O-N 2.94Å; E20-K23 VanDerWaalsContact O-N 3.11Å
24	R	47.8	Very low	51	Low	234 Å²	234	124.4 Å²	124.4	88%	0.883	68%	0.678	S	S	*	*	S	Bend	trans	-134.9	47.5	-179.9	-65.9	-67.2	-170.7	-179.6	1.1	112.7
25	A	46.5	Very low	49.7	Very low	74 Å²	74	130.7 Å²	130.7	61%	0.612	70%	0.695	S	S	*	*			trans	-157.9	57.4	171.2	0	0	0	0	0	113.6
26	K	43.7	Very low	48.6	Very low	219 Å²	219	129.3 Å²	129.3	95%	0.952	70%	0.695	S	S	*	*	S	Bend	trans	-140.2	43.2	153.9	-81.9	-157.3	179.6	-175.2	0	111.5
27	H	46.1	Very low	47.8	Very low	151 Å²	151	136 Å²	136	70%	0.699	71%	0.711	S	S	*	*	S	Bend	trans	-132.9	130.7	155.8	-159.3	-109.8	0	0	0	105.3
28	H	46.4	Very low	47	Very low	165 Å²	165	136.6 Å²	136.6	76%	0.764	72%	0.722	S	S	*	*			trans	78.2	69.1	-174.8	-42.4	-74.2	0	0	0	116.7	G30	H28-G30 VanDerWaalsContact C-N 3.3Å
29	K	40.4	Very low	46.8	Very low	195 Å²	195	137.4 Å²	137.4	85%	0.848	72%	0.724	S	S	*	*			trans	-100.4	68	137.5	-160.5	169.8	179.9	-174.8	0	108.3
30	G	38	Very low	47	Very low	68 Å²	68	140.5 Å²	140.5	70%	0.701	73%	0.732	S	S	*	*			trans	-64.4	128.9	160.6	0	0	0	0	0	108.9	H28 K32	H28-G30 VanDerWaalsContact C-N 3.3Å; G30-K32 PolarHBondContact O-N 3.11Å
31	G	41	Very low	47.7	Very low	73 Å²	73	135.2 Å²	135.2	75%	0.753	71%	0.71	S	S	*	*			trans	62.9	55.1	140.9	0	0	0	0	0	116.8	S33	G31-S33 VanDerWaalsContact C-N 3.32Å
32	K	37.8	Very low	49	Very low	168 Å²	168	136.1 Å²	136.1	73%	0.73	71%	0.708	S	S	*	*			trans	-91	88.8	136.9	-86.5	179.6	176.6	173.2	0	106.2	G30 D34	G30-K32 PolarHBondContact O-N 3.11Å; K32-D34 PolarHBondContact O-N 3.24Å
33	S	44.9	Very low	50.1	Low	106 Å²	106	133 Å²	133	74%	0.741	70%	0.702	S	S	*	*			trans	-58.4	76.2	149.1	55.2	0	0	0	0	106.7	G31 K35	G31-S33 VanDerWaalsContact C-N 3.32Å; S33-K35 PolarHBondContact O-N 3.23Å
34	D	40.5	Very low	51.5	Low	139 Å²	139	129.3 Å²	129.3	74%	0.743	70%	0.704	S	S	*	*			trans	-58.2	103.2	154	-116.6	-85.6	0	0	0	102.8	K32 S36	K32-D34 PolarHBondContact O-N 3.24Å; D34-S36 PolarHBondContact O-N 2.98Å
35	K	46.6	Very low	53.2	Low	186 Å²	186	122.1 Å²	122.1	81%	0.809	68%	0.68	S	S	*	*			trans	-46.3	100.8	164.9	-79.2	173.2	162.1	78.8	0	103.9	S33 R37	S33-K35 PolarHBondContact O-N 3.23Å; K35-R37 VanDerWaalsContact C-N 3.28Å; K35-R37 PolarHBondContact O-N 2.88Å
36	S	49.3	Very low	55.1	Low	77 Å²	77	119.2 Å²	119.2	54%	0.538	66%	0.655	S	S	.	*			trans	-46.5	108.8	170.5	-173.6	0	0	0	0	103.6	D34	D34-S36 PolarHBondContact O-N 2.98Å
37	R	51.8	Low	57.3	Low	218 Å²	218	115.8 Å²	115.8	82%	0.823	64%	0.643	S	S	*	*			trans	-34.5	127.9	177.8	-177.4	177.6	175.5	169.4	-1.8	106.6	K35 S39	K35-R37 VanDerWaalsContact C-N 3.28Å; K35-R37 PolarHBondContact O-N 2.88Å; R37-S39 VanDerWaalsContact C-N 3.32Å; R37-S39 PolarHBondContact O-N 2.81Å
38	P	46.7	Very low	59.4	Low	119 Å²	119	113.3 Å²	113.3	77%	0.773	63%	0.628	S	S	*	*			trans	-49.2	104.5	-170.5	19.5	-31.6	0	0	0	107.4	E40	P38-E40 PolarHBondContact O-N 2.88Å
39	S	56.3	Low	61.5	Low	70 Å²	70	107.1 Å²	107.1	49%	0.49	61%	0.609	S	S	.	*			trans	-59.7	127.9	-178.7	-58.1	0	0	0	0	103.7	R37 C41	R37-S39 VanDerWaalsContact C-N 3.32Å; R37-S39 PolarHBondContact O-N 2.81Å; S39-C41 PolarHBondContact O-N 1.99Å
40	E	63	Low	63.8	Low	162 Å²	162	106.1 Å²	106.1	76%	0.757	60%	0.604	S	S	*	*	S	Bend	trans	-63.2	10.8	-178.3	-56.9	-171.7	89.3	0	0	113	P38 R70	P38-E40 PolarHBondContact O-N 2.88Å; E40-R70 IonicContact OE2-NH1 3.24Å; E40-R70 PolarHBondContact OE2-NH1 2.82Å
41	C	68.6	Low	66.4	Low	29 Å²	29	104.8 Å²	104.8	20%	0.196	58%	0.584	C	S	.	*	S	Bend	trans	-122.9	134.6	-173.9	-63	0	0	0	0	109.6	S39 C67	S39-C41 PolarHBondContact O-N 1.99Å; C41-C67 HydrophobicContact CB-CB 3.5Å; C41-C67 VanDerWaalsContact CB-CB 3.5Å; C41-C67 WeakPolarHBondContact CB-SG 3.48Å; C41-C67 WeakPolarHBondContact SG-CB 3.46Å; C41-C67 CovalentContact SG-SG 1.99Å; C41-C67 PolarHBondContact SG-SG 3.06Å
42	T	75.9	Confident	68.8	Low	91 Å²	91	105 Å²	105	56%	0.558	57%	0.57	S	S	*	*			trans	-68.2	154.4	175.6	-24.7	0	0	0	0	109.8	A44 E45 T46	T42-A44 PolarHBondContact O-N 2.72Å; T42-E45 WeakPolarHBondContact CB-OE2 3.49Å; T42-E45 PolarHBondContact N-OE2 2.87Å; T42-E45 PolarHBondContact O-N 2.69Å; T42-E45 PolarHBondContact OG1-OE2 3.19Å; T42-T46 PolarHBondContact O-N 2.77Å; T42-T46 PolarHBondContact O-OG1 2.73Å; T42-T46 VanDerWaalsContact O-OG1 3.07Å
43	A	73.2	Confident	71.4	Confident	72 Å²	72	98.8 Å²	98.8	60%	0.595	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.8	-25.3	175.7	0	0	0	0	0	112.9
44	A	77.1	Confident	73.5	Confident	99 Å²	99	99 Å²	99	82%	0.818	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.7	-27.3	175.8	0	0	0	0	0	114.1	T42	T42-A44 PolarHBondContact O-N 2.72Å
45	E	83.6	Confident	75.7	Confident	83 Å²	83	99.5 Å²	99.5	39%	0.388	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.4	-18.9	179.4	-64.9	171.4	95.4	0	0	112.2	T42 K68	T42-E45 WeakPolarHBondContact CB-OE2 3.49Å; T42-E45 PolarHBondContact N-OE2 2.87Å; T42-E45 PolarHBondContact O-N 2.69Å; T42-E45 PolarHBondContact OG1-OE2 3.19Å; E45-K68 IonicContact OE1-NZ 3.94Å
46	T	86.5	Confident	77.5	Confident	14 Å²	14	94.2 Å²	94.2	9%	0.086	54%	0.536	C	S	.	.			trans	-85.9	116.4	-176	-54.1	0	0	0	0	110	T42 Y48 A65	T42-T46 PolarHBondContact O-N 2.77Å; T42-T46 PolarHBondContact O-OG1 2.73Å; T42-T46 VanDerWaalsContact O-OG1 3.07Å; T46-Y48 HydrophobicContact CG2-CD1 4.03Å; T46-Y48 HydrophobicContact CG2-CE1 3.54Å; T46-Y48 HydrophobicContact CG2-CE2 4.12Å; T46-Y48 WeakPolarHBondContact O-CD2 3.45Å; T46-Y48 PolarHBondContact O-N 2.76Å; T46-A65 HydrophobicContact CG2-CB 3.72Å
47	Q	90.1	Very high	79.2	Confident	147 Å²	147	97.5 Å²	97.5	69%	0.687	55%	0.548	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.2	110.8	171.9	-67.1	-177	87.7	0	0	109.2	T66	Q47-T66 PolarHBondContact N-O 3.07Å; Q47-T66 PolarHBondContact O-N 3.41Å
48	Y	89.6	Confident	80.9	Confident	99 Å²	99	89.1 Å²	89.1	39%	0.388	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.8	123	176.9	-60.8	-73.2	0	0	0	110.5	T46 R63 E64 A65 I74	T46-Y48 HydrophobicContact CG2-CD1 4.03Å; T46-Y48 HydrophobicContact CG2-CE1 3.54Å; T46-Y48 HydrophobicContact CG2-CE2 4.12Å; T46-Y48 WeakPolarHBondContact O-CD2 3.45Å; T46-Y48 PolarHBondContact O-N 2.76Å; Y48-R63 VanDerWaalsContact CD1-CZ 3.42Å; Y48-E64 CarbonylContact C-O 3.58Å; Y48-E64 WeakPolarHBondContact CA-O 3.37Å; Y48-A65 HydrophobicContact CD1-CB 3.93Å; Y48-A65 HydrophobicContact CE1-CB 3.96Å; Y48-I74 HydrophobicContact CD1-CD1 3.74Å; Y48-I74 HydrophobicContact CE1-CD1 3.43Å; Y48-I74 VanDerWaalsContact CE1-CD1 3.43Å
49	G	89.8	Confident	82.9	Confident	35 Å²	35	84.2 Å²	84.2	36%	0.361	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.4	-178	169.9	0	0	0	0	0	112.8	E64	G49-E64 PolarHBondContact N-O 2.92Å
50	K	90.4	Very high	84.6	Confident	173 Å²	173	85.1 Å²	85.1	75%	0.752	49%	0.492	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-63.8	141.7	176.6	70.3	-164.9	-174.5	-161.5	0	111.1	V52 R63	K50-V52 HydrophobicContact CG-CG2 4.08Å; K50-R63 WeakPolarHBondContact O-CB 3.29Å
51	C	91.1	Very high	86.1	Confident	41 Å²	41	77.4 Å²	77.4	28%	0.277	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80	123.7	171.3	-173	0	0	0	0	109.5	R63 C76 I78	C51-R63 HydrophobicContact CB-CB 4.39Å; C51-C76 WeakPolarHBondContact CA-SG 2.83Å; C51-C76 HydrophobicContact CB-CB 3.86Å; C51-C76 WeakPolarHBondContact CB-SG 2.93Å; C51-C76 WeakPolarHBondContact SG-CB 3.38Å; C51-C76 CovalentContact SG-SG 2Å; C51-C76 PolarHBondContact SG-SG 2.93Å; C51-I78 HydrophobicContact CB-CD1 4.39Å; C51-I78 HydrophobicContact CB-CG1 4.02Å; C51-I78 WeakPolarHBondContact O-CD1 2.94Å; C51-I78 WeakPolarHBondContact SG-CG1 2.98Å
52	V	92.5	Very high	87.2	Confident	76 Å²	76	79.3 Å²	79.3	46%	0.461	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	127.5	179.1	-178	0	0	0	0	108.5	K50 G61 L62	K50-V52 HydrophobicContact CG-CG2 4.08Å; V52-G61 CarbonylContact O-C 3.56Å; V52-G61 WeakPolarHBondContact O-CA 3.42Å; V52-L62 PolarHBondContact N-O 2.89Å; V52-L62 PolarHBondContact O-N 2.96Å
53	P	92	Very high	88	Confident	38 Å²	38	78.9 Å²	78.9	25%	0.247	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.7	140.3	-179.8	23.5	-26.5	0	0	0	110.5	G56 I78	P53-G56 VanDerWaalsContact CG-O 3.25Å; P53-G56 WeakPolarHBondContact CG-O 3.49Å; P53-I78 HydrophobicContact CB-CD1 3.78Å; P53-I78 HydrophobicContact CG-CD1 3.89Å; P53-I78 VanDerWaalsContact N-CD1 3.34Å
54	D	89.6	Confident	88.9	Confident	110 Å²	110	80.4 Å²	80.4	59%	0.588	45%	0.447	S	S	*	.	S	Bend	trans	-69.3	-39.7	170.4	176.8	-105.1	0	0	0	110.5	D60	D54-D60 PolarHBondContact N-O 2.9Å
55	Q	84.9	Confident	89.5	Confident	151 Å²	151	76.1 Å²	76.1	71%	0.706	41%	0.411	S	S	*	.	S	Bend	trans	-140.1	135.1	-178.6	-76.7	170	86.2	0	0	111.1
56	G	85.4	Confident	89.7	Confident	74 Å²	74	74.2 Å²	74.2	76%	0.763	41%	0.405	S	S	*	.	S	Bend	trans	70.3	-153.5	179.9	0	0	0	0	0	113.1	P53	P53-G56 VanDerWaalsContact CG-O 3.25Å; P53-G56 WeakPolarHBondContact CG-O 3.49Å
57	D	85.4	Confident	89.8	Confident	147 Å²	147	74 Å²	74	79%	0.786	41%	0.405	S	S	*	.	S	Bend	trans	-100.3	-14.1	-178.5	-164	-110.4	0	0	0	112.6
58	C	87.8	Confident	89.6	Confident	41 Å²	41	75.3 Å²	75.3	28%	0.277	41%	0.408	S	S	.	.	S	Bend	trans	-151.9	162.7	-174.4	72.5	0	0	0	0	111.3	I78 C80	C58-I78 HydrophobicContact CB-CG2 4.14Å; C58-C80 HydrophobicContact CB-CB 3.77Å; C58-C80 WeakPolarHBondContact CB-SG 3.48Å; C58-C80 WeakPolarHBondContact SG-CA 3.45Å; C58-C80 WeakPolarHBondContact SG-CB 3.44Å; C58-C80 CovalentContact SG-SG 2.03Å; C58-C80 PolarHBondContact SG-SG 2.74Å
59	G	88.2	Confident	89.4	Confident	16 Å²	16	78.1 Å²	78.1	17%	0.165	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	114.2	-144	-177.8	0	0	0	0	0	112.5	R77 I78 C80	G59-R77 CarbonylContact O-C 3.51Å; G59-R77 WeakPolarHBondContact O-CA 3.36Å; G59-I78 PolarHBondContact N-O 2.77Å; G59-I78 PolarHBondContact O-N 2.03Å; G59-C80 PolarHBondContact N-SG 2.8Å; G59-C80 VanDerWaalsContact N-SG 3.43Å
60	D	92.3	Very high	89.1	Confident	90 Å²	90	84.2 Å²	84.2	48%	0.481	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.7	146.1	-180	-155.9	-98.8	0	0	0	111	D54 H75	D54-D60 PolarHBondContact N-O 2.9Å; D60-H75 IonicContact OD1-CD2 3.64Å
61	G	92.9	Very high	89.1	Confident	0 Å²	0	79.6 Å²	79.6	0%	0	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.2	179.5	-174.8	0	0	0	0	0	112.6	V52 H75 C76	V52-G61 CarbonylContact O-C 3.56Å; V52-G61 WeakPolarHBondContact O-CA 3.42Å; G61-H75 CarbonylContact O-C 3.54Å; G61-H75 WeakPolarHBondContact O-CA 3Å; G61-C76 CarbonylContact C-O 3.58Å; G61-C76 VanDerWaalsContact C-SG 3.52Å; G61-C76 PolarHBondContact N-O 3.42Å; G61-C76 PolarHBondContact O-N 3.19Å; G61-C76 VanDerWaalsContact O-O 3.1Å
62	L	93	Very high	88.9	Confident	69 Å²	69	82 Å²	82	36%	0.361	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	141.2	176.9	-68.3	167.7	0	0	0	109.7	V52 I74	V52-L62 PolarHBondContact N-O 2.89Å; V52-L62 PolarHBondContact O-N 2.96Å; L62-I74 WeakPolarHBondContact CA-O 3Å
63	R	92.4	Very high	88.7	Confident	81 Å²	81	85.7 Å²	85.7	31%	0.306	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	148.2	168.6	66.3	-179.3	-179.4	170.5	6.2	109.8	Y48 K50 C51 K73 I74 C76	Y48-R63 VanDerWaalsContact CD1-CZ 3.42Å; K50-R63 WeakPolarHBondContact O-CB 3.29Å; C51-R63 HydrophobicContact CB-CB 4.39Å; R63-K73 WeakPolarHBondContact O-CA 2.98Å; R63-I74 HydrophobicContact CG-CD1 4.11Å; R63-I74 HydrophobicContact CG-CG1 3.57Å; R63-I74 PolarHBondContact N-O 3.43Å; R63-I74 PolarHBondContact O-N 2Å; R63-C76 HydrophobicContact CB-CB 4.38Å; R63-C76 HydrophobicContact CG-CB 3.97Å; R63-C76 PolarHBondContact N-SG 2.92Å; R63-C76 VanDerWaalsContact N-SG 3.41Å
64	E	91.5	Very high	88.6	Confident	105 Å²	105	85.2 Å²	85.2	49%	0.491	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.7	138.2	171.6	-65.9	175.8	102.6	0	0	109.2	Y48 G49 T71 D72 K73	Y48-E64 CarbonylContact C-O 3.58Å; Y48-E64 WeakPolarHBondContact CA-O 3.37Å; G49-E64 PolarHBondContact N-O 2.92Å; E64-T71 HydrophobicContact CB-CG2 4.21Å; E64-T71 HydrophobicContact CG-CG2 4.46Å; E64-D72 CarbonylContact C-O 3.45Å; E64-D72 WeakPolarHBondContact CA-O 3.41Å; E64-K73 HydrophobicContact CG-CG 4.4Å
65	A	89.8	Confident	88.6	Confident	8 Å²	8	86.7 Å²	86.7	7%	0.066	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	103.5	175.2	0	0	0	0	0	106.1	T46 Y48 D72 I74	T46-A65 HydrophobicContact CG2-CB 3.72Å; Y48-A65 HydrophobicContact CD1-CB 3.93Å; Y48-A65 HydrophobicContact CE1-CB 3.96Å; A65-D72 PolarHBondContact N-O 2.85Å; A65-D72 PolarHBondContact O-N 2.73Å; A65-I74 HydrophobicContact CB-CD1 3.98Å; A65-I74 HydrophobicContact CB-CG1 4.06Å; A65-I74 HydrophobicContact CB-CG2 4.21Å
66	T	89.4	Confident	88.9	Confident	43 Å²	43	80.4 Å²	80.4	26%	0.264	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	122.2	177.9	-57.9	0	0	0	0	109	Q47 R70 T71	Q47-T66 PolarHBondContact N-O 3.07Å; Q47-T66 PolarHBondContact O-N 3.41Å; T66-R70 CarbonylContact C-O 3.52Å; T66-R70 VanDerWaalsContact CA-O 3.29Å; T66-R70 WeakPolarHBondContact CA-O 3.25Å; T66-T71 WeakPolarHBondContact CG2-OG1 3.38Å; T66-T71 WeakPolarHBondContact OG1-CG2 3.42Å; T66-T71 PolarHBondContact OG1-OG1 3.47Å
67	C	87.8	Confident	89	Confident	11 Å²	11	86.8 Å²	86.8	7%	0.074	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	125.3	169.7	174.3	0	0	0	0	110	C41 D69 R70	C41-C67 HydrophobicContact CB-CB 3.5Å; C41-C67 VanDerWaalsContact CB-CB 3.5Å; C41-C67 WeakPolarHBondContact CB-SG 3.48Å; C41-C67 WeakPolarHBondContact SG-CB 3.46Å; C41-C67 CovalentContact SG-SG 1.99Å; C41-C67 PolarHBondContact SG-SG 3.06Å; C67-D69 PolarHBondContact O-N 2.99Å; C67-R70 PolarHBondContact N-O 2.85Å; C67-R70 PolarHBondContact O-N 2.61Å
68	K	84.9	Confident	89.3	Confident	173 Å²	173	81.4 Å²	81.4	75%	0.752	39%	0.391	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.6	-103.1	-176.5	-62.3	171.9	-177.7	171.6	0	109.9	E45	E45-K68 IonicContact OE1-NZ 3.94Å
69	D	86	Confident	89.2	Confident	159 Å²	159	85 Å²	85	85%	0.85	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	-114.3	2.3	-179.1	-162.3	-115.8	0	0	0	112.9	C67	C67-D69 PolarHBondContact O-N 2.99Å
70	R	84	Confident	89.1	Confident	162 Å²	162	86.7 Å²	86.7	61%	0.611	42%	0.422	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.2	128.2	179.1	-68.3	-171.2	178.9	163.5	4.5	110.6	E40 T66 C67	E40-R70 IonicContact OE2-NH1 3.24Å; E40-R70 PolarHBondContact OE2-NH1 2.82Å; T66-R70 CarbonylContact C-O 3.52Å; T66-R70 VanDerWaalsContact CA-O 3.29Å; T66-R70 WeakPolarHBondContact CA-O 3.25Å; C67-R70 PolarHBondContact N-O 2.85Å; C67-R70 PolarHBondContact O-N 2.61Å
71	T	89.4	Confident	88.3	Confident	77 Å²	77	87.9 Å²	87.9	47%	0.472	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	114.1	170.5	-58.6	0	0	0	0	109.1	E64 T66	E64-T71 HydrophobicContact CB-CG2 4.21Å; E64-T71 HydrophobicContact CG-CG2 4.46Å; T66-T71 WeakPolarHBondContact CG2-OG1 3.38Å; T66-T71 WeakPolarHBondContact OG1-CG2 3.42Å; T66-T71 PolarHBondContact OG1-OG1 3.47Å
72	D	87.4	Confident	87.1	Confident	91 Å²	91	98.4 Å²	98.4	49%	0.487	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	153.9	176.8	-71.1	-77.8	0	0	0	110.4	E64 A65	E64-D72 CarbonylContact C-O 3.45Å; E64-D72 WeakPolarHBondContact CA-O 3.41Å; A65-D72 PolarHBondContact N-O 2.85Å; A65-D72 PolarHBondContact O-N 2.73Å
73	K	89.3	Confident	85.6	Confident	153 Å²	153	102.3 Å²	102.3	67%	0.665	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.9	121	171.7	-68.2	-176.2	-179.5	-177.7	0	109.2	R63 E64	R63-K73 WeakPolarHBondContact O-CA 2.98Å; E64-K73 HydrophobicContact CG-CG 4.4Å
74	I	89.4	Confident	83.9	Confident	29 Å²	29	105.3 Å²	105.3	15%	0.149	50%	0.498	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	150.4	179.2	64.3	168.8	0	0	0	110.7	Y48 L62 R63 A65	Y48-I74 HydrophobicContact CD1-CD1 3.74Å; Y48-I74 HydrophobicContact CE1-CD1 3.43Å; Y48-I74 VanDerWaalsContact CE1-CD1 3.43Å; L62-I74 WeakPolarHBondContact CA-O 3Å; R63-I74 HydrophobicContact CG-CD1 4.11Å; R63-I74 HydrophobicContact CG-CG1 3.57Å; R63-I74 PolarHBondContact N-O 3.43Å; R63-I74 PolarHBondContact O-N 2Å; A65-I74 HydrophobicContact CB-CD1 3.98Å; A65-I74 HydrophobicContact CB-CG1 4.06Å; A65-I74 HydrophobicContact CB-CG2 4.21Å
75	H	90	Very high	82.2	Confident	141 Å²	141	105.1 Å²	105.1	65%	0.653	50%	0.5	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.7	143.5	177.6	-65.7	85.1	0	0	0	111.2	D60 G61	D60-H75 IonicContact OD1-CD2 3.64Å; G61-H75 CarbonylContact O-C 3.54Å; G61-H75 WeakPolarHBondContact O-CA 3Å
76	C	89.9	Confident	80.7	Confident	18 Å²	18	112.5 Å²	112.5	12%	0.122	54%	0.537	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146	158.7	176.8	56.7	0	0	0	0	109.5	C51 G61 R63	C51-C76 WeakPolarHBondContact CA-SG 2.83Å; C51-C76 HydrophobicContact CB-CB 3.86Å; C51-C76 WeakPolarHBondContact CB-SG 2.93Å; C51-C76 WeakPolarHBondContact SG-CB 3.38Å; C51-C76 CovalentContact SG-SG 2Å; C51-C76 PolarHBondContact SG-SG 2.93Å; G61-C76 CarbonylContact C-O 3.58Å; G61-C76 VanDerWaalsContact C-SG 3.52Å; G61-C76 PolarHBondContact N-O 3.42Å; G61-C76 PolarHBondContact O-N 3.19Å; G61-C76 VanDerWaalsContact O-O 3.1Å; R63-C76 HydrophobicContact CB-CB 4.38Å; R63-C76 HydrophobicContact CG-CB 3.97Å; R63-C76 PolarHBondContact N-SG 2.92Å; R63-C76 VanDerWaalsContact N-SG 3.41Å
77	R	89.2	Confident	79.1	Confident	208 Å²	208	115 Å²	115	79%	0.785	56%	0.556	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-122.5	118.2	-178.1	-169.3	156.6	176.4	172.9	-3.3	110.7	G59	G59-R77 CarbonylContact O-C 3.51Å; G59-R77 WeakPolarHBondContact O-CA 3.36Å
78	I	90.5	Very high	77.5	Confident	34 Å²	34	122 Å²	122	17%	0.174	59%	0.588	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.6	121.8	177	-57.8	174.3	0	0	0	107.8	C51 P53 C58 G59 C80	C51-I78 HydrophobicContact CB-CD1 4.39Å; C51-I78 HydrophobicContact CB-CG1 4.02Å; C51-I78 WeakPolarHBondContact O-CD1 2.94Å; C51-I78 WeakPolarHBondContact SG-CG1 2.98Å; P53-I78 HydrophobicContact CB-CD1 3.78Å; P53-I78 HydrophobicContact CG-CD1 3.89Å; P53-I78 VanDerWaalsContact N-CD1 3.34Å; C58-I78 HydrophobicContact CB-CG2 4.14Å; G59-I78 PolarHBondContact N-O 2.77Å; G59-I78 PolarHBondContact O-N 2.03Å; I78-C80 PolarHBondContact O-N 3.18Å
79	P	86.2	Confident	76	Confident	116 Å²	116	119.7 Å²	119.7	75%	0.753	59%	0.588	S	S	*	*	P	Polyproline II helix	trans	-63.6	120.8	179.7	26.1	-33	0	0	0	110	N81	P79-N81 PolarHBondContact O-N 3.48Å
80	C	86.5	Confident	74.3	Confident	52 Å²	52	122.9 Å²	122.9	35%	0.351	59%	0.588	S	S	.	*	P	Polyproline II helix	trans	-77	121.1	172.6	-72.9	0	0	0	0	110.3	C58 G59 I78 W82	C58-C80 HydrophobicContact CB-CB 3.77Å; C58-C80 WeakPolarHBondContact CB-SG 3.48Å; C58-C80 WeakPolarHBondContact SG-CA 3.45Å; C58-C80 WeakPolarHBondContact SG-CB 3.44Å; C58-C80 CovalentContact SG-SG 2.03Å; C58-C80 PolarHBondContact SG-SG 2.74Å; G59-C80 PolarHBondContact N-SG 2.8Å; G59-C80 VanDerWaalsContact N-SG 3.43Å; I78-C80 PolarHBondContact O-N 3.18Å; C80-W82 VanDerWaalsContact C-N 3.25Å; C80-W82 VanDerWaalsContact O-CD1 3.31Å; C80-W82 PolarHBondContact O-N 3.23Å
81	N	75.2	Confident	72.7	Confident	115 Å²	115	121.4 Å²	121.4	62%	0.615	60%	0.597	S	S	*	*			trans	-91.2	56.1	171.7	-167.9	76.5	0	0	0	110.5	P79 K83 K84	P79-N81 PolarHBondContact O-N 3.48Å; N81-K83 VanDerWaalsContact C-N 3.26Å; N81-K83 PolarHBondContact O-N 3.5Å; N81-K84 VanDerWaalsContact ND2-CB 3.25Å; N81-K84 WeakPolarHBondContact ND2-CB 3.26Å
82	W	67.3	Low	70.8	Confident	222 Å²	222	127.3 Å²	127.3	84%	0.841	62%	0.62	S	S	*	*	S	Bend	trans	-80.7	-9.4	-179.3	61.7	-74.6	0	0	0	113	C80	C80-W82 VanDerWaalsContact C-N 3.25Å; C80-W82 VanDerWaalsContact O-CD1 3.31Å; C80-W82 PolarHBondContact O-N 3.23Å
83	K	60.7	Low	69.1	Low	150 Å²	150	125.8 Å²	125.8	65%	0.652	63%	0.626	S	S	*	*			trans	-143	68.6	177.7	-163.8	167.3	-176.6	-177.8	0	110.4	N81 D85	N81-K83 VanDerWaalsContact C-N 3.26Å; N81-K83 PolarHBondContact O-N 3.5Å; K83-D85 WeakPolarHBondContact CE-OD2 3.17Å; K83-D85 VanDerWaalsContact CG-OD2 3.26Å; K83-D85 WeakPolarHBondContact CG-OD2 3.25Å
84	K	57.2	Low	67.3	Low	144 Å²	144	123.6 Å²	123.6	63%	0.626	63%	0.629	S	S	*	*			trans	-90.8	92.5	153.9	-165.1	130.9	-174.9	173.8	0	105.2	N81 I86	N81-K84 VanDerWaalsContact ND2-CB 3.25Å; N81-K84 WeakPolarHBondContact ND2-CB 3.26Å; K84-I86 PolarHBondContact O-N 2.9Å
85	D	55.7	Low	65.2	Low	101 Å²	101	133.9 Å²	133.9	54%	0.54	67%	0.667	S	S	.	*			trans	-49.6	107.8	165.7	-84.4	-102.1	0	0	0	106.7	K83 S87	K83-D85 WeakPolarHBondContact CE-OD2 3.17Å; K83-D85 VanDerWaalsContact CG-OD2 3.26Å; K83-D85 WeakPolarHBondContact CG-OD2 3.25Å; D85-S87 PolarHBondContact O-N 2.85Å
86	I	58.6	Low	63.4	Low	164 Å²	164	130.6 Å²	130.6	84%	0.841	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.4	20	176.6	46.3	170.8	0	0	0	112.3	K84 E88	K84-I86 PolarHBondContact O-N 2.9Å; I86-E88 PolarHBondContact O-N 3.17Å
87	S	55.7	Low	61	Low	94 Å²	94	142.4 Å²	142.4	66%	0.657	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.1	-5.6	-178.4	58.7	0	0	0	0	113.6	D85 T89	D85-S87 PolarHBondContact O-N 2.85Å; S87-T89 VanDerWaalsContact C-N 3.28Å; S87-T89 PolarHBondContact O-N 2.8Å
88	E	54.5	Low	59.6	Low	159 Å²	159	139.2 Å²	139.2	74%	0.743	72%	0.721	S	S	*	*			trans	-89.4	68.3	170.9	-61.3	-166.8	96.8	0	0	110.3	I86 R90	I86-E88 PolarHBondContact O-N 3.17Å; E88-R90 PolarHBondContact O-N 3.35Å
89	T	54.2	Low	58	Low	124 Å²	124	144.7 Å²	144.7	76%	0.761	75%	0.749	S	S	*	*			trans	-57.4	86.4	146.2	32.7	0	0	0	0	107.3	S87 T91	S87-T89 VanDerWaalsContact C-N 3.28Å; S87-T89 PolarHBondContact O-N 2.8Å; T89-T91 PolarHBondContact O-N 2.92Å
90	R	48.7	Very low	56.4	Low	226 Å²	226	146.3 Å²	146.3	85%	0.853	75%	0.749	S	S	*	*			trans	-67	89.9	159.8	-101.3	-167.1	-177.8	-171.9	1.1	106.2	E88 Q92	E88-R90 PolarHBondContact O-N 3.35Å; R90-Q92 VanDerWaalsContact C-N 3.3Å; R90-Q92 PolarHBondContact O-N 2.89Å
91	T	51.2	Low	54.7	Low	131 Å²	131	151.8 Å²	151.8	80%	0.804	77%	0.773	S	S	*	*			trans	-49	103.3	151.6	15.2	0	0	0	0	106.7	T89 G93	T89-T91 PolarHBondContact O-N 2.92Å; T91-G93 PolarHBondContact O-N 2.84Å
92	Q	50.3	Low	53.4	Low	201 Å²	201	154.1 Å²	154.1	94%	0.939	78%	0.782	S	S	*	*			trans	-73.7	76.2	169.9	-159.9	152.5	5.8	0	0	106.9	R90	R90-Q92 VanDerWaalsContact C-N 3.3Å; R90-Q92 PolarHBondContact O-N 2.89Å
93	G	50.5	Low	52.5	Low	60 Å²	60	149.6 Å²	149.6	62%	0.619	78%	0.779	S	S	*	*			trans	-111.4	91.8	179	0	0	0	0	0	110.6	T91	T91-G93 PolarHBondContact O-N 2.84Å
94	S	52	Low	51.9	Low	106 Å²	106	149.6 Å²	149.6	74%	0.741	79%	0.788	S	S	*	*			trans	38.3	109.1	140.2	-49.8	0	0	0	0	120.6
95	R	45.9	Very low	51.5	Low	246 Å²	246	150 Å²	150	93%	0.928	80%	0.8	S	S	*	*				158	118.8	129.3	-94.1	172	-90.2	179	-10.5	108.4
96	G	50.7	Low	51.1	Low	72 Å²	72	154.1 Å²	154.1	74%	0.742	82%	0.822	S	S	*	*			cis	72.9	58.2	15.7	0	0	0	0	0	112
97	H	41.2	Very low	50.4	Low	266 Å²	266	153.2 Å²	153.2	100%	1.231	82%	0.82	S	S	*	*				175	0	129.6	-131.1	-109.5	0	0	0	109.6

Retrieved 97 of 97 residues in 73.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).