A0A087Y4K2_POEFO Loading...

BolA-like protein 3

Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with NFU1.

AlphaFold DB , UniProt , Accession A0A087Y4K2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 111 aa.

						>A0A087Y4K2_POEFO|A0A087Y4K2
MLACTRLCSSTIFSAFRTTPVAAVGHLQRGFSSQTDGEERIASVLKEKFPLASKLKVTDISGGCGAMYEIHIESSEFKGKRTVQQHQLVNQALKEEIQSMHGLRIFTNIPK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.7	Very low	43.6	Very low	255 Å²	255	145.9 Å²	145.9	100%	1.256	84%	0.84	S	S	*	*				0	118.7	0	-69	-165.8	175	0	0	107.5
2	L	42.3	Very low	44.3	Very low	173 Å²	173	146.7 Å²	146.7	91%	0.906	84%	0.836	S	S	*	*			trans	-108.3	145.7	-170.5	-155.9	78.7	0	0	0	109.1
3	A	38.2	Very low	44.5	Very low	88 Å²	88	150.8 Å²	150.8	73%	0.727	84%	0.84	S	S	*	*			trans	77.7	125.7	156.4	0	0	0	0	0	120.6
4	C	40.7	Very low	44.4	Very low	121 Å²	121	147.9 Å²	147.9	82%	0.818	83%	0.834	S	S	*	*				-174.4	89.7	125.5	-130.3	0	0	0	0	108.8
5	T	42	Very low	45	Very low	108 Å²	108	143.6 Å²	143.6	66%	0.663	83%	0.825	S	S	*	*				54	112.5	93.6	56.8	0	0	0	0	118.8
6	R	40.6	Very low	45.1	Very low	229 Å²	229	147.4 Å²	147.4	86%	0.864	83%	0.83	S	S	*	*				70.4	128.2	126.5	-64.8	-171.9	173	-146.4	-1.9	122.6
7	L	50	Low	45.3	Very low	151 Å²	151	151.7 Å²	151.7	79%	0.791	83%	0.83	S	S	*	*			trans	62.2	122.8	137.7	-102.6	71.1	0	0	0	120.7
8	C	42.6	Very low	45.6	Very low	134 Å²	134	150.3 Å²	150.3	91%	0.905	83%	0.827	S	S	*	*				-161.4	142	110.1	-99.5	0	0	0	0	112.5
9	S	44.3	Very low	46	Very low	111 Å²	111	147.6 Å²	147.6	78%	0.776	82%	0.815	S	S	*	*			trans	-93.4	143.3	178.8	179.9	0	0	0	0	109.3
10	S	43.6	Very low	46.1	Very low	110 Å²	110	146.6 Å²	146.6	77%	0.769	82%	0.815	S	S	*	*			trans	-175.3	111.8	147.7	44.1	0	0	0	0	111.6
11	T	47.2	Very low	46.4	Very low	125 Å²	125	145.7 Å²	145.7	77%	0.767	81%	0.814	S	S	*	*			trans	-53.7	130.1	158.5	18.2	0	0	0	0	111.7
12	I	52.9	Low	46.7	Very low	155 Å²	155	137.1 Å²	137.1	80%	0.795	78%	0.784	S	S	*	*			trans	-140.5	113	148.1	-59.1	-176.1	0	0	0	108.2
13	F	46.5	Very low	47.1	Very low	201 Å²	201	134 Å²	134	88%	0.882	78%	0.783	S	S	*	*			trans	-58	128.8	161.2	-89.5	-103	0	0	0	109.1
14	S	43.5	Very low	47.7	Very low	109 Å²	109	135.5 Å²	135.5	76%	0.762	78%	0.783	S	S	*	*			trans	-144.7	122.1	162.9	87.9	0	0	0	0	112.6
15	A	52.2	Low	48.2	Very low	84 Å²	84	133.2 Å²	133.2	69%	0.694	78%	0.779	S	S	*	*			trans	63.3	95	153.4	0	0	0	0	0	117.9	R17	A15-R17 VanDerWaalsContact C-N 3.33Å; A15-R17 PolarHBondContact O-N 2.69Å
16	F	47.1	Very low	48.3	Very low	205 Å²	205	134.4 Å²	134.4	90%	0.899	78%	0.777	S	S	*	*			trans	-44.6	101.3	139.1	-86.9	-97.4	0	0	0	109.3
17	R	48.3	Very low	48.9	Very low	220 Å²	220	130.4 Å²	130.4	83%	0.83	77%	0.772	S	S	*	*			trans	-94.4	93.1	157.5	-94	-176.5	168.2	-137.8	-1.1	107	A15 T19	A15-R17 VanDerWaalsContact C-N 3.33Å; A15-R17 PolarHBondContact O-N 2.69Å; R17-T19 PolarHBondContact O-N 3.44Å; R17-T19 VanDerWaalsContact O-N 3.09Å
18	T	50.7	Low	48.9	Very low	127 Å²	127	130.6 Å²	130.6	78%	0.779	77%	0.769	S	S	*	*			trans	-62.8	101.2	158	42.6	0	0	0	0	108
19	T	53	Low	49.3	Very low	99 Å²	99	134.5 Å²	134.5	61%	0.607	77%	0.765	S	S	*	*			trans	-97	122.1	161.7	45.3	0	0	0	0	108.1	R17 V21	R17-T19 PolarHBondContact O-N 3.44Å; R17-T19 VanDerWaalsContact O-N 3.09Å; T19-V21 VanDerWaalsContact C-N 3.31Å; T19-V21 PolarHBondContact O-N 2.87Å
20	P	47.9	Very low	49.6	Very low	126 Å²	126	132 Å²	132	82%	0.818	76%	0.756	S	S	*	*			trans	-74.9	93.1	164.1	30.8	-27.7	0	0	0	106.2	A22	P20-A22 PolarHBondContact O-N 3.4Å
21	V	53.3	Low	49.8	Very low	128 Å²	128	136.1 Å²	136.1	78%	0.776	76%	0.76	S	S	*	*			trans	-72.7	105.5	167.5	-175	0	0	0	0	106	T19 A23	T19-V21 VanDerWaalsContact C-N 3.31Å; T19-V21 PolarHBondContact O-N 2.87Å; V21-A23 PolarHBondContact O-N 3.09Å
22	A	53.2	Low	50.4	Low	76 Å²	76	135.8 Å²	135.8	63%	0.628	76%	0.763	S	S	*	*			trans	-44.6	130.7	178	0	0	0	0	0	111.2	P20 V24	P20-A22 PolarHBondContact O-N 3.4Å; A22-V24 VanDerWaalsContact C-N 3.32Å; A22-V24 PolarHBondContact O-N 3.49Å
23	A	51.3	Low	50.9	Low	107 Å²	107	132.2 Å²	132.2	88%	0.884	75%	0.752	S	S	*	*			trans	-57.1	97.1	160.5	0	0	0	0	0	108.6	V21 G25	V21-A23 PolarHBondContact O-N 3.09Å; A23-G25 PolarHBondContact O-N 3.04Å
24	V	50.2	Low	52.1	Low	120 Å²	120	129.4 Å²	129.4	73%	0.727	74%	0.741	S	S	*	*			trans	-91.5	91.6	160	-179.4	0	0	0	0	105.6	A22 H26	A22-V24 VanDerWaalsContact C-N 3.32Å; A22-V24 PolarHBondContact O-N 3.49Å; V24-H26 VanDerWaalsContact C-N 3.26Å; V24-H26 PolarHBondContact O-N 3.06Å
25	G	51.2	Low	54	Low	72 Å²	72	125 Å²	125	74%	0.742	71%	0.71	S	S	*	*			trans	-60.4	95.5	159.6	0	0	0	0	0	107.9	A23 L27	A23-G25 PolarHBondContact O-N 3.04Å; G25-L27 VanDerWaalsContact C-N 3.33Å; G25-L27 PolarHBondContact O-N 3.34Å
26	H	44.8	Very low	55.7	Low	133 Å²	133	126.8 Å²	126.8	62%	0.616	71%	0.708	S	S	*	*			trans	-91.4	84.7	162.4	-137.2	45	0	0	0	107.5	V24 Q28	V24-H26 VanDerWaalsContact C-N 3.26Å; V24-H26 PolarHBondContact O-N 3.06Å; H26-Q28 WeakPolarHBondContact CD2-CG 3.42Å; H26-Q28 PolarHBondContact CD2-OE1 2.9Å; H26-Q28 VanDerWaalsContact CD2-OE1 3.28Å; H26-Q28 WeakPolarHBondContact NE2-CG 3.23Å; H26-Q28 PolarHBondContact NE2-NE2 3.45Å; H26-Q28 PolarHBondContact O-N 3.41Å
27	L	52.7	Low	57.6	Low	146 Å²	146	117.7 Å²	117.7	76%	0.764	67%	0.672	S	S	*	*			trans	-69.6	69.8	160.8	-143.2	117.4	0	0	0	106.8	G25 R29	G25-L27 VanDerWaalsContact C-N 3.33Å; G25-L27 PolarHBondContact O-N 3.34Å; L27-R29 PolarHBondContact O-N 2.92Å
28	Q	50.7	Low	59.6	Low	155 Å²	155	108.2 Å²	108.2	72%	0.724	64%	0.637	S	S	*	*			trans	-72.7	82	163.9	-92.4	175.6	-38.5	0	0	106.6	H26 G30	H26-Q28 WeakPolarHBondContact CD2-CG 3.42Å; H26-Q28 PolarHBondContact CD2-OE1 2.9Å; H26-Q28 VanDerWaalsContact CD2-OE1 3.28Å; H26-Q28 WeakPolarHBondContact NE2-CG 3.23Å; H26-Q28 PolarHBondContact NE2-NE2 3.45Å; H26-Q28 PolarHBondContact O-N 3.41Å; Q28-G30 PolarHBondContact O-N 2.91Å
29	R	51.3	Low	61.4	Low	216 Å²	216	107.4 Å²	107.4	82%	0.815	62%	0.624	S	S	*	*			trans	-62.7	86.8	155.9	-168.7	-175.1	-67.9	174.9	-1.4	105	L27 F31	L27-R29 PolarHBondContact O-N 2.92Å; R29-F31 PolarHBondContact O-N 2.78Å
30	G	51	Low	63.2	Low	57 Å²	57	111 Å²	111	59%	0.588	63%	0.627	S	S	*	*			trans	-53.7	116.7	176	0	0	0	0	0	107.4	Q28 S32	Q28-G30 PolarHBondContact O-N 2.91Å; G30-S32 PolarHBondContact O-N 2.9Å
31	F	47.3	Very low	65.3	Low	197 Å²	197	105 Å²	105	86%	0.864	59%	0.588	S	S	*	*			trans	-53.9	113	165.5	-123.8	-102.9	0	0	0	105.6	R29 S33	R29-F31 PolarHBondContact O-N 2.78Å; F31-S33 PolarHBondContact O-N 3.23Å
32	S	59.2	Low	67.2	Low	118 Å²	118	99.7 Å²	99.7	83%	0.825	56%	0.558	S	S	*	*			trans	-69.3	77.3	170.6	-57.3	0	0	0	0	107.2	G30 Q34	G30-S32 PolarHBondContact O-N 2.9Å; S32-Q34 PolarHBondContact O-N 2.83Å; S32-Q34 VanDerWaalsContact O-N 3.1Å
33	S	64.4	Low	69.1	Low	81 Å²	81	99.1 Å²	99.1	57%	0.566	55%	0.549	S	S	*	.			trans	-64.5	106.8	163.8	48	0	0	0	0	105.5	F31 T35	F31-S33 PolarHBondContact O-N 3.23Å; S33-T35 PolarHBondContact O-N 2.77Å
34	Q	70.1	Confident	71	Confident	141 Å²	141	95.1 Å²	95.1	66%	0.659	51%	0.514	S	S	*	.			trans	-47	130.4	170.3	-69.1	-179.7	-92.9	0	0	108.2	S32 E38	S32-Q34 PolarHBondContact O-N 2.83Å; S32-Q34 VanDerWaalsContact O-N 3.1Å; Q34-E38 WeakPolarHBondContact CA-OE2 3.37Å; Q34-E38 VanDerWaalsContact CB-OE2 3.28Å; Q34-E38 WeakPolarHBondContact CB-OE2 3.15Å; Q34-E38 WeakPolarHBondContact CG-OE2 3.49Å
35	T	84.3	Confident	73.1	Confident	18 Å²	18	89.4 Å²	89.4	11%	0.11	48%	0.479	C	S	.	.			trans	-86.7	152	-179.9	69	0	0	0	0	109.4	S33 G37 E38 D59 Y68	S33-T35 PolarHBondContact O-N 2.77Å; T35-G37 PolarHBondContact O-N 2.88Å; T35-E38 WeakPolarHBondContact O-CB 3.39Å; T35-E38 PolarHBondContact O-N 3.3Å; T35-E38 PolarHBondContact OG1-N 2.83Å; T35-D59 HydrophobicContact CG2-CB 4.29Å; T35-D59 WeakPolarHBondContact CG2-OD2 3.45Å; T35-Y68 WeakPolarHBondContact OG1-CE1 3.24Å; T35-Y68 PolarHBondContact OG1-OH 3.45Å
36	D	87	Confident	75.1	Confident	121 Å²	121	92.4 Å²	92.4	65%	0.647	47%	0.472	S	S	*	.	H	α-helix	trans	-54.7	-27.4	174.2	-62	-75.8	0	0	0	112.3	R40	D36-R40 VanDerWaalsContact O-CG 3.3Å; D36-R40 WeakPolarHBondContact O-CG 3.36Å; D36-R40 PolarHBondContact O-N 3.48Å
37	G	88	Confident	77.4	Confident	14 Å²	14	93.5 Å²	93.5	14%	0.144	48%	0.477	C	S	.	.	H	α-helix	trans	-68.3	-38.4	176.4	0	0	0	0	0	113.3	T35 E39 R40 I41	T35-G37 PolarHBondContact O-N 2.88Å; G37-E39 VanDerWaalsContact C-N 3.32Å; G37-E39 PolarHBondContact O-N 3.47Å; G37-R40 PolarHBondContact O-N 3.4Å; G37-I41 WeakPolarHBondContact O-CD1 3.43Å; G37-I41 WeakPolarHBondContact O-CG1 3.47Å; G37-I41 PolarHBondContact O-N 3.44Å
38	E	89.4	Confident	79.3	Confident	21 Å²	21	92.4 Å²	92.4	10%	0.098	47%	0.466	C	S	.	.	H	α-helix	trans	-59.7	-44.3	176.8	-68.5	-178	155.3	0	0	111.4	Q34 T35 A42 V57 T58 D59 Y68	Q34-E38 WeakPolarHBondContact CA-OE2 3.37Å; Q34-E38 VanDerWaalsContact CB-OE2 3.28Å; Q34-E38 WeakPolarHBondContact CB-OE2 3.15Å; Q34-E38 WeakPolarHBondContact CG-OE2 3.49Å; T35-E38 WeakPolarHBondContact O-CB 3.39Å; T35-E38 PolarHBondContact O-N 3.3Å; T35-E38 PolarHBondContact OG1-N 2.83Å; E38-A42 VanDerWaalsContact O-CB 3.22Å; E38-A42 WeakPolarHBondContact O-CB 3.47Å; E38-A42 PolarHBondContact O-N 3.19Å; E38-V57 HydrophobicContact CB-CG1 4.3Å; E38-V57 HydrophobicContact CG-CG1 4.28Å; E38-T58 WeakPolarHBondContact OE1-CA 3.38Å; E38-D59 HydrophobicContact CG-CB 4.25Å; E38-D59 WeakPolarHBondContact OE1-CB 2.98Å; E38-D59 PolarHBondContact OE1-N 2.82Å; E38-Y68 HydrophobicContact CG-CD1 3.99Å; E38-Y68 HydrophobicContact CG-CE1 3.8Å
39	E	89.9	Confident	81.3	Confident	109 Å²	109	85.6 Å²	85.6	51%	0.509	43%	0.434	S	S	.	.	H	α-helix	trans	-66.7	-39.5	-178.6	-61.9	-170	170.3	0	0	112.1	G37 A42 S43	G37-E39 VanDerWaalsContact C-N 3.32Å; G37-E39 PolarHBondContact O-N 3.47Å; E39-A42 PolarHBondContact O-N 2.96Å; E39-S43 WeakPolarHBondContact O-CB 3.46Å; E39-S43 PolarHBondContact O-N 3.3Å; E39-S43 PolarHBondContact O-OG 3.2Å
40	R	90.9	Very high	83.2	Confident	174 Å²	174	80 Å²	80	66%	0.657	43%	0.426	S	S	*	.	H	α-helix	trans	-63.8	-51.3	176.1	-70.5	173.8	-166.5	-159.3	4.7	111.3	D36 G37 A42 S43 V44	D36-R40 VanDerWaalsContact O-CG 3.3Å; D36-R40 WeakPolarHBondContact O-CG 3.36Å; D36-R40 PolarHBondContact O-N 3.48Å; G37-R40 PolarHBondContact O-N 3.4Å; R40-A42 VanDerWaalsContact C-N 3.28Å; R40-A42 PolarHBondContact O-N 3.11Å; R40-S43 PolarHBondContact O-N 3.05Å; R40-S43 VanDerWaalsContact O-N 3.16Å; R40-V44 WeakPolarHBondContact O-CG2 3.41Å; R40-V44 PolarHBondContact O-N 2.98Å
41	I	91.4	Very high	85.2	Confident	0 Å²	0	82.2 Å²	82.2	0%	0	42%	0.424	C	S	.	.	H	α-helix	trans	-58.1	-44.9	177.4	-64.6	164.9	0	0	0	109.9	G37 S43 V44 L45 V57 Y68 I70 L93 M100	G37-I41 WeakPolarHBondContact O-CD1 3.43Å; G37-I41 WeakPolarHBondContact O-CG1 3.47Å; G37-I41 PolarHBondContact O-N 3.44Å; I41-S43 VanDerWaalsContact C-N 3.3Å; I41-S43 PolarHBondContact O-N 3.48Å; I41-V44 PolarHBondContact O-N 2.66Å; I41-L45 HydrophobicContact CG2-CD1 3.78Å; I41-L45 HydrophobicContact CG2-CG 4.3Å; I41-L45 WeakPolarHBondContact O-CB 3.32Å; I41-L45 VanDerWaalsContact O-CG 3.3Å; I41-L45 WeakPolarHBondContact O-CG 3.4Å; I41-L45 PolarHBondContact O-N 3.45Å; I41-V57 HydrophobicContact CB-CG1 4.3Å; I41-V57 HydrophobicContact CB-CG2 4.44Å; I41-V57 HydrophobicContact CD1-CG1 4.27Å; I41-V57 HydrophobicContact CG2-CG1 4.1Å; I41-V57 HydrophobicContact CG2-CG2 3.85Å; I41-Y68 HydrophobicContact CD1-CD1 3.96Å; I41-Y68 HydrophobicContact CD1-CD2 3.57Å; I41-Y68 HydrophobicContact CD1-CE1 4.23Å; I41-Y68 HydrophobicContact CD1-CE2 3.89Å; I41-Y68 HydrophobicContact CD1-CG 3.61Å; I41-I70 HydrophobicContact CG2-CD1 3.8Å; I41-I70 HydrophobicContact CG2-CG1 4.44Å; I41-L93 HydrophobicContact CG2-CD1 4.18Å; I41-L93 HydrophobicContact CG2-CD2 3.9Å; I41-M100 HydrophobicContact CD1-CE 3.47Å; I41-M100 VanDerWaalsContact CD1-CE 3.47Å; I41-M100 HydrophobicContact CD1-SD 3.86Å; I41-M100 HydrophobicContact CG1-CE 3.59Å; I41-M100 HydrophobicContact CG1-SD 4.47Å
42	A	92.3	Very high	87.3	Confident	18 Å²	18	74.2 Å²	74.2	15%	0.149	39%	0.394	C	S	.	.	H	α-helix	trans	-63	-36.9	-179.7	0	0	0	0	0	112.4	E38 E39 R40 K46 L55 V57	E38-A42 VanDerWaalsContact O-CB 3.22Å; E38-A42 WeakPolarHBondContact O-CB 3.47Å; E38-A42 PolarHBondContact O-N 3.19Å; E39-A42 PolarHBondContact O-N 2.96Å; R40-A42 VanDerWaalsContact C-N 3.28Å; R40-A42 PolarHBondContact O-N 3.11Å; A42-K46 WeakPolarHBondContact O-CB 3.45Å; A42-K46 WeakPolarHBondContact O-CG 3.46Å; A42-K46 PolarHBondContact O-N 3.37Å; A42-L55 HydrophobicContact CB-CD2 4.06Å; A42-V57 HydrophobicContact CB-CG2 4.21Å
43	S	92.8	Very high	88.9	Confident	63 Å²	63	72.4 Å²	72.4	44%	0.441	38%	0.382	S	S	.	.	H	α-helix	trans	-67.8	-48.7	177.9	-58.4	0	0	0	0	111.6	E39 R40 I41 L45 K46 E47	E39-S43 WeakPolarHBondContact O-CB 3.46Å; E39-S43 PolarHBondContact O-N 3.3Å; E39-S43 PolarHBondContact O-OG 3.2Å; R40-S43 PolarHBondContact O-N 3.05Å; R40-S43 VanDerWaalsContact O-N 3.16Å; I41-S43 VanDerWaalsContact C-N 3.3Å; I41-S43 PolarHBondContact O-N 3.48Å; S43-L45 VanDerWaalsContact C-N 3.34Å; S43-L45 PolarHBondContact O-N 3.2Å; S43-K46 WeakPolarHBondContact O-CB 3.28Å; S43-K46 PolarHBondContact O-N 2.9Å; S43-E47 PolarHBondContact O-N 2.98Å; S43-E47 VanDerWaalsContact O-N 3.1Å
44	V	93.1	Very high	90.3	Very high	24 Å²	24	74.7 Å²	74.7	15%	0.145	38%	0.381	C	S	.	.	H	α-helix	trans	-60	-44.5	177.6	175.8	0	0	0	0	111.2	R40 I41 K46 E47 K48 A92 L93 E96	R40-V44 WeakPolarHBondContact O-CG2 3.41Å; R40-V44 PolarHBondContact O-N 2.98Å; I41-V44 PolarHBondContact O-N 2.66Å; V44-K46 VanDerWaalsContact C-N 3.34Å; V44-K46 PolarHBondContact O-N 2.91Å; V44-E47 PolarHBondContact O-N 3.17Å; V44-K48 HydrophobicContact CG1-CG 4.3Å; V44-K48 VanDerWaalsContact O-CG 3.28Å; V44-K48 WeakPolarHBondContact O-CG 3.38Å; V44-K48 PolarHBondContact O-N 2.86Å; V44-A92 WeakPolarHBondContact CG1-O 3.46Å; V44-L93 HydrophobicContact CB-CD2 4.39Å; V44-L93 HydrophobicContact CG1-CD2 4.16Å; V44-E96 HydrophobicContact CG2-CG 4.21Å; V44-E96 WeakPolarHBondContact CG2-OE1 3.25Å
45	L	92.9	Very high	91.4	Very high	0 Å²	0	70.1 Å²	70.1	0%	0	36%	0.361	C	S	.	.	H	α-helix	trans	-66.4	-34.5	178.6	-72	176.4	0	0	0	112.9	I41 S43 E47 K48 F49 L55 V57 I70 I72 V89 A92 L93	I41-L45 HydrophobicContact CG2-CD1 3.78Å; I41-L45 HydrophobicContact CG2-CG 4.3Å; I41-L45 WeakPolarHBondContact O-CB 3.32Å; I41-L45 VanDerWaalsContact O-CG 3.3Å; I41-L45 WeakPolarHBondContact O-CG 3.4Å; I41-L45 PolarHBondContact O-N 3.45Å; S43-L45 VanDerWaalsContact C-N 3.34Å; S43-L45 PolarHBondContact O-N 3.2Å; L45-E47 VanDerWaalsContact C-N 3.33Å; L45-K48 PolarHBondContact O-N 3.28Å; L45-F49 HydrophobicContact CD2-CD2 3.97Å; L45-F49 HydrophobicContact CD2-CE2 3.78Å; L45-F49 WeakPolarHBondContact O-CB 3.41Å; L45-F49 PolarHBondContact O-N 2.86Å; L45-L55 HydrophobicContact CB-CD1 3.47Å; L45-L55 VanDerWaalsContact CB-CD1 3.47Å; L45-L55 HydrophobicContact CB-CG 4.36Å; L45-V57 HydrophobicContact CD1-CG2 4.29Å; L45-I70 HydrophobicContact CD1-CD1 4.36Å; L45-I70 HydrophobicContact CD1-CG2 3.52Å; L45-I72 HydrophobicContact CD1-CD1 3.94Å; L45-I72 HydrophobicContact CD2-CD1 3.86Å; L45-I72 HydrophobicContact CG-CD1 4.44Å; L45-V89 HydrophobicContact CD2-CG1 4.26Å; L45-A92 HydrophobicContact CD2-CB 4.41Å; L45-L93 HydrophobicContact CD1-CD1 4.39Å; L45-L93 HydrophobicContact CD2-CD1 4.03Å; L45-L93 HydrophobicContact CD2-CD2 4.03Å; L45-L93 HydrophobicContact CD2-CG 3.91Å; L45-L93 HydrophobicContact CG-CD1 4.38Å; L45-L93 HydrophobicContact CG-CD2 3.99Å; L45-L93 HydrophobicContact CG-CG 4.37Å
46	K	93.2	Very high	91.9	Very high	135 Å²	135	75.7 Å²	75.7	59%	0.587	38%	0.384	S	S	*	.	H	α-helix	trans	-64.1	-39.4	173.9	-78.8	170.6	-176.3	176.2	0	111.8	A42 S43 V44 L55	A42-K46 WeakPolarHBondContact O-CB 3.45Å; A42-K46 WeakPolarHBondContact O-CG 3.46Å; A42-K46 PolarHBondContact O-N 3.37Å; S43-K46 WeakPolarHBondContact O-CB 3.28Å; S43-K46 PolarHBondContact O-N 2.9Å; V44-K46 VanDerWaalsContact C-N 3.34Å; V44-K46 PolarHBondContact O-N 2.91Å; K46-L55 HydrophobicContact CG-CD1 3.98Å
47	E	93.1	Very high	92.1	Very high	155 Å²	155	70.9 Å²	70.9	72%	0.724	36%	0.359	S	S	*	.	H	α-helix	trans	-69.7	-40.5	177.4	-68.8	179.7	178.6	0	0	112.2	S43 V44 L45	S43-E47 PolarHBondContact O-N 2.98Å; S43-E47 VanDerWaalsContact O-N 3.1Å; V44-E47 PolarHBondContact O-N 3.17Å; L45-E47 VanDerWaalsContact C-N 3.33Å
48	K	93.1	Very high	92.3	Very high	123 Å²	123	72.5 Å²	72.5	54%	0.535	37%	0.366	S	S	.	.	H	α-helix	trans	-77.8	-30.4	-177.3	-63.8	-66.9	-177	-173.7	0	113.6	V44 L45 P50 A92	V44-K48 HydrophobicContact CG1-CG 4.3Å; V44-K48 VanDerWaalsContact O-CG 3.28Å; V44-K48 WeakPolarHBondContact O-CG 3.38Å; V44-K48 PolarHBondContact O-N 2.86Å; L45-K48 PolarHBondContact O-N 3.28Å; K48-P50 VanDerWaalsContact C-CD 3.5Å; K48-P50 WeakPolarHBondContact O-CD 3.47Å; K48-A92 HydrophobicContact CB-CB 3.95Å; K48-A92 HydrophobicContact CG-CB 3.8Å
49	F	93.4	Very high	92.4	Very high	12 Å²	12	72.6 Å²	72.6	5%	0.053	37%	0.367	C	S	.	.			trans	-122.6	72.7	-178.5	-59.5	-76.6	0	0	0	111	L45 L51 A52 I72 E76 F77 L88 V89 A92	L45-F49 HydrophobicContact CD2-CD2 3.97Å; L45-F49 HydrophobicContact CD2-CE2 3.78Å; L45-F49 WeakPolarHBondContact O-CB 3.41Å; L45-F49 PolarHBondContact O-N 2.86Å; F49-L51 PolarHBondContact O-N 2.83Å; F49-A52 HydrophobicContact CB-CB 4.05Å; F49-A52 WeakPolarHBondContact O-CB 3.42Å; F49-A52 PolarHBondContact O-N 3.03Å; F49-A52 VanDerWaalsContact O-N 3.08Å; F49-I72 HydrophobicContact CD2-CD1 4.49Å; F49-I72 HydrophobicContact CE2-CD1 4.41Å; F49-E76 WeakPolarHBondContact CD1-OE2 3.3Å; F49-F77 HydrophobicContact CD1-CE1 4.3Å; F49-F77 HydrophobicContact CD1-CZ 4.26Å; F49-F77 AromaticContact CE1-CE1 3.73Å; F49-F77 HydrophobicContact CE1-CE1 3.73Å; F49-F77 AromaticContact CE1-CZ 3.95Å; F49-F77 HydrophobicContact CE1-CZ 3.95Å; F49-F77 HydrophobicContact CZ-CE1 4.28Å; F49-F77 HydrophobicContact CZ-CZ 4.32Å; F49-L88 HydrophobicContact CZ-CB 4.34Å; F49-V89 HydrophobicContact CE2-CG2 4.2Å; F49-V89 HydrophobicContact CZ-CG2 3.98Å; F49-A92 HydrophobicContact CE2-CB 3.98Å; F49-A92 HydrophobicContact CZ-CB 4.43Å
50	P	91.4	Very high	92.4	Very high	100 Å²	100	70.4 Å²	70.4	65%	0.649	36%	0.358	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-22.3	-178.7	27.8	-35.9	0	0	0	113.2	K48 A52	K48-P50 VanDerWaalsContact C-CD 3.5Å; K48-P50 WeakPolarHBondContact O-CD 3.47Å; P50-A52 VanDerWaalsContact C-N 3.3Å
51	L	91.1	Very high	92.1	Very high	102 Å²	102	63.9 Å²	63.9	53%	0.534	34%	0.339	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89.2	7.6	177.1	-57.7	177	0	0	0	113.2	F49 S53 E76	F49-L51 PolarHBondContact O-N 2.83Å; L51-S53 PolarHBondContact O-N 3.06Å; L51-E76 HydrophobicContact CB-CG 4.03Å; L51-E76 HydrophobicContact CD1-CG 3.8Å; L51-E76 HydrophobicContact CG-CG 4.34Å
52	A	92.8	Very high	91.8	Very high	29 Å²	29	67.7 Å²	67.7	24%	0.24	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66	121.3	175.9	0	0	0	0	0	110.7	F49 P50 I72 E73	F49-A52 HydrophobicContact CB-CB 4.05Å; F49-A52 WeakPolarHBondContact O-CB 3.42Å; F49-A52 PolarHBondContact O-N 3.03Å; F49-A52 VanDerWaalsContact O-N 3.08Å; P50-A52 VanDerWaalsContact C-N 3.3Å; A52-I72 HydrophobicContact CB-CG2 4.39Å; A52-E73 CarbonylContact C-O 3.49Å; A52-E73 WeakPolarHBondContact CA-O 3.4Å
53	S	93.1	Very high	91.3	Very high	81 Å²	81	69 Å²	69	57%	0.566	39%	0.394	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.9	-36	176.1	-56.7	0	0	0	0	111.8	L51 E73	L51-S53 PolarHBondContact O-N 3.06Å; S53-E73 PolarHBondContact N-O 2.93Å
54	K	92.9	Very high	90.8	Very high	128 Å²	128	71 Å²	71	56%	0.557	41%	0.407	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-136.4	135.2	174	-52.2	-163.7	-169.2	98.7	0	110.2	E73	K54-E73 HydrophobicContact CB-CB 3.9Å; K54-E73 VanDerWaalsContact CD-OE2 3.24Å; K54-E73 WeakPolarHBondContact CD-OE2 3.2Å; K54-E73 WeakPolarHBondContact CE-OE2 3.5Å; K54-E73 HydrophobicContact CG-CB 4.36Å; K54-E73 WeakPolarHBondContact CG-OE2 3.45Å; K54-E73 PolarHBondContact N-O 3.49Å; K54-E73 IonicContact NZ-OE1 3.44Å; K54-E73 PolarHBondContact NZ-OE1 2.86Å; K54-E73 IonicContact NZ-OE2 2.69Å; K54-E73 PolarHBondContact NZ-OE2 2.79Å; K54-E73 PolarHBondContact O-N 3.26Å
55	L	94.2	Very high	90.3	Very high	46 Å²	46	70.6 Å²	70.6	24%	0.241	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	120.3	176.2	-176	161.7	0	0	0	107.5	A42 L45 K46 V57 H71	A42-L55 HydrophobicContact CB-CD2 4.06Å; L45-L55 HydrophobicContact CB-CD1 3.47Å; L45-L55 VanDerWaalsContact CB-CD1 3.47Å; L45-L55 HydrophobicContact CB-CG 4.36Å; K46-L55 HydrophobicContact CG-CD1 3.98Å; L55-V57 HydrophobicContact CD2-CG2 4.04Å; L55-H71 WeakPolarHBondContact CA-O 3.45Å
56	K	93.1	Very high	90	Very high	134 Å²	134	72 Å²	72	58%	0.583	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-134	128.1	176.1	-175.2	178.7	179.7	-177	0	109.2	T58 H71	K56-T58 WeakPolarHBondContact CE-OG1 3.47Å; K56-H71 HydrophobicContact CB-CB 4.33Å; K56-H71 PolarHBondContact N-O 2.77Å; K56-H71 PolarHBondContact O-N 3.48Å
57	V	92.4	Very high	89.8	Confident	20 Å²	20	68.6 Å²	68.6	12%	0.121	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	138.7	171.6	-175.2	0	0	0	0	107	E38 I41 A42 L45 L55 Y68 E69 I70	E38-V57 HydrophobicContact CB-CG1 4.3Å; E38-V57 HydrophobicContact CG-CG1 4.28Å; I41-V57 HydrophobicContact CB-CG1 4.3Å; I41-V57 HydrophobicContact CB-CG2 4.44Å; I41-V57 HydrophobicContact CD1-CG1 4.27Å; I41-V57 HydrophobicContact CG2-CG1 4.1Å; I41-V57 HydrophobicContact CG2-CG2 3.85Å; A42-V57 HydrophobicContact CB-CG2 4.21Å; L45-V57 HydrophobicContact CD1-CG2 4.29Å; L55-V57 HydrophobicContact CD2-CG2 4.04Å; V57-Y68 HydrophobicContact CG1-CD1 4.26Å; V57-E69 CarbonylContact C-O 3.56Å; V57-E69 WeakPolarHBondContact CA-O 3.28Å; V57-I70 HydrophobicContact CG1-CG1 4.4Å; V57-I70 HydrophobicContact CG2-CG2 4.41Å
58	T	91.1	Very high	89.8	Confident	48 Å²	48	61.7 Å²	61.7	29%	0.294	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.1	127.3	179.4	-59.3	0	0	0	0	109.6	E38 K56 E69	E38-T58 WeakPolarHBondContact OE1-CA 3.38Å; K56-T58 WeakPolarHBondContact CE-OG1 3.47Å; T58-E69 PolarHBondContact N-O 2.99Å; T58-E69 PolarHBondContact O-N 2.99Å
59	D	91.3	Very high	89.7	Confident	24 Å²	24	57.9 Å²	57.9	13%	0.128	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	122.8	173.1	-178.6	21.6	0	0	0	109.5	T35 E38 S61 G63 G65 Y68	T35-D59 HydrophobicContact CG2-CB 4.29Å; T35-D59 WeakPolarHBondContact CG2-OD2 3.45Å; E38-D59 HydrophobicContact CG-CB 4.25Å; E38-D59 WeakPolarHBondContact OE1-CB 2.98Å; E38-D59 PolarHBondContact OE1-N 2.82Å; D59-S61 VanDerWaalsContact CG-OG 3.24Å; D59-S61 WeakPolarHBondContact OD1-CA 3.49Å; D59-S61 VanDerWaalsContact OD1-CB 3.25Å; D59-S61 WeakPolarHBondContact OD1-CB 3.38Å; D59-S61 PolarHBondContact OD1-N 3.23Å; D59-S61 PolarHBondContact OD1-OG 3.08Å; D59-S61 PolarHBondContact OD2-OG 2.81Å; D59-S61 VanDerWaalsContact OD2-OG 3.13Å; D59-G63 VanDerWaalsContact OD2-CA 3.27Å; D59-G63 WeakPolarHBondContact OD2-CA 3.23Å; D59-G63 PolarHBondContact OD2-N 3.14Å; D59-G65 PolarHBondContact OD2-N 2.92Å; D59-Y68 HydrophobicContact CB-CD1 4.07Å; D59-Y68 HydrophobicContact CB-CE1 4.03Å
60	I	89.9	Confident	89.8	Confident	63 Å²	63	57.3 Å²	57.3	32%	0.323	36%	0.355	S	S	.	.			trans	-106.6	4.4	176.3	59.1	167.6	0	0	0	111.9	G62 M67 E69	I60-G62 VanDerWaalsContact C-N 3.34Å; I60-M67 HydrophobicContact CD1-CB 4.49Å; I60-M67 HydrophobicContact CD1-CE 3.93Å; I60-M67 HydrophobicContact CD1-CG 3.79Å; I60-M67 HydrophobicContact CD1-SD 3.68Å; I60-M67 HydrophobicContact CG1-CB 4Å; I60-M67 HydrophobicContact CG1-CG 3.83Å; I60-M67 VanDerWaalsContact CG1-O 3.3Å; I60-M67 WeakPolarHBondContact CG1-O 3.38Å; I60-M67 HydrophobicContact CG1-SD 4.15Å; I60-M67 PolarHBondContact N-O 2.87Å; I60-E69 HydrophobicContact CG2-CB 3.98Å
61	S	86	Confident	89.9	Confident	37 Å²	37	55.5 Å²	55.5	26%	0.259	34%	0.338	S	S	.	.	S	Bend	trans	-88.3	1.3	177.4	72.8	0	0	0	0	114.1	D59 C64 G65 A66	D59-S61 VanDerWaalsContact CG-OG 3.24Å; D59-S61 WeakPolarHBondContact OD1-CA 3.49Å; D59-S61 VanDerWaalsContact OD1-CB 3.25Å; D59-S61 WeakPolarHBondContact OD1-CB 3.38Å; D59-S61 PolarHBondContact OD1-N 3.23Å; D59-S61 PolarHBondContact OD1-OG 3.08Å; D59-S61 PolarHBondContact OD2-OG 2.81Å; D59-S61 VanDerWaalsContact OD2-OG 3.13Å; S61-C64 PolarHBondContact OG-N 2.86Å; S61-G65 PolarHBondContact OG-N 3.22Å; S61-A66 PolarHBondContact OG-N 3.32Å
62	G	84.8	Confident	90.1	Very high	79 Å²	79	50.7 Å²	50.7	81%	0.814	31%	0.313	S	S	*	.	S	Bend	trans	74.2	30.1	177.7	0	0	0	0	0	114	I60	I60-G62 VanDerWaalsContact C-N 3.34Å
63	G	81.6	Confident	90.3	Very high	46 Å²	46	51.2 Å²	51.2	47%	0.474	31%	0.31	S	S	.	.	S	Bend	trans	97.6	4.1	176.9	0	0	0	0	0	114.8	D59	D59-G63 VanDerWaalsContact OD2-CA 3.27Å; D59-G63 WeakPolarHBondContact OD2-CA 3.23Å; D59-G63 PolarHBondContact OD2-N 3.14Å
64	C	82.3	Confident	90.4	Very high	105 Å²	105	47.4 Å²	47.4	71%	0.709	28%	0.283	S	S	*	.	S	Bend	trans	-82.1	-19.3	174	-169.8	0	0	0	0	112	S61 A66	S61-C64 PolarHBondContact OG-N 2.86Å; C64-A66 HydrophobicContact CB-CB 4.45Å; C64-A66 PolarHBondContact O-N 3.49Å
65	G	83.5	Confident	90.4	Very high	16 Å²	16	43.9 Å²	43.9	17%	0.165	28%	0.275	C	S	.	.			trans	66.5	23.3	-174.9	0	0	0	0	0	114.1	D59 S61 Y68	D59-G65 PolarHBondContact OD2-N 2.92Å; S61-G65 PolarHBondContact OG-N 3.22Å; G65-Y68 WeakPolarHBondContact CA-OH 3.42Å; G65-Y68 WeakPolarHBondContact O-CE2 3.2Å; G65-Y68 PolarHBondContact O-OH 3.47Å
66	A	85.5	Confident	90.3	Very high	30 Å²	30	44.1 Å²	44.1	25%	0.248	28%	0.275	C	S	.	.	S	Bend	trans	-86.7	-25.5	-177.6	0	0	0	0	0	112.9	S61 C64 H101 G102	S61-A66 PolarHBondContact OG-N 3.32Å; C64-A66 HydrophobicContact CB-CB 4.45Å; C64-A66 PolarHBondContact O-N 3.49Å; A66-H101 HydrophobicContact CB-CB 4.31Å; A66-H101 WeakPolarHBondContact O-CA 3.5Å; A66-H101 VanDerWaalsContact O-CB 3.26Å; A66-H101 WeakPolarHBondContact O-CB 3.5Å; A66-H101 PolarHBondContact O-N 3.2Å; A66-G102 PolarHBondContact O-N 3.17Å
67	M	90.1	Very high	90.3	Very high	62 Å²	62	37.8 Å²	37.8	31%	0.305	25%	0.247	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-146.9	125.4	-172.8	-163	179.4	-175.9	0	0	111.7	I60 G102 R104	I60-M67 HydrophobicContact CD1-CB 4.49Å; I60-M67 HydrophobicContact CD1-CE 3.93Å; I60-M67 HydrophobicContact CD1-CG 3.79Å; I60-M67 HydrophobicContact CD1-SD 3.68Å; I60-M67 HydrophobicContact CG1-CB 4Å; I60-M67 HydrophobicContact CG1-CG 3.83Å; I60-M67 VanDerWaalsContact CG1-O 3.3Å; I60-M67 WeakPolarHBondContact CG1-O 3.38Å; I60-M67 HydrophobicContact CG1-SD 4.15Å; I60-M67 PolarHBondContact N-O 2.87Å; M67-G102 WeakPolarHBondContact CA-O 3.33Å; M67-G102 WeakPolarHBondContact CG-O 3.45Å; M67-R104 HydrophobicContact CE-CG 4.15Å
68	Y	91.4	Very high	90.3	Very high	10 Å²	10	44.7 Å²	44.7	4%	0.039	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	148.9	-177.2	-56.4	-87.4	0	0	0	112.1	T35 E38 I41 V57 D59 G65 M100 G102 L103 R104	T35-Y68 WeakPolarHBondContact OG1-CE1 3.24Å; T35-Y68 PolarHBondContact OG1-OH 3.45Å; E38-Y68 HydrophobicContact CG-CD1 3.99Å; E38-Y68 HydrophobicContact CG-CE1 3.8Å; I41-Y68 HydrophobicContact CD1-CD1 3.96Å; I41-Y68 HydrophobicContact CD1-CD2 3.57Å; I41-Y68 HydrophobicContact CD1-CE1 4.23Å; I41-Y68 HydrophobicContact CD1-CE2 3.89Å; I41-Y68 HydrophobicContact CD1-CG 3.61Å; V57-Y68 HydrophobicContact CG1-CD1 4.26Å; D59-Y68 HydrophobicContact CB-CD1 4.07Å; D59-Y68 HydrophobicContact CB-CE1 4.03Å; G65-Y68 WeakPolarHBondContact CA-OH 3.42Å; G65-Y68 WeakPolarHBondContact O-CE2 3.2Å; G65-Y68 PolarHBondContact O-OH 3.47Å; Y68-M100 HydrophobicContact CD2-CE 4.37Å; Y68-M100 HydrophobicContact CD2-CG 4.27Å; Y68-M100 HydrophobicContact CD2-SD 3.55Å; Y68-M100 VanDerWaalsContact CD2-SD 3.55Å; Y68-M100 HydrophobicContact CE2-CE 4.08Å; Y68-M100 HydrophobicContact CE2-CG 3.97Å; Y68-M100 HydrophobicContact CE2-SD 3.66Å; Y68-G102 PolarHBondContact N-O 3.42Å; Y68-L103 HydrophobicContact CD2-CD2 4.06Å; Y68-L103 HydrophobicContact CG-CD2 4.37Å; Y68-L103 CarbonylContact O-C 3.57Å; Y68-L103 WeakPolarHBondContact O-CA 3.35Å; Y68-R104 PolarHBondContact O-N 3.26Å
69	E	92.8	Very high	90.4	Very high	44 Å²	44	46.3 Å²	46.3	21%	0.206	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	127.5	169.8	-171.9	170	108.4	0	0	109.6	V57 T58 I60 H71 R104 F106	V57-E69 CarbonylContact C-O 3.56Å; V57-E69 WeakPolarHBondContact CA-O 3.28Å; T58-E69 PolarHBondContact N-O 2.99Å; T58-E69 PolarHBondContact O-N 2.99Å; I60-E69 HydrophobicContact CG2-CB 3.98Å; E69-H71 IonicContact OE1-CD2 3.75Å; E69-H71 IonicContact OE1-CE1 3.74Å; E69-H71 IonicContact OE1-NE2 2.78Å; E69-H71 PolarHBondContact OE1-NE2 2.88Å; E69-R104 WeakPolarHBondContact CA-O 3.39Å; E69-R104 HydrophobicContact CB-CB 4.36Å; E69-R104 HydrophobicContact CG-CB 4.06Å; E69-F106 HydrophobicContact CG-CD2 3.9Å; E69-F106 HydrophobicContact CG-CE2 3.66Å
70	I	93.6	Very high	90.6	Very high	0 Å²	0	48.8 Å²	48.8	0%	0	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	122.1	-172.4	-52.7	177.4	0	0	0	108.4	I41 L45 V57 I72 L93 L103 R104 F106	I41-I70 HydrophobicContact CG2-CD1 3.8Å; I41-I70 HydrophobicContact CG2-CG1 4.44Å; L45-I70 HydrophobicContact CD1-CD1 4.36Å; L45-I70 HydrophobicContact CD1-CG2 3.52Å; V57-I70 HydrophobicContact CG1-CG1 4.4Å; V57-I70 HydrophobicContact CG2-CG2 4.41Å; I70-I72 HydrophobicContact CG2-CD1 3.85Å; I70-I72 HydrophobicContact CG2-CG1 3.65Å; I70-L93 HydrophobicContact CD1-CD1 3.4Å; I70-L93 VanDerWaalsContact CD1-CD1 3.4Å; I70-L103 HydrophobicContact CD1-CD1 4.13Å; I70-L103 HydrophobicContact CD1-CD2 4.13Å; I70-R104 PolarHBondContact N-O 3.31Å; I70-F106 PolarHBondContact O-N 3.18Å
71	H	95.2	Very high	90.8	Very high	62 Å²	62	55.3 Å²	55.3	29%	0.287	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	118	174	-68	-102.4	0	0	0	109.1	L55 K56 E69 F106	L55-H71 WeakPolarHBondContact CA-O 3.45Å; K56-H71 HydrophobicContact CB-CB 4.33Å; K56-H71 PolarHBondContact N-O 2.77Å; K56-H71 PolarHBondContact O-N 3.48Å; E69-H71 IonicContact OE1-CD2 3.75Å; E69-H71 IonicContact OE1-CE1 3.74Å; E69-H71 IonicContact OE1-NE2 2.78Å; E69-H71 PolarHBondContact OE1-NE2 2.88Å; H71-F106 WeakPolarHBondContact CA-O 3.27Å; H71-F106 AromaticContact CE1-CD2 3.39Å; H71-F106 WeakPolarHBondContact CE1-CD2 3.35Å; H71-F106 AromaticContact CE1-CG 3.66Å; H71-F106 AromaticContact ND1-CD2 3.93Å; H71-F106 AromaticContact ND1-CG 3.89Å; H71-F106 AromaticContact NE2-CD2 3.53Å
72	I	95.3	Very high	91.2	Very high	1 Å²	1	57.7 Å²	57.7	1%	0.005	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	125.1	-179.9	-47	-178.4	0	0	0	109.2	L45 F49 A52 I70 F77 V89 F106 T107 N108	L45-I72 HydrophobicContact CD1-CD1 3.94Å; L45-I72 HydrophobicContact CD2-CD1 3.86Å; L45-I72 HydrophobicContact CG-CD1 4.44Å; F49-I72 HydrophobicContact CD2-CD1 4.49Å; F49-I72 HydrophobicContact CE2-CD1 4.41Å; A52-I72 HydrophobicContact CB-CG2 4.39Å; I70-I72 HydrophobicContact CG2-CD1 3.85Å; I70-I72 HydrophobicContact CG2-CG1 3.65Å; I72-F77 HydrophobicContact CB-CE2 3.99Å; I72-F77 HydrophobicContact CB-CZ 4.38Å; I72-F77 HydrophobicContact CG2-CE2 3.67Å; I72-F77 HydrophobicContact CG2-CZ 3.99Å; I72-V89 HydrophobicContact CD1-CG1 3.98Å; I72-V89 HydrophobicContact CD1-CG2 3.78Å; I72-F106 PolarHBondContact N-O 3.1Å; I72-T107 WeakPolarHBondContact O-CA 3.33Å; I72-N108 PolarHBondContact O-N 3.34Å
73	E	95.2	Very high	91.6	Very high	40 Å²	40	58.7 Å²	58.7	19%	0.187	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	109.4	171	-168.8	177.6	168.2	0	0	108.1	A52 S53 K54 N108 P110	A52-E73 CarbonylContact C-O 3.49Å; A52-E73 WeakPolarHBondContact CA-O 3.4Å; S53-E73 PolarHBondContact N-O 2.93Å; K54-E73 HydrophobicContact CB-CB 3.9Å; K54-E73 VanDerWaalsContact CD-OE2 3.24Å; K54-E73 WeakPolarHBondContact CD-OE2 3.2Å; K54-E73 WeakPolarHBondContact CE-OE2 3.5Å; K54-E73 HydrophobicContact CG-CB 4.36Å; K54-E73 WeakPolarHBondContact CG-OE2 3.45Å; K54-E73 PolarHBondContact N-O 3.49Å; K54-E73 IonicContact NZ-OE1 3.44Å; K54-E73 PolarHBondContact NZ-OE1 2.86Å; K54-E73 IonicContact NZ-OE2 2.69Å; K54-E73 PolarHBondContact NZ-OE2 2.79Å; K54-E73 PolarHBondContact O-N 3.26Å; E73-N108 VanDerWaalsContact CA-O 3.32Å; E73-N108 WeakPolarHBondContact CA-O 3.45Å; E73-N108 HydrophobicContact CG-CB 4.32Å; E73-P110 HydrophobicContact CG-CB 3.92Å; E73-P110 HydrophobicContact CG-CG 4.33Å; E73-P110 VanDerWaalsContact OE1-CA 3.23Å; E73-P110 WeakPolarHBondContact OE1-CA 3.25Å; E73-P110 WeakPolarHBondContact OE1-CB 3.48Å
74	S	95.5	Very high	92.3	Very high	0 Å²	0	60.7 Å²	60.7	0%	0	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.6	144.1	-177.3	-179.5	0	0	0	0	111.6	E76 F77 N108 P110	S74-E76 PolarHBondContact O-N 3.13Å; S74-E76 PolarHBondContact OG-N 2.54Å; S74-F77 PolarHBondContact O-N 2.67Å; S74-N108 PolarHBondContact N-O 3.49Å; S74-P110 WeakPolarHBondContact O-CD 3.44Å
75	S	93.9	Very high	92.9	Very high	55 Å²	55	56.3 Å²	56.3	39%	0.385	30%	0.301	S	S	.	.	G	3₁₀ helix	trans	-69.4	-19.3	174	58.6	0	0	0	0	112.5	F77 K78	S75-F77 PolarHBondContact O-N 2.9Å; S75-K78 WeakPolarHBondContact O-CB 3.44Å; S75-K78 PolarHBondContact O-N 2.91Å
76	E	91.4	Very high	93.4	Very high	51 Å²	51	58.2 Å²	58.2	24%	0.238	31%	0.306	C	S	.	.	G	3₁₀ helix	trans	-66.7	-15.8	177.4	-68.4	178.3	-150.4	0	0	114.3	F49 L51 S74 K78 K80	F49-E76 WeakPolarHBondContact CD1-OE2 3.3Å; L51-E76 HydrophobicContact CB-CG 4.03Å; L51-E76 HydrophobicContact CD1-CG 3.8Å; L51-E76 HydrophobicContact CG-CG 4.34Å; S74-E76 PolarHBondContact O-N 3.13Å; S74-E76 PolarHBondContact OG-N 2.54Å; E76-K78 VanDerWaalsContact C-N 3.3Å; E76-K80 WeakPolarHBondContact O-CE 3.17Å; E76-K80 PolarHBondContact O-NZ 3.06Å
77	F	93.8	Very high	93.8	Very high	0 Å²	0	61.6 Å²	61.6	0%	0	32%	0.316	C	S	.	.	G	3₁₀ helix	trans	-83.7	-9	175.5	-60	-36.7	0	0	0	112.6	F49 I72 S74 S75 G79 K80 Q85 V89 T107 I109	F49-F77 HydrophobicContact CD1-CE1 4.3Å; F49-F77 HydrophobicContact CD1-CZ 4.26Å; F49-F77 AromaticContact CE1-CE1 3.73Å; F49-F77 HydrophobicContact CE1-CE1 3.73Å; F49-F77 AromaticContact CE1-CZ 3.95Å; F49-F77 HydrophobicContact CE1-CZ 3.95Å; F49-F77 HydrophobicContact CZ-CE1 4.28Å; F49-F77 HydrophobicContact CZ-CZ 4.32Å; I72-F77 HydrophobicContact CB-CE2 3.99Å; I72-F77 HydrophobicContact CB-CZ 4.38Å; I72-F77 HydrophobicContact CG2-CE2 3.67Å; I72-F77 HydrophobicContact CG2-CZ 3.99Å; S74-F77 PolarHBondContact O-N 2.67Å; S75-F77 PolarHBondContact O-N 2.9Å; F77-G79 PolarHBondContact O-N 2.82Å; F77-K80 PolarHBondContact O-N 3.38Å; F77-K80 VanDerWaalsContact O-N 3.11Å; F77-Q85 HydrophobicContact CB-CG 3.87Å; F77-Q85 HydrophobicContact CD1-CB 3.98Å; F77-Q85 HydrophobicContact CD1-CG 3.85Å; F77-Q85 HydrophobicContact CE1-CB 4.36Å; F77-Q85 HydrophobicContact CG-CB 4.35Å; F77-Q85 HydrophobicContact CG-CG 3.99Å; F77-Q85 PolarHBondContact O-NE2 2.93Å; F77-V89 HydrophobicContact CE1-CG2 4.46Å; F77-V89 HydrophobicContact CZ-CG2 4.09Å; F77-T107 HydrophobicContact CD2-CG2 4.29Å; F77-T107 HydrophobicContact CE1-CG2 4.48Å; F77-T107 HydrophobicContact CE2-CG2 3.77Å; F77-T107 HydrophobicContact CZ-CG2 3.88Å; F77-I109 HydrophobicContact CB-CG1 3.86Å
78	K	93	Very high	94	Very high	166 Å²	166	61.1 Å²	61.1	72%	0.722	32%	0.315	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.9	125.5	177.4	-168.9	174.1	-177.5	175.3	0	110.5	S75 E76 K80 I109	S75-K78 WeakPolarHBondContact O-CB 3.44Å; S75-K78 PolarHBondContact O-N 2.91Å; E76-K78 VanDerWaalsContact C-N 3.3Å; K78-K80 VanDerWaalsContact C-N 3.32Å; K78-K80 PolarHBondContact O-N 3.37Å; K78-I109 HydrophobicContact CB-CG2 4.4Å
79	G	93	Very high	94.1	Very high	82 Å²	82	60.7 Å²	60.7	85%	0.845	31%	0.313	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.4	-0.4	-179.3	0	0	0	0	0	115.3	F77	F77-G79 PolarHBondContact O-N 2.82Å
80	K	94.3	Very high	94.1	Very high	75 Å²	75	62 Å²	62	33%	0.326	32%	0.322	S	S	.	.			trans	-99.8	145.4	175.2	-63.8	180	-178.3	151.6	0	111	E76 F77 K78 Q84 Q85 L88	E76-K80 WeakPolarHBondContact O-CE 3.17Å; E76-K80 PolarHBondContact O-NZ 3.06Å; F77-K80 PolarHBondContact O-N 3.38Å; F77-K80 VanDerWaalsContact O-N 3.11Å; K78-K80 VanDerWaalsContact C-N 3.32Å; K78-K80 PolarHBondContact O-N 3.37Å; K80-Q84 HydrophobicContact CB-CB 4.32Å; K80-Q85 HydrophobicContact CB-CG 3.92Å; K80-Q85 PolarHBondContact O-NE2 2.94Å; K80-L88 HydrophobicContact CD-CD1 3.44Å; K80-L88 VanDerWaalsContact CD-CD1 3.44Å
81	R	95.8	Very high	94	Very high	201 Å²	201	68.3 Å²	68.3	76%	0.758	35%	0.351	S	S	*	.			trans	-72	153.8	172.2	-65.2	-176.8	179.3	165.9	0.3	110.5	V83 Q84 Q85	R81-V83 VanDerWaalsContact C-N 3.27Å; R81-V83 PolarHBondContact O-N 3.45Å; R81-Q84 HydrophobicContact CB-CG 4.48Å; R81-Q84 WeakPolarHBondContact O-CA 3.4Å; R81-Q84 WeakPolarHBondContact O-CB 3.2Å; R81-Q84 PolarHBondContact O-N 3.39Å; R81-Q85 WeakPolarHBondContact O-CG 3.48Å; R81-Q85 PolarHBondContact O-N 3.05Å
82	T	93	Very high	93.8	Very high	87 Å²	87	66 Å²	66	53%	0.534	34%	0.342	S	S	.	.	H	α-helix	trans	-51.1	-43.6	179.5	-49.1	0	0	0	0	113.1	Q84 Q85 H86	T82-Q84 VanDerWaalsContact C-N 3.32Å; T82-Q84 PolarHBondContact O-N 2.98Å; T82-Q85 WeakPolarHBondContact O-CB 3.47Å; T82-Q85 PolarHBondContact O-N 3.18Å; T82-H86 PolarHBondContact O-CD2 3.23Å; T82-H86 PolarHBondContact O-N 3.47Å
83	V	94.7	Very high	93.6	Very high	99 Å²	99	66 Å²	66	60%	0.6	34%	0.342	S	S	*	.	H	α-helix	trans	-60.3	-41.5	177.1	177.4	0	0	0	0	111.7	R81 H86 Q87	R81-V83 VanDerWaalsContact C-N 3.27Å; R81-V83 PolarHBondContact O-N 3.45Å; V83-H86 PolarHBondContact O-N 2.99Å; V83-Q87 WeakPolarHBondContact O-CB 3.22Å; V83-Q87 VanDerWaalsContact O-CG 3.25Å; V83-Q87 WeakPolarHBondContact O-CG 3.3Å; V83-Q87 PolarHBondContact O-N 3.43Å
84	Q	95.1	Very high	93.3	Very high	88 Å²	88	71 Å²	71	41%	0.411	36%	0.363	S	S	.	.	H	α-helix	trans	-69.1	-38	178.1	-67.6	174.1	-17.1	0	0	111.6	K80 R81 T82 Q87 L88	K80-Q84 HydrophobicContact CB-CB 4.32Å; R81-Q84 HydrophobicContact CB-CG 4.48Å; R81-Q84 WeakPolarHBondContact O-CA 3.4Å; R81-Q84 WeakPolarHBondContact O-CB 3.2Å; R81-Q84 PolarHBondContact O-N 3.39Å; T82-Q84 VanDerWaalsContact C-N 3.32Å; T82-Q84 PolarHBondContact O-N 2.98Å; Q84-Q87 PolarHBondContact O-N 3.39Å; Q84-L88 WeakPolarHBondContact O-CG 3.45Å; Q84-L88 PolarHBondContact O-N 3.33Å
85	Q	95.1	Very high	92.7	Very high	13 Å²	13	78.4 Å²	78.4	6%	0.061	40%	0.398	C	S	.	.	H	α-helix	trans	-60.5	-48.6	175.1	-60.8	169.5	13.3	0	0	110.1	F77 K80 R81 T82 Q87 L88 V89 T107	F77-Q85 HydrophobicContact CB-CG 3.87Å; F77-Q85 HydrophobicContact CD1-CB 3.98Å; F77-Q85 HydrophobicContact CD1-CG 3.85Å; F77-Q85 HydrophobicContact CE1-CB 4.36Å; F77-Q85 HydrophobicContact CG-CB 4.35Å; F77-Q85 HydrophobicContact CG-CG 3.99Å; F77-Q85 PolarHBondContact O-NE2 2.93Å; K80-Q85 HydrophobicContact CB-CG 3.92Å; K80-Q85 PolarHBondContact O-NE2 2.94Å; R81-Q85 WeakPolarHBondContact O-CG 3.48Å; R81-Q85 PolarHBondContact O-N 3.05Å; T82-Q85 WeakPolarHBondContact O-CB 3.47Å; T82-Q85 PolarHBondContact O-N 3.18Å; Q85-Q87 VanDerWaalsContact C-N 3.33Å; Q85-Q87 PolarHBondContact O-N 3.45Å; Q85-L88 WeakPolarHBondContact O-CB 3.26Å; Q85-L88 PolarHBondContact O-N 3.44Å; Q85-V89 WeakPolarHBondContact O-CG2 3.45Å; Q85-V89 PolarHBondContact O-N 3.41Å; Q85-V89 VanDerWaalsContact O-N 3.14Å; Q85-T107 HydrophobicContact CB-CG2 4.08Å; Q85-T107 VanDerWaalsContact OE1-CB 3.3Å; Q85-T107 PolarHBondContact OE1-OG1 3.17Å
86	H	94.4	Very high	92.1	Very high	57 Å²	57	78 Å²	78	26%	0.264	39%	0.39	S	S	.	.	H	α-helix	trans	-63.9	-37.3	176.8	-67.4	-170	0	0	0	112.3	T82 V83 L88 V89 N90 I105 T107	T82-H86 PolarHBondContact O-CD2 3.23Å; T82-H86 PolarHBondContact O-N 3.47Å; V83-H86 PolarHBondContact O-N 2.99Å; H86-L88 VanDerWaalsContact C-N 3.34Å; H86-L88 PolarHBondContact O-N 3.07Å; H86-V89 PolarHBondContact O-N 3.44Å; H86-N90 WeakPolarHBondContact O-CB 3.41Å; H86-N90 VanDerWaalsContact O-CG 3.23Å; H86-N90 PolarHBondContact O-N 3.04Å; H86-N90 PolarHBondContact O-ND2 3.42Å; H86-I105 PolarHBondContact CE1-O 3.03Å; H86-I105 PolarHBondContact NE2-O 2.86Å; H86-T107 PolarHBondContact CD2-OG1 2.96Å
87	Q	94	Very high	91.2	Very high	101 Å²	101	77.9 Å²	77.9	47%	0.472	39%	0.391	S	S	.	.	H	α-helix	trans	-60.9	-41.1	174.1	-78.5	172.1	-8.3	0	0	112.2	V83 Q84 Q85 N90 Q91	V83-Q87 WeakPolarHBondContact O-CB 3.22Å; V83-Q87 VanDerWaalsContact O-CG 3.25Å; V83-Q87 WeakPolarHBondContact O-CG 3.3Å; V83-Q87 PolarHBondContact O-N 3.43Å; Q84-Q87 PolarHBondContact O-N 3.39Å; Q85-Q87 VanDerWaalsContact C-N 3.33Å; Q85-Q87 PolarHBondContact O-N 3.45Å; Q87-N90 PolarHBondContact O-N 3.03Å; Q87-Q91 WeakPolarHBondContact O-CB 3.29Å; Q87-Q91 VanDerWaalsContact O-CG 3.23Å; Q87-Q91 WeakPolarHBondContact O-CG 3.08Å; Q87-Q91 PolarHBondContact O-N 3.4Å
88	L	93.4	Very high	90.3	Very high	52 Å²	52	85.4 Å²	85.4	27%	0.272	43%	0.426	S	S	.	.	H	α-helix	trans	-64.1	-42.3	176.9	-70.3	167.2	0	0	0	111.7	F49 K80 Q84 Q85 H86 Q91 A92	F49-L88 HydrophobicContact CZ-CB 4.34Å; K80-L88 HydrophobicContact CD-CD1 3.44Å; K80-L88 VanDerWaalsContact CD-CD1 3.44Å; Q84-L88 WeakPolarHBondContact O-CG 3.45Å; Q84-L88 PolarHBondContact O-N 3.33Å; Q85-L88 WeakPolarHBondContact O-CB 3.26Å; Q85-L88 PolarHBondContact O-N 3.44Å; H86-L88 VanDerWaalsContact C-N 3.34Å; H86-L88 PolarHBondContact O-N 3.07Å; L88-Q91 PolarHBondContact O-N 3.44Å; L88-A92 WeakPolarHBondContact O-CB 3.47Å; L88-A92 PolarHBondContact O-N 2.97Å
89	V	93.1	Very high	89.2	Confident	0 Å²	0	82.5 Å²	82.5	0%	0	43%	0.427	C	S	.	.	H	α-helix	trans	-65.7	-42.9	176.5	179.5	0	0	0	0	110.9	L45 F49 I72 F77 Q85 H86 Q91 A92 L93 I105 T107	L45-V89 HydrophobicContact CD2-CG1 4.26Å; F49-V89 HydrophobicContact CE2-CG2 4.2Å; F49-V89 HydrophobicContact CZ-CG2 3.98Å; I72-V89 HydrophobicContact CD1-CG1 3.98Å; I72-V89 HydrophobicContact CD1-CG2 3.78Å; F77-V89 HydrophobicContact CE1-CG2 4.46Å; F77-V89 HydrophobicContact CZ-CG2 4.09Å; Q85-V89 WeakPolarHBondContact O-CG2 3.45Å; Q85-V89 PolarHBondContact O-N 3.41Å; Q85-V89 VanDerWaalsContact O-N 3.14Å; H86-V89 PolarHBondContact O-N 3.44Å; V89-Q91 VanDerWaalsContact C-N 3.3Å; V89-Q91 PolarHBondContact O-N 3.42Å; V89-A92 WeakPolarHBondContact O-CB 3.48Å; V89-A92 PolarHBondContact O-N 3.38Å; V89-L93 HydrophobicContact CG1-CD1 4Å; V89-L93 PolarHBondContact O-N 2.99Å; V89-I105 HydrophobicContact CB-CD1 4.22Å; V89-I105 HydrophobicContact CB-CG2 4.2Å; V89-I105 HydrophobicContact CG1-CD1 3.87Å; V89-I105 HydrophobicContact CG1-CG1 4.21Å; V89-I105 HydrophobicContact CG1-CG2 4.05Å; V89-I105 HydrophobicContact CG2-CG2 4.26Å; V89-T107 HydrophobicContact CG2-CG2 4.09Å
90	N	93	Very high	88.3	Confident	72 Å²	72	80 Å²	80	39%	0.385	39%	0.393	S	S	.	.	H	α-helix	trans	-63.2	-35.9	175.4	-73.9	-14.5	0	0	0	112.6	H86 Q87 K94 I105	H86-N90 WeakPolarHBondContact O-CB 3.41Å; H86-N90 VanDerWaalsContact O-CG 3.23Å; H86-N90 PolarHBondContact O-N 3.04Å; H86-N90 PolarHBondContact O-ND2 3.42Å; Q87-N90 PolarHBondContact O-N 3.03Å; N90-K94 WeakPolarHBondContact O-CA 3.5Å; N90-K94 WeakPolarHBondContact O-CB 3.45Å; N90-K94 PolarHBondContact O-N 3.28Å; N90-K94 VanDerWaalsContact O-N 3.07Å; N90-I105 WeakPolarHBondContact OD1-CD1 3.28Å
91	Q	92.3	Very high	87.6	Confident	132 Å²	132	85.2 Å²	85.2	62%	0.617	42%	0.418	S	S	*	.	H	α-helix	trans	-68.3	-40.8	175	-76.4	172.8	14.4	0	0	111.5	Q87 L88 V89 L93 K94	Q87-Q91 WeakPolarHBondContact O-CB 3.29Å; Q87-Q91 VanDerWaalsContact O-CG 3.23Å; Q87-Q91 WeakPolarHBondContact O-CG 3.08Å; Q87-Q91 PolarHBondContact O-N 3.4Å; L88-Q91 PolarHBondContact O-N 3.44Å; V89-Q91 VanDerWaalsContact C-N 3.3Å; V89-Q91 PolarHBondContact O-N 3.42Å; Q91-L93 VanDerWaalsContact C-N 3.27Å; Q91-L93 PolarHBondContact O-N 3.01Å; Q91-K94 PolarHBondContact O-N 3.36Å
92	A	91.6	Very high	87.2	Confident	13 Å²	13	76.7 Å²	76.7	11%	0.107	39%	0.394	C	S	.	.	H	α-helix	trans	-61.8	-35.4	176.2	0	0	0	0	0	112.6	V44 L45 K48 F49 L88 V89	V44-A92 WeakPolarHBondContact CG1-O 3.46Å; L45-A92 HydrophobicContact CD2-CB 4.41Å; K48-A92 HydrophobicContact CB-CB 3.95Å; K48-A92 HydrophobicContact CG-CB 3.8Å; F49-A92 HydrophobicContact CE2-CB 3.98Å; F49-A92 HydrophobicContact CZ-CB 4.43Å; L88-A92 WeakPolarHBondContact O-CB 3.47Å; L88-A92 PolarHBondContact O-N 2.97Å; V89-A92 WeakPolarHBondContact O-CB 3.48Å; V89-A92 PolarHBondContact O-N 3.38Å
93	L	90.6	Very high	87.1	Confident	1 Å²	1	74.4 Å²	74.4	1%	0.005	38%	0.378	C	S	.	.	T	Hydrogen-bonded Turn	trans	-103.3	11.1	-175.5	-65.9	176.1	0	0	0	113.9	I41 V44 L45 I70 V89 Q91 E95 E96 I97 L103	I41-L93 HydrophobicContact CG2-CD1 4.18Å; I41-L93 HydrophobicContact CG2-CD2 3.9Å; V44-L93 HydrophobicContact CB-CD2 4.39Å; V44-L93 HydrophobicContact CG1-CD2 4.16Å; L45-L93 HydrophobicContact CD1-CD1 4.39Å; L45-L93 HydrophobicContact CD2-CD1 4.03Å; L45-L93 HydrophobicContact CD2-CD2 4.03Å; L45-L93 HydrophobicContact CD2-CG 3.91Å; L45-L93 HydrophobicContact CG-CD1 4.38Å; L45-L93 HydrophobicContact CG-CD2 3.99Å; L45-L93 HydrophobicContact CG-CG 4.37Å; I70-L93 HydrophobicContact CD1-CD1 3.4Å; I70-L93 VanDerWaalsContact CD1-CD1 3.4Å; V89-L93 HydrophobicContact CG1-CD1 4Å; V89-L93 PolarHBondContact O-N 2.99Å; Q91-L93 VanDerWaalsContact C-N 3.27Å; Q91-L93 PolarHBondContact O-N 3.01Å; L93-E95 PolarHBondContact O-N 2.81Å; L93-E96 WeakPolarHBondContact CA-OE2 3.3Å; L93-E96 PolarHBondContact O-N 3.16Å; L93-I97 HydrophobicContact CB-CD1 3.57Å; L93-I97 HydrophobicContact CB-CG1 3.89Å; L93-I97 WeakPolarHBondContact O-CB 3.03Å; L93-I97 VanDerWaalsContact O-CD1 3.29Å; L93-I97 WeakPolarHBondContact O-CD1 3.46Å; L93-I97 WeakPolarHBondContact O-CG1 3.21Å; L93-I97 PolarHBondContact O-N 2.91Å; L93-L103 HydrophobicContact CD1-CD1 4.02Å
94	K	87.9	Confident	87	Confident	145 Å²	145	75.6 Å²	75.6	63%	0.63	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.5	-31.6	-171.4	-173.9	179.7	176.8	-171.7	0	112.7	N90 Q91 Q98	N90-K94 WeakPolarHBondContact O-CA 3.5Å; N90-K94 WeakPolarHBondContact O-CB 3.45Å; N90-K94 PolarHBondContact O-N 3.28Å; N90-K94 VanDerWaalsContact O-N 3.07Å; Q91-K94 PolarHBondContact O-N 3.36Å; K94-Q98 PolarHBondContact O-NE2 3.07Å
95	E	84.1	Confident	87	Confident	156 Å²	156	72.4 Å²	72.4	73%	0.729	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.4	-39.4	-179.2	-64.8	178.5	-165.5	0	0	110.4	L93	L93-E95 PolarHBondContact O-N 2.81Å
96	E	79.8	Confident	87	Confident	46 Å²	46	76.1 Å²	76.1	22%	0.215	37%	0.373	C	S	.	.	T	Hydrogen-bonded Turn	trans	-74.2	-39.8	-179.3	-66.6	65.6	-147.3	0	0	112.2	V44 L93 Q98 S99 M100	V44-E96 HydrophobicContact CG2-CG 4.21Å; V44-E96 WeakPolarHBondContact CG2-OE1 3.25Å; L93-E96 WeakPolarHBondContact CA-OE2 3.3Å; L93-E96 PolarHBondContact O-N 3.16Å; E96-Q98 PolarHBondContact O-N 2.98Å; E96-S99 PolarHBondContact O-N 3.1Å; E96-S99 PolarHBondContact O-OG 3.39Å; E96-M100 HydrophobicContact CB-CE 3.91Å; E96-M100 WeakPolarHBondContact O-CE 3.44Å
97	I	73.4	Confident	87	Confident	50 Å²	50	74.1 Å²	74.1	26%	0.256	37%	0.365	S	S	.	.	G	3₁₀ helix	trans	-61.3	-25.5	-177.3	-71.6	162.5	0	0	0	112.7	L93 S99 M100 L103	L93-I97 HydrophobicContact CB-CD1 3.57Å; L93-I97 HydrophobicContact CB-CG1 3.89Å; L93-I97 WeakPolarHBondContact O-CB 3.03Å; L93-I97 VanDerWaalsContact O-CD1 3.29Å; L93-I97 WeakPolarHBondContact O-CD1 3.46Å; L93-I97 WeakPolarHBondContact O-CG1 3.21Å; L93-I97 PolarHBondContact O-N 2.91Å; I97-S99 PolarHBondContact O-N 2.82Å; I97-M100 PolarHBondContact O-N 3.29Å; I97-L103 HydrophobicContact CD1-CD1 3.49Å; I97-L103 VanDerWaalsContact CD1-CD1 3.49Å; I97-L103 HydrophobicContact CG1-CD1 3.37Å; I97-L103 HydrophobicContact CG1-CG 4.22Å
98	Q	75.7	Confident	87.1	Confident	158 Å²	158	73.8 Å²	73.8	74%	0.738	37%	0.366	S	S	*	.	G	3₁₀ helix	trans	-58.5	-24.1	-178.6	-68	175.8	35.2	0	0	113	K94 E96	K94-Q98 PolarHBondContact O-NE2 3.07Å; E96-Q98 PolarHBondContact O-N 2.98Å
99	S	68.6	Low	87.1	Confident	105 Å²	105	74.9 Å²	74.9	73%	0.734	37%	0.372	S	S	*	.	G	3₁₀ helix	trans	-92.8	-8	177.9	64.9	0	0	0	0	114.3	E96 I97	E96-S99 PolarHBondContact O-N 3.1Å; E96-S99 PolarHBondContact O-OG 3.39Å; I97-S99 PolarHBondContact O-N 2.82Å
100	M	75.6	Confident	86.9	Confident	29 Å²	29	76.4 Å²	76.4	14%	0.143	38%	0.381	C	S	.	.			trans	-106.8	150.4	-170.2	-57.7	175.6	-165.4	0	0	112.2	I41 Y68 E96 I97 L103	I41-M100 HydrophobicContact CD1-CE 3.47Å; I41-M100 VanDerWaalsContact CD1-CE 3.47Å; I41-M100 HydrophobicContact CD1-SD 3.86Å; I41-M100 HydrophobicContact CG1-CE 3.59Å; I41-M100 HydrophobicContact CG1-SD 4.47Å; Y68-M100 HydrophobicContact CD2-CE 4.37Å; Y68-M100 HydrophobicContact CD2-CG 4.27Å; Y68-M100 HydrophobicContact CD2-SD 3.55Å; Y68-M100 VanDerWaalsContact CD2-SD 3.55Å; Y68-M100 HydrophobicContact CE2-CE 4.08Å; Y68-M100 HydrophobicContact CE2-CG 3.97Å; Y68-M100 HydrophobicContact CE2-SD 3.66Å; E96-M100 HydrophobicContact CB-CE 3.91Å; E96-M100 WeakPolarHBondContact O-CE 3.44Å; I97-M100 PolarHBondContact O-N 3.29Å; M100-L103 HydrophobicContact SD-CD2 3.86Å
101	H	79.6	Confident	86.4	Confident	184 Å²	184	86.1 Å²	86.1	85%	0.852	42%	0.42	S	S	*	.	S	Bend	trans	-78.9	-29.5	177.7	-115.1	67.6	0	0	0	112.6	A66	A66-H101 HydrophobicContact CB-CB 4.31Å; A66-H101 WeakPolarHBondContact O-CA 3.5Å; A66-H101 VanDerWaalsContact O-CB 3.26Å; A66-H101 WeakPolarHBondContact O-CB 3.5Å; A66-H101 PolarHBondContact O-N 3.2Å
102	G	86.2	Confident	86.1	Confident	23 Å²	23	83.9 Å²	83.9	24%	0.237	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	179.2	163.5	177.3	0	0	0	0	0	114.3	A66 M67 Y68	A66-G102 PolarHBondContact O-N 3.17Å; M67-G102 WeakPolarHBondContact CA-O 3.33Å; M67-G102 WeakPolarHBondContact CG-O 3.45Å; Y68-G102 PolarHBondContact N-O 3.42Å
103	L	90.7	Very high	85.8	Confident	38 Å²	38	87.6 Å²	87.6	20%	0.199	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	147.7	178.4	-65.4	-178.5	0	0	0	111.2	Y68 I70 L93 I97 M100	Y68-L103 HydrophobicContact CD2-CD2 4.06Å; Y68-L103 HydrophobicContact CG-CD2 4.37Å; Y68-L103 CarbonylContact O-C 3.57Å; Y68-L103 WeakPolarHBondContact O-CA 3.35Å; I70-L103 HydrophobicContact CD1-CD1 4.13Å; I70-L103 HydrophobicContact CD1-CD2 4.13Å; L93-L103 HydrophobicContact CD1-CD1 4.02Å; I97-L103 HydrophobicContact CD1-CD1 3.49Å; I97-L103 VanDerWaalsContact CD1-CD1 3.49Å; I97-L103 HydrophobicContact CG1-CD1 3.37Å; I97-L103 HydrophobicContact CG1-CG 4.22Å; M100-L103 HydrophobicContact SD-CD2 3.86Å
104	R	93	Very high	85.5	Confident	125 Å²	125	92.4 Å²	92.4	47%	0.472	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	125.5	164.3	-69.9	-178	179.5	161.2	1.9	109	M67 Y68 E69 I70 F106	M67-R104 HydrophobicContact CE-CG 4.15Å; Y68-R104 PolarHBondContact O-N 3.26Å; E69-R104 WeakPolarHBondContact CA-O 3.39Å; E69-R104 HydrophobicContact CB-CB 4.36Å; E69-R104 HydrophobicContact CG-CB 4.06Å; I70-R104 PolarHBondContact N-O 3.31Å; R104-F106 HydrophobicContact CB-CE2 4.18Å
105	I	94.6	Very high	85.4	Confident	21 Å²	21	89.3 Å²	89.3	11%	0.108	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	126.3	-175.1	-60.3	167.8	0	0	0	108.6	H86 V89 N90 T107	H86-I105 PolarHBondContact CE1-O 3.03Å; H86-I105 PolarHBondContact NE2-O 2.86Å; V89-I105 HydrophobicContact CB-CD1 4.22Å; V89-I105 HydrophobicContact CB-CG2 4.2Å; V89-I105 HydrophobicContact CG1-CD1 3.87Å; V89-I105 HydrophobicContact CG1-CG1 4.21Å; V89-I105 HydrophobicContact CG1-CG2 4.05Å; V89-I105 HydrophobicContact CG2-CG2 4.26Å; N90-I105 WeakPolarHBondContact OD1-CD1 3.28Å; I105-T107 HydrophobicContact CG2-CG2 3.94Å
106	F	95.2	Very high	85.5	Confident	90 Å²	90	85.1 Å²	85.1	40%	0.395	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	114.8	172.7	-64.7	-81.6	0	0	0	108.6	E69 I70 H71 I72 R104	E69-F106 HydrophobicContact CG-CD2 3.9Å; E69-F106 HydrophobicContact CG-CE2 3.66Å; I70-F106 PolarHBondContact O-N 3.18Å; H71-F106 WeakPolarHBondContact CA-O 3.27Å; H71-F106 AromaticContact CE1-CD2 3.39Å; H71-F106 WeakPolarHBondContact CE1-CD2 3.35Å; H71-F106 AromaticContact CE1-CG 3.66Å; H71-F106 AromaticContact ND1-CD2 3.93Å; H71-F106 AromaticContact ND1-CG 3.89Å; H71-F106 AromaticContact NE2-CD2 3.53Å; I72-F106 PolarHBondContact N-O 3.1Å; R104-F106 HydrophobicContact CB-CE2 4.18Å
107	T	95.4	Very high	85.9	Confident	16 Å²	16	87.7 Å²	87.7	10%	0.098	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	129.1	176.3	52.2	0	0	0	0	110.5	I72 F77 Q85 H86 V89 I105	I72-T107 WeakPolarHBondContact O-CA 3.33Å; F77-T107 HydrophobicContact CD2-CG2 4.29Å; F77-T107 HydrophobicContact CE1-CG2 4.48Å; F77-T107 HydrophobicContact CE2-CG2 3.77Å; F77-T107 HydrophobicContact CZ-CG2 3.88Å; Q85-T107 HydrophobicContact CB-CG2 4.08Å; Q85-T107 VanDerWaalsContact OE1-CB 3.3Å; Q85-T107 PolarHBondContact OE1-OG1 3.17Å; H86-T107 PolarHBondContact CD2-OG1 2.96Å; V89-T107 HydrophobicContact CG2-CG2 4.09Å; I105-T107 HydrophobicContact CG2-CG2 3.94Å
108	N	94.6	Very high	86.7	Confident	93 Å²	93	90.4 Å²	90.4	50%	0.497	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	156.1	174.9	-70.8	-65.1	0	0	0	110	I72 E73 S74	I72-N108 PolarHBondContact O-N 3.34Å; E73-N108 VanDerWaalsContact CA-O 3.32Å; E73-N108 WeakPolarHBondContact CA-O 3.45Å; E73-N108 HydrophobicContact CG-CB 4.32Å; S74-N108 PolarHBondContact N-O 3.49Å
109	I	93.4	Very high	87.6	Confident	75 Å²	75	85.2 Å²	85.2	39%	0.385	43%	0.425	S	S	.	.			trans	-105.2	127.7	173.2	-60	160.4	0	0	0	106.5	F77 K78	F77-I109 HydrophobicContact CB-CG1 3.86Å; K78-I109 HydrophobicContact CB-CG2 4.4Å
110	P	90.7	Very high	89.2	Confident	32 Å²	32	83.6 Å²	83.6	21%	0.208	40%	0.4	C	S	.	.			trans	-61	139	175.5	25.5	-31.3	0	0	0	110.1	E73 S74	E73-P110 HydrophobicContact CG-CB 3.92Å; E73-P110 HydrophobicContact CG-CG 4.33Å; E73-P110 VanDerWaalsContact OE1-CA 3.23Å; E73-P110 WeakPolarHBondContact OE1-CA 3.25Å; E73-P110 WeakPolarHBondContact OE1-CB 3.48Å; S74-P110 WeakPolarHBondContact O-CD 3.44Å
111	K	81.2	Confident	90.4	Very high	277 Å²	277	88.5 Å²	88.5	100%	1.204	42%	0.423	S	S	*	.			trans	-74.4	0	178	-72	-173.1	178.9	179.1	0	111.8

Retrieved 111 of 111 residues in 241.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).