A0A087Y5E2_POEFO Loading...

V-type proton ATPase subunit G

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB , UniProt , Accession A0A087Y5E2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 118 aa.

						>A0A087Y5E2_POEFO|A0A087Y5E2
MASQSQGIQQLLQAEKRAAEKVTEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDRDTAERMARIQDSYRGNRETVLNELLRRICDIQPEFHANYRVAG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.8	Low	77.4	Confident	214 Å²	214	116 Å²	116	100%	1.054	64%	0.637	S	S	*	*				0	-34.5	0	-61.2	-60	-108.9	0	0	113.8	S3	M1-S3 PolarHBondContact O-N 3.44Å
2	A	56.5	Low	78.8	Confident	78 Å²	78	114.8 Å²	114.8	65%	0.645	63%	0.628	S	S	*	*	H	α-helix	trans	-70.3	-26.2	-178.3	0	0	0	0	0	115.9	Q4 S5	A2-Q4 VanDerWaalsContact C-N 3.35Å; A2-Q4 PolarHBondContact O-N 3.48Å; A2-S5 PolarHBondContact O-OG 3.11Å; A2-S5 VanDerWaalsContact O-OG 3.11Å
3	S	61.3	Low	80.1	Confident	106 Å²	106	114.4 Å²	114.4	74%	0.741	62%	0.619	S	S	*	*	H	α-helix	trans	-72.4	-23.8	-177.7	-179.1	0	0	0	0	114.2	M1	M1-S3 PolarHBondContact O-N 3.44Å
4	Q	65.5	Low	81.2	Confident	142 Å²	142	110.1 Å²	110.1	66%	0.664	61%	0.607	S	S	*	*	H	α-helix	trans	-79.7	-34.3	-176.4	-161.6	-174.4	20.7	0	0	111.6	A2 I8	A2-Q4 VanDerWaalsContact C-N 3.35Å; A2-Q4 PolarHBondContact O-N 3.48Å; Q4-I8 HydrophobicContact CG-CD1 4.49Å; Q4-I8 WeakPolarHBondContact O-CD1 3.46Å; Q4-I8 WeakPolarHBondContact O-CG1 3.47Å; Q4-I8 PolarHBondContact O-N 2.96Å
5	S	75.9	Confident	82.1	Confident	69 Å²	69	111.7 Å²	111.7	48%	0.483	61%	0.608	S	S	.	*	H	α-helix	trans	-70.9	-34.6	178.8	62.5	0	0	0	0	112.7	A2 I8 Q9	A2-S5 PolarHBondContact O-OG 3.11Å; A2-S5 VanDerWaalsContact O-OG 3.11Å; S5-I8 PolarHBondContact O-N 3.39Å; S5-Q9 PolarHBondContact O-N 3.37Å
6	Q	84.5	Confident	83	Confident	138 Å²	138	113.1 Å²	113.1	65%	0.645	61%	0.607	S	S	*	*	H	α-helix	trans	-69.1	-38.8	-179	-163.2	163.9	2.8	0	0	112.5	Q9 Q10	Q6-Q9 PolarHBondContact O-N 3.26Å; Q6-Q10 PolarHBondContact O-N 3.45Å; Q6-Q10 VanDerWaalsContact O-N 3.16Å
7	G	90.3	Very high	83.8	Confident	33 Å²	33	115.9 Å²	115.9	34%	0.34	61%	0.607	S	S	.	*	H	α-helix	trans	-65.8	-40.6	174.7	0	0	0	0	0	112.9	Q10 L11	G7-Q10 PolarHBondContact O-N 3.06Å; G7-L11 WeakPolarHBondContact O-CG 3.33Å; G7-L11 PolarHBondContact O-N 3.43Å; G7-L11 VanDerWaalsContact O-N 3.1Å
8	I	89	Confident	84.5	Confident	91 Å²	91	112.4 Å²	112.4	47%	0.467	60%	0.598	S	S	.	*	H	α-helix	trans	-63.6	-43.1	176.2	-67.3	167.2	0	0	0	110.9	Q4 S5 Q10 L11 L12	Q4-I8 HydrophobicContact CG-CD1 4.49Å; Q4-I8 WeakPolarHBondContact O-CD1 3.46Å; Q4-I8 WeakPolarHBondContact O-CG1 3.47Å; Q4-I8 PolarHBondContact O-N 2.96Å; S5-I8 PolarHBondContact O-N 3.39Å; I8-Q10 VanDerWaalsContact C-N 3.28Å; I8-Q10 PolarHBondContact O-N 3.45Å; I8-L11 PolarHBondContact O-N 3.18Å; I8-L12 HydrophobicContact CG2-CD1 3.97Å; I8-L12 HydrophobicContact CG2-CG 4.47Å; I8-L12 WeakPolarHBondContact O-CG 3.4Å; I8-L12 PolarHBondContact O-N 3.09Å
9	Q	90.2	Very high	85.2	Confident	136 Å²	136	109.4 Å²	109.4	64%	0.636	59%	0.59	S	S	*	*	H	α-helix	trans	-59.4	-39.6	175.4	-102.4	177.7	-28.6	0	0	112.5	S5 Q6 L12 Q13	S5-Q9 PolarHBondContact O-N 3.37Å; Q6-Q9 PolarHBondContact O-N 3.26Å; Q9-L12 PolarHBondContact O-N 3.16Å; Q9-Q13 WeakPolarHBondContact O-CB 3.49Å; Q9-Q13 PolarHBondContact O-N 3.01Å
10	Q	93.1	Very high	85.8	Confident	141 Å²	141	108.7 Å²	108.7	66%	0.659	58%	0.583	S	S	*	*	H	α-helix	trans	-67.8	-39.2	179.6	-155.1	170	13.6	0	0	111.9	Q6 G7 I8 Q13 A14	Q6-Q10 PolarHBondContact O-N 3.45Å; Q6-Q10 VanDerWaalsContact O-N 3.16Å; G7-Q10 PolarHBondContact O-N 3.06Å; I8-Q10 VanDerWaalsContact C-N 3.28Å; I8-Q10 PolarHBondContact O-N 3.45Å; Q10-Q13 PolarHBondContact O-N 3.1Å; Q10-A14 WeakPolarHBondContact O-CB 3.37Å; Q10-A14 PolarHBondContact O-N 3.29Å
11	L	93.4	Very high	86.3	Confident	128 Å²	128	111.3 Å²	111.3	67%	0.67	59%	0.589	S	S	*	*	H	α-helix	trans	-64.3	-45.7	173.9	-69.6	172.5	0	0	0	112	G7 I8 Q13 A14 E15	G7-L11 WeakPolarHBondContact O-CG 3.33Å; G7-L11 PolarHBondContact O-N 3.43Å; G7-L11 VanDerWaalsContact O-N 3.1Å; I8-L11 PolarHBondContact O-N 3.18Å; L11-Q13 VanDerWaalsContact C-N 3.28Å; L11-Q13 PolarHBondContact O-N 3.48Å; L11-A14 PolarHBondContact O-N 2.85Å; L11-E15 WeakPolarHBondContact O-CB 3.46Å; L11-E15 PolarHBondContact O-N 2.98Å
12	L	94.5	Very high	88.5	Confident	101 Å²	101	104.7 Å²	104.7	53%	0.529	56%	0.56	S	S	.	*	H	α-helix	trans	-60.3	-38.7	175.9	-73.6	167.5	0	0	0	111.9	I8 Q9 E15 K16	I8-L12 HydrophobicContact CG2-CD1 3.97Å; I8-L12 HydrophobicContact CG2-CG 4.47Å; I8-L12 WeakPolarHBondContact O-CG 3.4Å; I8-L12 PolarHBondContact O-N 3.09Å; Q9-L12 PolarHBondContact O-N 3.16Å; L12-E15 PolarHBondContact O-N 2.99Å; L12-K16 WeakPolarHBondContact O-CB 3.42Å; L12-K16 PolarHBondContact O-N 3.36Å
13	Q	94.8	Very high	90.5	Very high	110 Å²	110	105.1 Å²	105.1	51%	0.514	56%	0.555	S	S	.	*	H	α-helix	trans	-69.8	-37.6	177.4	-148.3	178.7	42.4	0	0	111.9	Q9 Q10 L11 R17	Q9-Q13 WeakPolarHBondContact O-CB 3.49Å; Q9-Q13 PolarHBondContact O-N 3.01Å; Q10-Q13 PolarHBondContact O-N 3.1Å; L11-Q13 VanDerWaalsContact C-N 3.28Å; L11-Q13 PolarHBondContact O-N 3.48Å; Q13-R17 WeakPolarHBondContact O-CG 3.47Å; Q13-R17 PolarHBondContact O-N 3.46Å; Q13-R17 VanDerWaalsContact O-N 3.09Å
14	A	95.4	Very high	92.2	Very high	55 Å²	55	106.8 Å²	106.8	46%	0.455	55%	0.551	S	S	.	*	H	α-helix	trans	-66	-42	173.7	0	0	0	0	0	111.9	Q10 L11 R17 A18	Q10-A14 WeakPolarHBondContact O-CB 3.37Å; Q10-A14 PolarHBondContact O-N 3.29Å; L11-A14 PolarHBondContact O-N 2.85Å; A14-R17 PolarHBondContact O-N 2.9Å; A14-A18 WeakPolarHBondContact O-CB 3.4Å; A14-A18 PolarHBondContact O-N 2.9Å
15	E	95.6	Very high	93.7	Very high	134 Å²	134	103 Å²	103	63%	0.626	54%	0.544	S	S	*	.	H	α-helix	trans	-60.2	-46.9	175.7	-173.4	179.9	-179.2	0	0	111.2	L11 L12 R17 A18 A19	L11-E15 WeakPolarHBondContact O-CB 3.46Å; L11-E15 PolarHBondContact O-N 2.98Å; L12-E15 PolarHBondContact O-N 2.99Å; E15-R17 PolarHBondContact O-N 3.3Å; E15-A18 PolarHBondContact O-N 3.44Å; E15-A19 WeakPolarHBondContact O-CB 3.06Å; E15-A19 PolarHBondContact O-N 3.45Å
16	K	96.7	Very high	94.8	Very high	134 Å²	134	108.1 Å²	108.1	58%	0.583	55%	0.552	S	S	*	*	H	α-helix	trans	-58.8	-47.6	176.2	-173.3	176.2	177.4	180	0	111.9	L12 A18 A19 E20	L12-K16 WeakPolarHBondContact O-CB 3.42Å; L12-K16 PolarHBondContact O-N 3.36Å; K16-A18 VanDerWaalsContact C-N 3.34Å; K16-A18 PolarHBondContact O-N 2.98Å; K16-A19 PolarHBondContact O-N 3.31Å; K16-E20 WeakPolarHBondContact CE-OE1 3.34Å; K16-E20 WeakPolarHBondContact O-CB 3.33Å; K16-E20 WeakPolarHBondContact O-CG 3.44Å; K16-E20 PolarHBondContact O-N 3.34Å
17	R	96	Very high	95.4	Very high	160 Å²	160	109.4 Å²	109.4	60%	0.604	56%	0.556	S	S	*	*	H	α-helix	trans	-62.7	-39.2	177.7	-72.7	176.4	-176.4	174.6	3.9	112.2	Q13 A14 E15 K21	Q13-R17 WeakPolarHBondContact O-CG 3.47Å; Q13-R17 PolarHBondContact O-N 3.46Å; Q13-R17 VanDerWaalsContact O-N 3.09Å; A14-R17 PolarHBondContact O-N 2.9Å; E15-R17 PolarHBondContact O-N 3.3Å; R17-K21 WeakPolarHBondContact O-CB 3.36Å; R17-K21 PolarHBondContact O-N 3.24Å
18	A	96.9	Very high	95.8	Very high	54 Å²	54	115.2 Å²	115.2	45%	0.446	57%	0.568	S	S	.	*	H	α-helix	trans	-65.9	-44.6	176.6	0	0	0	0	0	111.3	A14 E15 K16 K21 V22	A14-A18 WeakPolarHBondContact O-CB 3.4Å; A14-A18 PolarHBondContact O-N 2.9Å; E15-A18 PolarHBondContact O-N 3.44Å; K16-A18 VanDerWaalsContact C-N 3.34Å; K16-A18 PolarHBondContact O-N 2.98Å; A18-K21 PolarHBondContact O-N 2.86Å; A18-V22 WeakPolarHBondContact O-CG2 3.42Å; A18-V22 PolarHBondContact O-N 3.26Å
19	A	96.8	Very high	96.2	Very high	54 Å²	54	117.5 Å²	117.5	45%	0.446	57%	0.574	S	S	.	*	H	α-helix	trans	-62.4	-43.2	176.7	0	0	0	0	0	112.1	E15 K16 V22 T23	E15-A19 WeakPolarHBondContact O-CB 3.06Å; E15-A19 PolarHBondContact O-N 3.45Å; K16-A19 PolarHBondContact O-N 3.31Å; A19-V22 PolarHBondContact O-N 3.43Å; A19-T23 WeakPolarHBondContact O-CB 3.41Å; A19-T23 WeakPolarHBondContact O-CG2 3.46Å; A19-T23 PolarHBondContact O-N 3.37Å; A19-T23 PolarHBondContact O-OG1 2.91Å
20	E	97.2	Very high	96.5	Very high	96 Å²	96	116 Å²	116	45%	0.449	57%	0.571	S	S	.	*	H	α-helix	trans	-60.5	-46.2	174.4	-75.6	171.6	-178.5	0	0	111.2	K16 V22 T23 E24	K16-E20 WeakPolarHBondContact CE-OE1 3.34Å; K16-E20 WeakPolarHBondContact O-CB 3.33Å; K16-E20 WeakPolarHBondContact O-CG 3.44Å; K16-E20 PolarHBondContact O-N 3.34Å; E20-V22 VanDerWaalsContact C-N 3.35Å; E20-V22 PolarHBondContact O-N 3.38Å; E20-T23 WeakPolarHBondContact CA-OG1 3.36Å; E20-T23 PolarHBondContact O-N 2.99Å; E20-T23 PolarHBondContact O-OG1 2.88Å; E20-E24 WeakPolarHBondContact O-CB 3.46Å; E20-E24 PolarHBondContact O-N 3.32Å
21	K	97.7	Very high	96.8	Very high	163 Å²	163	118.4 Å²	118.4	71%	0.709	57%	0.573	S	S	*	*	H	α-helix	trans	-61.9	-41.2	178.3	-170.1	173.9	-176.9	176.3	0	112.4	R17 A18 A25	R17-K21 WeakPolarHBondContact O-CB 3.36Å; R17-K21 PolarHBondContact O-N 3.24Å; A18-K21 PolarHBondContact O-N 2.86Å; K21-A25 WeakPolarHBondContact O-CB 3.37Å; K21-A25 PolarHBondContact O-N 2.83Å
22	V	97.8	Very high	97	Very high	75 Å²	75	119.7 Å²	119.7	46%	0.455	57%	0.569	S	S	.	*	H	α-helix	trans	-69.6	-42.6	178.1	172.6	0	0	0	0	111.5	A18 A19 E20 A25 R26	A18-V22 WeakPolarHBondContact O-CG2 3.42Å; A18-V22 PolarHBondContact O-N 3.26Å; A19-V22 PolarHBondContact O-N 3.43Å; E20-V22 VanDerWaalsContact C-N 3.35Å; E20-V22 PolarHBondContact O-N 3.38Å; V22-A25 PolarHBondContact O-N 2.98Å; V22-R26 WeakPolarHBondContact O-CG 3.38Å; V22-R26 PolarHBondContact O-N 2.91Å
23	T	97.5	Very high	97.1	Very high	87 Å²	87	119.3 Å²	119.3	53%	0.534	57%	0.568	S	S	.	*	H	α-helix	trans	-66	-40.9	178.8	47.1	0	0	0	0	111.6	A19 E20 R26 K27	A19-T23 WeakPolarHBondContact O-CB 3.41Å; A19-T23 WeakPolarHBondContact O-CG2 3.46Å; A19-T23 PolarHBondContact O-N 3.37Å; A19-T23 PolarHBondContact O-OG1 2.91Å; E20-T23 WeakPolarHBondContact CA-OG1 3.36Å; E20-T23 PolarHBondContact O-N 2.99Å; E20-T23 PolarHBondContact O-OG1 2.88Å; T23-R26 PolarHBondContact O-N 3.06Å; T23-K27 WeakPolarHBondContact O-CB 3.36Å; T23-K27 PolarHBondContact O-N 2.9Å
24	E	97.5	Very high	97.3	Very high	142 Å²	142	120.5 Å²	120.5	66%	0.664	57%	0.571	S	S	*	*	H	α-helix	trans	-62.6	-43.8	174	-169.1	177.9	-176	0	0	111.8	E20 R26 K27 R28	E20-E24 WeakPolarHBondContact O-CB 3.46Å; E20-E24 PolarHBondContact O-N 3.32Å; E24-R26 PolarHBondContact O-N 3.32Å; E24-K27 PolarHBondContact O-N 3.39Å; E24-R28 WeakPolarHBondContact O-CB 3.38Å; E24-R28 PolarHBondContact O-N 2.92Å
25	A	97.7	Very high	97.4	Very high	61 Å²	61	122 Å²	122	50%	0.504	57%	0.568	S	S	.	*	H	α-helix	trans	-60.4	-42.8	175.6	0	0	0	0	0	112.2	K21 V22 R28 K29	K21-A25 WeakPolarHBondContact O-CB 3.37Å; K21-A25 PolarHBondContact O-N 2.83Å; V22-A25 PolarHBondContact O-N 2.98Å; A25-R28 PolarHBondContact O-N 3.01Å; A25-K29 WeakPolarHBondContact O-CB 3.49Å; A25-K29 PolarHBondContact O-N 2.94Å
26	R	97.8	Very high	97.5	Very high	177 Å²	177	118.2 Å²	118.2	67%	0.668	56%	0.56	S	S	*	*	H	α-helix	trans	-63.2	-44.7	175	-72.6	177.9	-178.5	-166.4	1.4	111.7	V22 T23 E24 R28 K29 N30	V22-R26 WeakPolarHBondContact O-CG 3.38Å; V22-R26 PolarHBondContact O-N 2.91Å; T23-R26 PolarHBondContact O-N 3.06Å; E24-R26 PolarHBondContact O-N 3.32Å; R26-R28 PolarHBondContact O-N 3.22Å; R26-K29 PolarHBondContact O-N 3.42Å; R26-N30 PolarHBondContact O-N 3.41Å
27	K	97.7	Very high	97.5	Very high	166 Å²	166	118.8 Å²	118.8	72%	0.722	56%	0.563	S	S	*	*	H	α-helix	trans	-61.2	-43.7	177	-170.4	177.8	-177.8	-179.8	0	111.3	T23 E24 N30 R31	T23-K27 WeakPolarHBondContact O-CB 3.36Å; T23-K27 PolarHBondContact O-N 2.9Å; E24-K27 PolarHBondContact O-N 3.39Å; K27-N30 PolarHBondContact O-N 2.76Å; K27-R31 WeakPolarHBondContact O-CB 3.21Å; K27-R31 PolarHBondContact O-N 2.95Å
28	R	97.8	Very high	97.6	Very high	155 Å²	155	115.9 Å²	115.9	59%	0.585	56%	0.556	S	S	*	*	H	α-helix	trans	-63.7	-42.6	176.7	-172.4	177.5	-179.7	178	0.9	112.1	E24 A25 R26 R31 R32	E24-R28 WeakPolarHBondContact O-CB 3.38Å; E24-R28 PolarHBondContact O-N 2.92Å; A25-R28 PolarHBondContact O-N 3.01Å; R26-R28 PolarHBondContact O-N 3.22Å; R28-R31 PolarHBondContact O-N 3.48Å; R28-R32 PolarHBondContact O-N 3.37Å
29	K	97.9	Very high	97.6	Very high	138 Å²	138	118.6 Å²	118.6	60%	0.6	56%	0.559	S	S	*	*	H	α-helix	trans	-59.4	-50.3	174.8	-179.1	-176.7	173.5	-178.3	0	111.1	A25 R26 R31 R32 L33	A25-K29 WeakPolarHBondContact O-CB 3.49Å; A25-K29 PolarHBondContact O-N 2.94Å; R26-K29 PolarHBondContact O-N 3.42Å; K29-R31 VanDerWaalsContact C-N 3.32Å; K29-R31 PolarHBondContact O-N 3.42Å; K29-R32 PolarHBondContact O-N 2.97Å; K29-L33 HydrophobicContact CG-CD1 4.17Å; K29-L33 WeakPolarHBondContact O-CG 3.42Å; K29-L33 PolarHBondContact O-N 3.31Å
30	N	97.6	Very high	97.7	Very high	105 Å²	105	118.2 Å²	118.2	56%	0.561	56%	0.556	S	S	*	*	H	α-helix	trans	-62.4	-39.9	-179.9	-72.6	-5	0	0	0	112.1	R26 K27 L33 K34	R26-N30 PolarHBondContact O-N 3.41Å; K27-N30 PolarHBondContact O-N 2.76Å; N30-L33 PolarHBondContact O-N 3.08Å; N30-K34 PolarHBondContact O-N 2.86Å
31	R	97.9	Very high	97.7	Very high	191 Å²	191	119.7 Å²	119.7	72%	0.721	56%	0.563	S	S	*	*	H	α-helix	trans	-60.4	-47.1	174.3	-176.6	178.6	174.4	-179.2	-0.3	111.8	K27 R28 K29 L33 K34 Q35	K27-R31 WeakPolarHBondContact O-CB 3.21Å; K27-R31 PolarHBondContact O-N 2.95Å; R28-R31 PolarHBondContact O-N 3.48Å; K29-R31 VanDerWaalsContact C-N 3.32Å; K29-R31 PolarHBondContact O-N 3.42Å; R31-L33 VanDerWaalsContact C-N 3.35Å; R31-L33 PolarHBondContact O-N 3.4Å; R31-K34 PolarHBondContact O-N 2.96Å; R31-Q35 WeakPolarHBondContact O-CB 3.39Å; R31-Q35 PolarHBondContact O-N 3.17Å
32	R	97.7	Very high	97.7	Very high	155 Å²	155	114.4 Å²	114.4	59%	0.585	55%	0.55	S	S	*	.	H	α-helix	trans	-62.4	-40.4	177.5	-78.2	-173.4	169.1	-176.1	-5	112.5	R28 K29 K34 Q35 A36	R28-R32 PolarHBondContact O-N 3.37Å; K29-R32 PolarHBondContact O-N 2.97Å; R32-K34 VanDerWaalsContact C-N 3.34Å; R32-Q35 PolarHBondContact O-N 3.28Å; R32-A36 WeakPolarHBondContact O-CB 3.46Å; R32-A36 PolarHBondContact O-N 3.14Å
33	L	97.4	Very high	97.7	Very high	94 Å²	94	117.6 Å²	117.6	49%	0.492	56%	0.56	S	S	.	*	H	α-helix	trans	-64.4	-39.2	176.1	-72.3	173.3	0	0	0	112.1	K29 N30 R31 K37	K29-L33 HydrophobicContact CG-CD1 4.17Å; K29-L33 WeakPolarHBondContact O-CG 3.42Å; K29-L33 PolarHBondContact O-N 3.31Å; N30-L33 PolarHBondContact O-N 3.08Å; R31-L33 VanDerWaalsContact C-N 3.35Å; R31-L33 PolarHBondContact O-N 3.4Å; L33-K37 WeakPolarHBondContact O-CG 3.41Å; L33-K37 PolarHBondContact O-N 3.47Å
34	K	97.9	Very high	97.7	Very high	134 Å²	134	118.8 Å²	118.8	58%	0.583	56%	0.562	S	S	*	*	H	α-helix	trans	-68.2	-45.9	177	-161.5	-175.1	-177.1	-158.8	0	111.2	N30 R31 R32 A36 K37 E38	N30-K34 PolarHBondContact O-N 2.86Å; R31-K34 PolarHBondContact O-N 2.96Å; R32-K34 VanDerWaalsContact C-N 3.34Å; K34-A36 PolarHBondContact O-N 3.26Å; K34-K37 WeakPolarHBondContact O-CB 3.39Å; K34-K37 PolarHBondContact O-N 3.44Å; K34-K37 VanDerWaalsContact O-N 3.14Å; K34-E38 WeakPolarHBondContact CE-OE1 3.31Å; K34-E38 IonicContact NZ-OE1 3.93Å; K34-E38 WeakPolarHBondContact O-CG 3.44Å; K34-E38 PolarHBondContact O-N 2.94Å
35	Q	97.9	Very high	97.7	Very high	86 Å²	86	115.9 Å²	115.9	40%	0.402	55%	0.548	S	S	.	.	H	α-helix	trans	-57.4	-47	176.3	-178.9	176.3	-0.1	0	0	111.7	R31 R32 K37 E38 E39	R31-Q35 WeakPolarHBondContact O-CB 3.39Å; R31-Q35 PolarHBondContact O-N 3.17Å; R32-Q35 PolarHBondContact O-N 3.28Å; Q35-K37 VanDerWaalsContact C-N 3.26Å; Q35-K37 PolarHBondContact O-N 3.47Å; Q35-E38 PolarHBondContact O-N 2.91Å; Q35-E38 VanDerWaalsContact O-N 3.17Å; Q35-E39 HydrophobicContact CG-CG 4.3Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.44Å; Q35-E39 PolarHBondContact NE2-OE1 2.97Å; Q35-E39 WeakPolarHBondContact O-CB 3.43Å; Q35-E39 WeakPolarHBondContact O-CG 3.35Å; Q35-E39 PolarHBondContact O-N 2.97Å
36	A	97.8	Very high	97.7	Very high	55 Å²	55	119.5 Å²	119.5	46%	0.455	56%	0.555	S	S	.	*	H	α-helix	trans	-60.2	-35.6	177.9	0	0	0	0	0	112.9	R32 K34 A40	R32-A36 WeakPolarHBondContact O-CB 3.46Å; R32-A36 PolarHBondContact O-N 3.14Å; K34-A36 PolarHBondContact O-N 3.26Å; A36-A40 VanDerWaalsContact O-CB 3.31Å; A36-A40 WeakPolarHBondContact O-CB 3.49Å; A36-A40 PolarHBondContact O-N 3.03Å; A36-A40 VanDerWaalsContact O-N 3.08Å
37	K	97.6	Very high	97.7	Very high	147 Å²	147	117.9 Å²	117.9	64%	0.639	55%	0.55	S	S	*	.	H	α-helix	trans	-69.9	-43.6	175	-72.4	-179.3	179.8	-171	0	112.2	L33 K34 Q35 Q41	L33-K37 WeakPolarHBondContact O-CG 3.41Å; L33-K37 PolarHBondContact O-N 3.47Å; K34-K37 WeakPolarHBondContact O-CB 3.39Å; K34-K37 PolarHBondContact O-N 3.44Å; K34-K37 VanDerWaalsContact O-N 3.14Å; Q35-K37 VanDerWaalsContact C-N 3.26Å; Q35-K37 PolarHBondContact O-N 3.47Å; K37-Q41 WeakPolarHBondContact O-CB 3.47Å; K37-Q41 VanDerWaalsContact O-CG 3.32Å; K37-Q41 WeakPolarHBondContact O-CG 3.49Å; K37-Q41 PolarHBondContact O-N 3.36Å
38	E	97.8	Very high	97.8	Very high	98 Å²	98	116.2 Å²	116.2	46%	0.458	54%	0.539	S	S	.	.	H	α-helix	trans	-64.4	-43	178.6	-72.9	169.9	-175	0	0	111	K34 Q35 Q41 A42	K34-E38 WeakPolarHBondContact CE-OE1 3.31Å; K34-E38 IonicContact NZ-OE1 3.93Å; K34-E38 WeakPolarHBondContact O-CG 3.44Å; K34-E38 PolarHBondContact O-N 2.94Å; Q35-E38 PolarHBondContact O-N 2.91Å; Q35-E38 VanDerWaalsContact O-N 3.17Å; E38-Q41 PolarHBondContact O-N 3.28Å; E38-A42 WeakPolarHBondContact O-CB 3.45Å; E38-A42 PolarHBondContact O-N 3.47Å
39	E	97.3	Very high	97.8	Very high	111 Å²	111	113.7 Å²	113.7	52%	0.519	54%	0.536	S	S	.	.	H	α-helix	trans	-63.9	-45.9	176.3	-73.3	172.8	-175.6	0	0	111.8	Q35 Q41 A42 E43	Q35-E39 HydrophobicContact CG-CG 4.3Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.44Å; Q35-E39 PolarHBondContact NE2-OE1 2.97Å; Q35-E39 WeakPolarHBondContact O-CB 3.43Å; Q35-E39 WeakPolarHBondContact O-CG 3.35Å; Q35-E39 PolarHBondContact O-N 2.97Å; E39-Q41 VanDerWaalsContact C-N 3.33Å; E39-Q41 PolarHBondContact O-N 3.36Å; E39-A42 PolarHBondContact O-N 2.91Å; E39-E43 PolarHBondContact O-N 2.99Å
40	A	97.7	Very high	97.7	Very high	46 Å²	46	112.5 Å²	112.5	38%	0.38	53%	0.533	S	S	.	.	H	α-helix	trans	-62.1	-39.6	176.2	0	0	0	0	0	112.4	A36 E43 I44	A36-A40 VanDerWaalsContact O-CB 3.31Å; A36-A40 WeakPolarHBondContact O-CB 3.49Å; A36-A40 PolarHBondContact O-N 3.03Å; A36-A40 VanDerWaalsContact O-N 3.08Å; A40-E43 PolarHBondContact O-N 2.98Å; A40-I44 WeakPolarHBondContact O-CD1 3.48Å; A40-I44 VanDerWaalsContact O-CG1 3.25Å; A40-I44 WeakPolarHBondContact O-CG1 3.25Å; A40-I44 PolarHBondContact O-N 3.37Å
41	Q	97.6	Very high	97.7	Very high	128 Å²	128	113 Å²	113	60%	0.598	53%	0.527	S	S	*	.	H	α-helix	trans	-65.4	-41.3	175.5	-77	177.2	-14.3	0	0	111.9	K37 E38 E39 E43 I44 E45	K37-Q41 WeakPolarHBondContact O-CB 3.47Å; K37-Q41 VanDerWaalsContact O-CG 3.32Å; K37-Q41 WeakPolarHBondContact O-CG 3.49Å; K37-Q41 PolarHBondContact O-N 3.36Å; E38-Q41 PolarHBondContact O-N 3.28Å; E39-Q41 VanDerWaalsContact C-N 3.33Å; E39-Q41 PolarHBondContact O-N 3.36Å; Q41-E43 VanDerWaalsContact C-N 3.34Å; Q41-E43 PolarHBondContact O-N 3.43Å; Q41-I44 PolarHBondContact O-N 2.99Å; Q41-E45 WeakPolarHBondContact O-CG 3.32Å; Q41-E45 PolarHBondContact O-N 3.3Å
42	A	98	Very high	97.7	Very high	51 Å²	51	107.6 Å²	107.6	42%	0.421	51%	0.51	S	S	.	.	H	α-helix	trans	-61.8	-41.9	176.4	0	0	0	0	0	111.8	E38 E39 E45 Q46	E38-A42 WeakPolarHBondContact O-CB 3.45Å; E38-A42 PolarHBondContact O-N 3.47Å; E39-A42 PolarHBondContact O-N 2.91Å; A42-E45 PolarHBondContact O-N 3.48Å; A42-Q46 WeakPolarHBondContact O-CG 3.43Å; A42-Q46 PolarHBondContact O-N 3.44Å
43	E	97.7	Very high	97.7	Very high	142 Å²	142	107.6 Å²	107.6	66%	0.664	51%	0.514	S	S	*	.	H	α-helix	trans	-65.1	-42.4	176.9	-170.7	175.1	-178.2	0	0	112.1	E39 A40 Q41 E45 Q46 Y47	E39-E43 PolarHBondContact O-N 2.99Å; A40-E43 PolarHBondContact O-N 2.98Å; Q41-E43 VanDerWaalsContact C-N 3.34Å; Q41-E43 PolarHBondContact O-N 3.43Å; E43-E45 PolarHBondContact O-N 3.23Å; E43-Q46 PolarHBondContact O-N 2.95Å; E43-Y47 WeakPolarHBondContact O-CB 3.11Å; E43-Y47 PolarHBondContact O-N 3.41Å
44	I	97.7	Very high	97.6	Very high	112 Å²	112	106.2 Å²	106.2	57%	0.574	51%	0.505	S	S	*	.	H	α-helix	trans	-60.6	-45.5	175.8	-70.9	165.5	0	0	0	111.2	A40 Q41 Y47 R48	A40-I44 WeakPolarHBondContact O-CD1 3.48Å; A40-I44 VanDerWaalsContact O-CG1 3.25Å; A40-I44 WeakPolarHBondContact O-CG1 3.25Å; A40-I44 PolarHBondContact O-N 3.37Å; Q41-I44 PolarHBondContact O-N 2.99Å; I44-Y47 PolarHBondContact O-N 2.93Å; I44-R48 PolarHBondContact O-N 3.27Å
45	E	97.8	Very high	97.5	Very high	81 Å²	81	106.1 Å²	106.1	38%	0.379	51%	0.505	S	S	.	.	H	α-helix	trans	-66.2	-40.7	179.3	-74.5	-65.8	140.8	0	0	111.8	Q41 A42 E43 Y47 R48 L49	Q41-E45 WeakPolarHBondContact O-CG 3.32Å; Q41-E45 PolarHBondContact O-N 3.3Å; A42-E45 PolarHBondContact O-N 3.48Å; E43-E45 PolarHBondContact O-N 3.23Å; E45-Y47 PolarHBondContact O-N 2.93Å; E45-R48 VanDerWaalsContact CD-NH1 3.33Å; E45-R48 PolarHBondContact O-N 3.48Å; E45-R48 IonicContact OE1-CZ 3.49Å; E45-R48 IonicContact OE1-NH1 3.61Å; E45-R48 PolarHBondContact OE1-NH1 2.96Å; E45-R48 IonicContact OE1-NH2 3.91Å; E45-R48 IonicContact OE2-CZ 3.53Å; E45-R48 IonicContact OE2-NE 2.8Å; E45-R48 IonicContact OE2-NH1 3.09Å; E45-R48 PolarHBondContact OE2-NH1 3.46Å; E45-R48 VanDerWaalsContact OE2-NH1 3.08Å; E45-R48 IonicContact OE2-NH2 2.73Å; E45-R48 PolarHBondContact OE2-NH2 3.47Å; E45-L49 WeakPolarHBondContact O-CG 3.47Å; E45-L49 PolarHBondContact O-N 3.34Å
46	Q	98	Very high	97.4	Very high	138 Å²	138	107.5 Å²	107.5	65%	0.645	51%	0.51	S	S	*	.	H	α-helix	trans	-60.4	-45.4	173.4	-76.5	-176.5	3	0	0	111.8	A42 E43 R48 L49 Q50	A42-Q46 WeakPolarHBondContact O-CG 3.43Å; A42-Q46 PolarHBondContact O-N 3.44Å; E43-Q46 PolarHBondContact O-N 2.95Å; Q46-R48 VanDerWaalsContact C-N 3.34Å; Q46-R48 PolarHBondContact O-N 3.31Å; Q46-L49 PolarHBondContact O-N 2.96Å; Q46-Q50 PolarHBondContact O-N 3.29Å
47	Y	97.9	Very high	97.2	Very high	143 Å²	143	109 Å²	109	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-62.7	-41.9	176.7	-175.7	-103.6	0	0	0	111.5	E43 I44 E45 L49 Q50 R51	E43-Y47 WeakPolarHBondContact O-CB 3.11Å; E43-Y47 PolarHBondContact O-N 3.41Å; I44-Y47 PolarHBondContact O-N 2.93Å; E45-Y47 PolarHBondContact O-N 2.93Å; Y47-L49 PolarHBondContact O-N 3.47Å; Y47-Q50 PolarHBondContact O-N 2.88Å; Y47-R51 HydrophobicContact CD1-CG 4.02Å; Y47-R51 HydrophobicContact CD2-CG 4.42Å; Y47-R51 HydrophobicContact CE1-CG 3.63Å; Y47-R51 HydrophobicContact CE2-CG 4.05Å; Y47-R51 HydrophobicContact CG-CG 4.41Å; Y47-R51 WeakPolarHBondContact O-CB 3.47Å; Y47-R51 VanDerWaalsContact O-CG 3.28Å; Y47-R51 WeakPolarHBondContact O-CG 3.28Å; Y47-R51 PolarHBondContact O-N 2.74Å
48	R	97.9	Very high	96.9	Very high	130 Å²	130	108.6 Å²	108.6	49%	0.491	51%	0.512	S	S	.	.	H	α-helix	trans	-59.4	-48	176.2	-165.3	-178.1	84.2	-141.6	-11.4	111.4	I44 E45 Q46 Q50 R51 E52	I44-R48 PolarHBondContact O-N 3.27Å; E45-R48 VanDerWaalsContact CD-NH1 3.33Å; E45-R48 PolarHBondContact O-N 3.48Å; E45-R48 IonicContact OE1-CZ 3.49Å; E45-R48 IonicContact OE1-NH1 3.61Å; E45-R48 PolarHBondContact OE1-NH1 2.96Å; E45-R48 IonicContact OE1-NH2 3.91Å; E45-R48 IonicContact OE2-CZ 3.53Å; E45-R48 IonicContact OE2-NE 2.8Å; E45-R48 IonicContact OE2-NH1 3.09Å; E45-R48 PolarHBondContact OE2-NH1 3.46Å; E45-R48 VanDerWaalsContact OE2-NH1 3.08Å; E45-R48 IonicContact OE2-NH2 2.73Å; E45-R48 PolarHBondContact OE2-NH2 3.47Å; Q46-R48 VanDerWaalsContact C-N 3.34Å; Q46-R48 PolarHBondContact O-N 3.31Å; R48-Q50 VanDerWaalsContact C-N 3.34Å; R48-Q50 PolarHBondContact O-N 3.5Å; R48-R51 PolarHBondContact O-N 3.49Å; R48-E52 WeakPolarHBondContact O-CB 3.4Å; R48-E52 PolarHBondContact O-N 3.32Å
49	L	97.7	Very high	96.5	Very high	103 Å²	103	108.4 Å²	108.4	54%	0.539	51%	0.511	S	S	.	.	H	α-helix	trans	-60.7	-42.7	177.9	-75	166.9	0	0	0	112.1	E45 Q46 Y47 E52 K53	E45-L49 WeakPolarHBondContact O-CG 3.47Å; E45-L49 PolarHBondContact O-N 3.34Å; Q46-L49 PolarHBondContact O-N 2.96Å; Y47-L49 PolarHBondContact O-N 3.47Å; L49-E52 PolarHBondContact O-N 2.87Å; L49-K53 WeakPolarHBondContact O-CB 3.4Å; L49-K53 PolarHBondContact O-N 3.38Å
50	Q	97.5	Very high	96.1	Very high	113 Å²	113	106.1 Å²	106.1	53%	0.528	51%	0.511	S	S	.	.	H	α-helix	trans	-61.9	-47.5	176.6	-176.9	175.4	6	0	0	111.3	Q46 Y47 R48 E52 K53 E54	Q46-Q50 PolarHBondContact O-N 3.29Å; Y47-Q50 PolarHBondContact O-N 2.88Å; R48-Q50 VanDerWaalsContact C-N 3.34Å; R48-Q50 PolarHBondContact O-N 3.5Å; Q50-E52 PolarHBondContact O-N 3.35Å; Q50-K53 PolarHBondContact O-N 3Å; Q50-E54 WeakPolarHBondContact O-CG 3.42Å; Q50-E54 PolarHBondContact O-N 2.73Å
51	R	97.6	Very high	95.6	Very high	115 Å²	115	107 Å²	107	43%	0.434	52%	0.518	S	S	.	.	H	α-helix	trans	-64.6	-38.9	178.8	-68.7	-59.6	-60.9	173.3	0.9	112.5	Y47 R48 E54 F55	Y47-R51 HydrophobicContact CD1-CG 4.02Å; Y47-R51 HydrophobicContact CD2-CG 4.42Å; Y47-R51 HydrophobicContact CE1-CG 3.63Å; Y47-R51 HydrophobicContact CE2-CG 4.05Å; Y47-R51 HydrophobicContact CG-CG 4.41Å; Y47-R51 WeakPolarHBondContact O-CB 3.47Å; Y47-R51 VanDerWaalsContact O-CG 3.28Å; Y47-R51 WeakPolarHBondContact O-CG 3.28Å; Y47-R51 PolarHBondContact O-N 2.74Å; R48-R51 PolarHBondContact O-N 3.49Å; R51-E54 IonicContact CZ-OE2 3.03Å; R51-E54 IonicContact NE-OE2 3.69Å; R51-E54 IonicContact NH1-OE2 3.13Å; R51-E54 PolarHBondContact NH1-OE2 3.45Å; R51-E54 PolarHBondContact O-N 3.43Å; R51-F55 VanDerWaalsContact O-CB 3.31Å; R51-F55 WeakPolarHBondContact O-CB 3.42Å; R51-F55 PolarHBondContact O-N 2.87Å
52	E	97.1	Very high	94.9	Very high	78 Å²	78	103.6 Å²	103.6	36%	0.364	51%	0.512	S	S	.	.	H	α-helix	trans	-65.4	-40.8	175.6	-168.3	-177	159.9	0	0	111.3	R48 L49 Q50 F55 K56	R48-E52 WeakPolarHBondContact O-CB 3.4Å; R48-E52 PolarHBondContact O-N 3.32Å; L49-E52 PolarHBondContact O-N 2.87Å; Q50-E52 PolarHBondContact O-N 3.35Å; E52-F55 PolarHBondContact O-N 2.8Å; E52-K56 HydrophobicContact CG-CD 4.5Å; E52-K56 WeakPolarHBondContact O-CG 3.4Å; E52-K56 PolarHBondContact O-N 3Å; E52-K56 VanDerWaalsContact OE1-CE 3.23Å; E52-K56 WeakPolarHBondContact OE1-CE 3.31Å; E52-K56 IonicContact OE1-NZ 3.93Å; E52-K56 PolarHBondContact OE1-NZ 2.78Å
53	K	97.3	Very high	93.9	Very high	155 Å²	155	106.8 Å²	106.8	67%	0.674	52%	0.521	S	S	*	.	H	α-helix	trans	-63.1	-45.7	174.6	-175.2	-179.1	178.3	-177.6	0	111.9	L49 Q50 F55 K56 T57	L49-K53 WeakPolarHBondContact O-CB 3.4Å; L49-K53 PolarHBondContact O-N 3.38Å; Q50-K53 PolarHBondContact O-N 3Å; K53-F55 VanDerWaalsContact C-N 3.31Å; K53-F55 PolarHBondContact O-N 3.08Å; K53-K56 PolarHBondContact O-N 2.98Å; K53-T57 WeakPolarHBondContact O-CB 3.39Å; K53-T57 PolarHBondContact O-N 3.47Å; K53-T57 PolarHBondContact O-OG1 2.94Å
54	E	96.4	Very high	92.6	Very high	64 Å²	64	102.8 Å²	102.8	30%	0.299	52%	0.517	S	S	.	.	H	α-helix	trans	-60.1	-43.2	174.7	-75.1	174.9	-164.4	0	0	111.5	Q50 R51 T57 K58	Q50-E54 WeakPolarHBondContact O-CG 3.42Å; Q50-E54 PolarHBondContact O-N 2.73Å; R51-E54 IonicContact CZ-OE2 3.03Å; R51-E54 IonicContact NE-OE2 3.69Å; R51-E54 IonicContact NH1-OE2 3.13Å; R51-E54 PolarHBondContact NH1-OE2 3.45Å; R51-E54 PolarHBondContact O-N 3.43Å; E54-T57 PolarHBondContact O-N 2.96Å; E54-K58 WeakPolarHBondContact O-CG 3.23Å; E54-K58 PolarHBondContact O-N 2.91Å
55	F	95.8	Very high	91.1	Very high	133 Å²	133	100.6 Å²	100.6	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-60.3	-53.1	177.6	177.4	-95	0	0	0	111.2	R51 E52 K53 T57 K58 E59	R51-F55 VanDerWaalsContact O-CB 3.31Å; R51-F55 WeakPolarHBondContact O-CB 3.42Å; R51-F55 PolarHBondContact O-N 2.87Å; E52-F55 PolarHBondContact O-N 2.8Å; K53-F55 VanDerWaalsContact C-N 3.31Å; K53-F55 PolarHBondContact O-N 3.08Å; F55-T57 VanDerWaalsContact C-N 3.26Å; F55-T57 PolarHBondContact O-N 2.69Å; F55-K58 PolarHBondContact O-N 3.48Å; F55-K58 VanDerWaalsContact O-N 3.1Å; F55-E59 WeakPolarHBondContact O-CB 3.33Å; F55-E59 PolarHBondContact O-N 2.88Å
56	K	95.4	Very high	89.4	Confident	114 Å²	114	103.4 Å²	103.4	50%	0.496	53%	0.525	S	S	.	.	H	α-helix	trans	-60.2	-36.2	178.6	-72.8	179.2	-176.5	168.5	0	112.5	E52 K53 E59 A60	E52-K56 HydrophobicContact CG-CD 4.5Å; E52-K56 WeakPolarHBondContact O-CG 3.4Å; E52-K56 PolarHBondContact O-N 3Å; E52-K56 VanDerWaalsContact OE1-CE 3.23Å; E52-K56 WeakPolarHBondContact OE1-CE 3.31Å; E52-K56 IonicContact OE1-NZ 3.93Å; E52-K56 PolarHBondContact OE1-NZ 2.78Å; K53-K56 PolarHBondContact O-N 2.98Å; K56-E59 PolarHBondContact O-N 3.29Å; K56-A60 WeakPolarHBondContact O-CB 3.38Å; K56-A60 PolarHBondContact O-N 3.33Å
57	T	93.6	Very high	87.9	Confident	87 Å²	87	99.1 Å²	99.1	53%	0.534	52%	0.518	S	S	.	.	H	α-helix	trans	-65.5	-44	176.3	-54.9	0	0	0	0	111	K53 E54 F55 A61	K53-T57 WeakPolarHBondContact O-CB 3.39Å; K53-T57 PolarHBondContact O-N 3.47Å; K53-T57 PolarHBondContact O-OG1 2.94Å; E54-T57 PolarHBondContact O-N 2.96Å; F55-T57 VanDerWaalsContact C-N 3.26Å; F55-T57 PolarHBondContact O-N 2.69Å; T57-A61 WeakPolarHBondContact O-CB 3.38Å; T57-A61 PolarHBondContact O-N 3.43Å
58	K	91.4	Very high	86.8	Confident	139 Å²	139	97.5 Å²	97.5	60%	0.604	52%	0.519	S	S	*	.	H	α-helix	trans	-67.5	-40.3	176.8	-73.3	177.5	178.5	178.8	0	112.1	E54 F55 A61 A62	E54-K58 WeakPolarHBondContact O-CG 3.23Å; E54-K58 PolarHBondContact O-N 2.91Å; F55-K58 PolarHBondContact O-N 3.48Å; F55-K58 VanDerWaalsContact O-N 3.1Å; K58-A61 PolarHBondContact O-N 2.92Å; K58-A62 WeakPolarHBondContact O-CB 3.32Å; K58-A62 PolarHBondContact O-N 3.29Å
59	E	89.8	Confident	86	Confident	94 Å²	94	94 Å²	94	44%	0.439	51%	0.514	S	S	.	.	H	α-helix	trans	-59.5	-49.3	175	-177.7	-179.6	-159.8	0	0	110.8	F55 K56 A61 A62 L63	F55-E59 WeakPolarHBondContact O-CB 3.33Å; F55-E59 PolarHBondContact O-N 2.88Å; K56-E59 PolarHBondContact O-N 3.29Å; E59-A61 VanDerWaalsContact C-N 3.34Å; E59-A61 PolarHBondContact O-N 3.5Å; E59-A62 PolarHBondContact O-N 3.46Å; E59-L63 HydrophobicContact CG-CD1 4.08Å; E59-L63 WeakPolarHBondContact O-CB 3.4Å; E59-L63 WeakPolarHBondContact O-CG 3.49Å; E59-L63 PolarHBondContact O-N 3.05Å
60	A	88.1	Confident	85.3	Confident	63 Å²	63	91.7 Å²	91.7	52%	0.521	51%	0.51	S	S	.	.	H	α-helix	trans	-61.9	-40.6	176.4	0	0	0	0	0	112.4	K56 G64	K56-A60 WeakPolarHBondContact O-CB 3.38Å; K56-A60 PolarHBondContact O-N 3.33Å; A60-G64 PolarHBondContact O-N 2.97Å
61	A	87.5	Confident	84.9	Confident	65 Å²	65	90.9 Å²	90.9	54%	0.537	51%	0.512	S	S	.	.	H	α-helix	trans	-65.2	-41.9	176.7	0	0	0	0	0	112.2	T57 K58 E59 G64 S65	T57-A61 WeakPolarHBondContact O-CB 3.38Å; T57-A61 PolarHBondContact O-N 3.43Å; K58-A61 PolarHBondContact O-N 2.92Å; E59-A61 VanDerWaalsContact C-N 3.34Å; E59-A61 PolarHBondContact O-N 3.5Å; A61-G64 PolarHBondContact O-N 2.83Å; A61-S65 WeakPolarHBondContact O-CB 3.41Å; A61-S65 PolarHBondContact O-N 3.1Å
62	A	83.4	Confident	84.5	Confident	55 Å²	55	90.3 Å²	90.3	46%	0.455	52%	0.515	S	S	.	.	H	α-helix	trans	-65.4	-45.3	177.3	0	0	0	0	0	111.7	K58 E59 S65 H66	K58-A62 WeakPolarHBondContact O-CB 3.32Å; K58-A62 PolarHBondContact O-N 3.29Å; E59-A62 PolarHBondContact O-N 3.46Å; A62-S65 PolarHBondContact O-N 3.35Å; A62-H66 PolarHBondContact O-CD2 2.89Å; A62-H66 PolarHBondContact O-N 3.32Å
63	L	76.8	Confident	84.3	Confident	119 Å²	119	90.7 Å²	90.7	62%	0.623	52%	0.522	S	S	*	.	H	α-helix	trans	-64.8	-40.3	176.6	-71.6	169.5	0	0	0	112.1	E59 S65	E59-L63 HydrophobicContact CG-CD1 4.08Å; E59-L63 WeakPolarHBondContact O-CB 3.4Å; E59-L63 WeakPolarHBondContact O-CG 3.49Å; E59-L63 PolarHBondContact O-N 3.05Å; L63-S65 VanDerWaalsContact C-N 3.34Å
64	G	70.7	Confident	84.2	Confident	57 Å²	57	88.6 Å²	88.6	59%	0.588	52%	0.518	S	S	*	.	H	α-helix	trans	-67	-32.5	175.6	0	0	0	0	0	113.4	A60 A61 H66	A60-G64 PolarHBondContact O-N 2.97Å; A61-G64 PolarHBondContact O-N 2.83Å; G64-H66 VanDerWaalsContact C-N 3.34Å; G64-H66 PolarHBondContact O-N 3.44Å
65	S	65.4	Low	84.2	Confident	67 Å²	67	92.4 Å²	92.4	47%	0.469	53%	0.53	S	S	.	.	H	α-helix	trans	-68.9	-29.6	179.9	-170.4	0	0	0	0	113.2	A61 A62 L63 G67 N68 S69	A61-S65 WeakPolarHBondContact O-CB 3.41Å; A61-S65 PolarHBondContact O-N 3.1Å; A62-S65 PolarHBondContact O-N 3.35Å; L63-S65 VanDerWaalsContact C-N 3.34Å; S65-G67 VanDerWaalsContact C-N 3.27Å; S65-G67 PolarHBondContact O-N 3.24Å; S65-N68 PolarHBondContact O-N 3.43Å; S65-S69 PolarHBondContact O-N 2.95Å; S65-S69 PolarHBondContact O-OG 3.49Å
66	H	61.6	Low	84.2	Confident	140 Å²	140	88.7 Å²	88.7	65%	0.648	52%	0.516	S	S	*	.	H	α-helix	trans	-63.1	-32.1	-179.2	-84.6	-59.9	0	0	0	113.3	A62 G64 A70	A62-H66 PolarHBondContact O-CD2 2.89Å; A62-H66 PolarHBondContact O-N 3.32Å; G64-H66 VanDerWaalsContact C-N 3.34Å; G64-H66 PolarHBondContact O-N 3.44Å; H66-A70 PolarHBondContact O-N 2.94Å
67	G	66.8	Low	84.2	Confident	47 Å²	47	86.6 Å²	86.6	49%	0.485	51%	0.513	S	S	.	.	H	α-helix	trans	-67	-36.5	177.2	0	0	0	0	0	113.1	S65 V71	S65-G67 VanDerWaalsContact C-N 3.27Å; S65-G67 PolarHBondContact O-N 3.24Å; G67-V71 WeakPolarHBondContact O-CG2 3.25Å
68	N	75.2	Confident	84.4	Confident	110 Å²	110	85.4 Å²	85.4	59%	0.588	51%	0.512	S	S	*	.	H	α-helix	trans	-74.7	-36.4	-178.2	-166.2	62.1	0	0	0	112.2	S65 V71 E72	S65-N68 PolarHBondContact O-N 3.43Å; N68-V71 PolarHBondContact O-N 3.31Å; N68-E72 PolarHBondContact O-N 3.38Å
69	S	80	Confident	84.7	Confident	56 Å²	56	82.7 Å²	82.7	39%	0.392	50%	0.501	S	S	.	.	H	α-helix	trans	-66.5	-38.3	179.6	-61.2	0	0	0	0	112.8	S65 E72 V73	S65-S69 PolarHBondContact O-N 2.95Å; S65-S69 PolarHBondContact O-OG 3.49Å; S69-E72 PolarHBondContact O-N 3.22Å; S69-V73 WeakPolarHBondContact O-CB 3.44Å; S69-V73 VanDerWaalsContact O-CG2 3.25Å; S69-V73 WeakPolarHBondContact O-CG2 3.43Å; S69-V73 PolarHBondContact O-N 2.98Å
70	A	84.9	Confident	85.1	Confident	55 Å²	55	85 Å²	85	46%	0.455	51%	0.506	S	S	.	.	H	α-helix	trans	-63	-46.2	176.4	0	0	0	0	0	111.5	H66 E72 V73 D74	H66-A70 PolarHBondContact O-N 2.94Å; A70-E72 VanDerWaalsContact C-N 3.34Å; A70-E72 PolarHBondContact O-N 3.39Å; A70-V73 PolarHBondContact O-N 3.39Å; A70-D74 WeakPolarHBondContact O-CB 3.48Å; A70-D74 VanDerWaalsContact O-CG 3.3Å; A70-D74 PolarHBondContact O-N 3.47Å
71	V	88.3	Confident	85.6	Confident	95 Å²	95	88 Å²	88	58%	0.576	51%	0.511	S	S	*	.	H	α-helix	trans	-62.4	-40.7	178.4	176.1	0	0	0	0	111.7	G67 N68 D74 R75	G67-V71 WeakPolarHBondContact O-CG2 3.25Å; N68-V71 PolarHBondContact O-N 3.31Å; V71-D74 PolarHBondContact O-N 2.98Å; V71-R75 WeakPolarHBondContact O-CB 3.24Å; V71-R75 PolarHBondContact O-N 2.88Å
72	E	89.5	Confident	86	Confident	104 Å²	104	87 Å²	87	49%	0.486	50%	0.503	S	S	.	.	H	α-helix	trans	-66.3	-41.6	177.8	-172.6	172.8	-167.2	0	0	112.2	N68 S69 A70 R75 D76	N68-E72 PolarHBondContact O-N 3.38Å; S69-E72 PolarHBondContact O-N 3.22Å; A70-E72 VanDerWaalsContact C-N 3.34Å; A70-E72 PolarHBondContact O-N 3.39Å; E72-R75 PolarHBondContact O-N 3.28Å; E72-R75 IonicContact OE1-NH2 2.78Å; E72-D76 PolarHBondContact O-N 3.03Å
73	V	93.3	Very high	86.7	Confident	86 Å²	86	92.2 Å²	92.2	52%	0.521	51%	0.511	S	S	.	.	H	α-helix	trans	-64.1	-43.3	175.1	169.4	0	0	0	0	111.1	S69 A70 R75 D76 T77	S69-V73 WeakPolarHBondContact O-CB 3.44Å; S69-V73 VanDerWaalsContact O-CG2 3.25Å; S69-V73 WeakPolarHBondContact O-CG2 3.43Å; S69-V73 PolarHBondContact O-N 2.98Å; A70-V73 PolarHBondContact O-N 3.39Å; V73-R75 VanDerWaalsContact C-N 3.33Å; V73-R75 PolarHBondContact O-N 3.01Å; V73-D76 PolarHBondContact O-N 3.13Å; V73-T77 VanDerWaalsContact O-CB 3.29Å; V73-T77 WeakPolarHBondContact O-CB 3.47Å; V73-T77 PolarHBondContact O-N 3.35Å; V73-T77 PolarHBondContact O-OG1 3.4Å
74	D	94.3	Very high	87.7	Confident	110 Å²	110	92.1 Å²	92.1	59%	0.588	51%	0.51	S	S	*	.	H	α-helix	trans	-63.2	-40.9	177.8	-73.1	-20.2	0	0	0	111.3	A70 V71 T77 A78	A70-D74 WeakPolarHBondContact O-CB 3.48Å; A70-D74 VanDerWaalsContact O-CG 3.3Å; A70-D74 PolarHBondContact O-N 3.47Å; V71-D74 PolarHBondContact O-N 2.98Å; D74-T77 PolarHBondContact O-N 3.46Å; D74-A78 WeakPolarHBondContact O-CB 3.49Å; D74-A78 PolarHBondContact O-N 2.85Å
75	R	95.6	Very high	89	Confident	144 Å²	144	94.1 Å²	94.1	54%	0.543	50%	0.504	S	S	.	.	H	α-helix	trans	-62	-51.4	174.8	-176.6	-169.9	64.6	163.3	-2.1	111.7	V71 E72 V73 T77 A78 E79	V71-R75 WeakPolarHBondContact O-CB 3.24Å; V71-R75 PolarHBondContact O-N 2.88Å; E72-R75 PolarHBondContact O-N 3.28Å; E72-R75 IonicContact OE1-NH2 2.78Å; V73-R75 VanDerWaalsContact C-N 3.33Å; V73-R75 PolarHBondContact O-N 3.01Å; R75-T77 VanDerWaalsContact C-N 3.26Å; R75-T77 PolarHBondContact O-N 3.42Å; R75-A78 PolarHBondContact O-N 3.44Å; R75-E79 PolarHBondContact O-N 3.48Å
76	D	96.3	Very high	90.5	Very high	55 Å²	55	95.9 Å²	95.9	29%	0.294	51%	0.508	S	S	.	.	H	α-helix	trans	-62.3	-37	179	-177.4	34.6	0	0	0	111	E72 V73 E79 R80	E72-D76 PolarHBondContact O-N 3.03Å; V73-D76 PolarHBondContact O-N 3.13Å; D76-E79 PolarHBondContact O-N 2.72Å; D76-R80 WeakPolarHBondContact O-CB 3.42Å; D76-R80 VanDerWaalsContact O-CG 3.24Å; D76-R80 WeakPolarHBondContact O-CG 3.36Å; D76-R80 PolarHBondContact O-N 3.39Å; D76-R80 IonicContact OD1-CZ 3.61Å; D76-R80 IonicContact OD1-NE 3.98Å; D76-R80 PolarHBondContact OD1-NE 3.32Å; D76-R80 IonicContact OD1-NH2 2.66Å; D76-R80 IonicContact OD2-CZ 2.86Å; D76-R80 IonicContact OD2-NE 2.69Å; D76-R80 PolarHBondContact OD2-NE 3.45Å; D76-R80 VanDerWaalsContact OD2-NE 3.13Å; D76-R80 IonicContact OD2-NH1 3Å; D76-R80 IonicContact OD2-NH2 3.85Å; D76-R80 PolarHBondContact OD2-NH2 2.9Å
77	T	96.8	Very high	92.2	Very high	71 Å²	71	92.5 Å²	92.5	44%	0.436	50%	0.5	S	S	.	.	H	α-helix	trans	-62.7	-46.5	174.6	-58.2	0	0	0	0	111.5	V73 D74 R75 R80 M81	V73-T77 VanDerWaalsContact O-CB 3.29Å; V73-T77 WeakPolarHBondContact O-CB 3.47Å; V73-T77 PolarHBondContact O-N 3.35Å; V73-T77 PolarHBondContact O-OG1 3.4Å; D74-T77 PolarHBondContact O-N 3.46Å; R75-T77 VanDerWaalsContact C-N 3.26Å; R75-T77 PolarHBondContact O-N 3.42Å; T77-R80 PolarHBondContact O-N 2.89Å; T77-M81 HydrophobicContact CG2-CG 4.49Å; T77-M81 WeakPolarHBondContact O-CB 3.29Å; T77-M81 VanDerWaalsContact O-CG 3.23Å; T77-M81 WeakPolarHBondContact O-CG 3.29Å; T77-M81 PolarHBondContact O-N 2.99Å
78	A	97.4	Very high	93.6	Very high	61 Å²	61	96.9 Å²	96.9	50%	0.504	50%	0.503	S	S	.	.	H	α-helix	trans	-62.8	-42.5	177.2	0	0	0	0	0	112	D74 R75 M81 A82	D74-A78 WeakPolarHBondContact O-CB 3.49Å; D74-A78 PolarHBondContact O-N 2.85Å; R75-A78 PolarHBondContact O-N 3.44Å; A78-M81 PolarHBondContact O-N 2.66Å; A78-A82 PolarHBondContact O-N 3.41Å
79	E	97.8	Very high	94.6	Very high	82 Å²	82	99.2 Å²	99.2	38%	0.383	50%	0.503	S	S	.	.	H	α-helix	trans	-62.4	-44.3	175.6	-75.8	-175.4	-158.7	0	0	112.1	R75 D76 A82 R83	R75-E79 PolarHBondContact O-N 3.48Å; D76-E79 PolarHBondContact O-N 2.72Å; E79-A82 PolarHBondContact O-N 3.42Å; E79-R83 WeakPolarHBondContact O-CG 3.39Å; E79-R83 PolarHBondContact O-N 3.12Å; E79-R83 IonicContact OE2-NH2 3.08Å
80	R	97.4	Very high	95.4	Very high	143 Å²	143	99.2 Å²	99.2	54%	0.54	51%	0.512	S	S	.	.	H	α-helix	trans	-64.5	-42.9	177.7	-73.2	175.2	-169.7	-170.6	1.7	111.8	D76 T77 A82 R83 I84	D76-R80 WeakPolarHBondContact O-CB 3.42Å; D76-R80 VanDerWaalsContact O-CG 3.24Å; D76-R80 WeakPolarHBondContact O-CG 3.36Å; D76-R80 PolarHBondContact O-N 3.39Å; D76-R80 IonicContact OD1-CZ 3.61Å; D76-R80 IonicContact OD1-NE 3.98Å; D76-R80 PolarHBondContact OD1-NE 3.32Å; D76-R80 IonicContact OD1-NH2 2.66Å; D76-R80 IonicContact OD2-CZ 2.86Å; D76-R80 IonicContact OD2-NE 2.69Å; D76-R80 PolarHBondContact OD2-NE 3.45Å; D76-R80 VanDerWaalsContact OD2-NE 3.13Å; D76-R80 IonicContact OD2-NH1 3Å; D76-R80 IonicContact OD2-NH2 3.85Å; D76-R80 PolarHBondContact OD2-NH2 2.9Å; T77-R80 PolarHBondContact O-N 2.89Å; R80-A82 VanDerWaalsContact C-N 3.32Å; R80-A82 PolarHBondContact O-N 2.91Å; R80-R83 PolarHBondContact O-N 3.45Å; R80-I84 VanDerWaalsContact O-CG1 3.29Å; R80-I84 WeakPolarHBondContact O-CG1 3.44Å; R80-I84 PolarHBondContact O-N 2.96Å
81	M	97.7	Very high	96	Very high	127 Å²	127	100.8 Å²	100.8	63%	0.626	51%	0.513	S	S	*	.	H	α-helix	trans	-57.3	-45.4	174.5	-77.3	-85.3	-71.7	0	0	111.4	T77 A78 I84 Q85	T77-M81 HydrophobicContact CG2-CG 4.49Å; T77-M81 WeakPolarHBondContact O-CB 3.29Å; T77-M81 VanDerWaalsContact O-CG 3.23Å; T77-M81 WeakPolarHBondContact O-CG 3.29Å; T77-M81 PolarHBondContact O-N 2.99Å; A78-M81 PolarHBondContact O-N 2.66Å; M81-I84 PolarHBondContact O-N 3.43Å; M81-Q85 WeakPolarHBondContact O-CB 3.23Å; M81-Q85 PolarHBondContact O-N 3.02Å
82	A	97.9	Very high	96.3	Very high	44 Å²	44	101.6 Å²	101.6	36%	0.364	51%	0.506	S	S	.	.	H	α-helix	trans	-60.7	-47.3	176.8	0	0	0	0	0	111.6	A78 E79 R80 I84 Q85 D86	A78-A82 PolarHBondContact O-N 3.41Å; E79-A82 PolarHBondContact O-N 3.42Å; R80-A82 VanDerWaalsContact C-N 3.32Å; R80-A82 PolarHBondContact O-N 2.91Å; A82-I84 VanDerWaalsContact C-N 3.35Å; A82-I84 PolarHBondContact O-N 3.41Å; A82-Q85 WeakPolarHBondContact O-CB 3.39Å; A82-Q85 PolarHBondContact O-N 2.92Å; A82-Q85 VanDerWaalsContact O-N 3.12Å; A82-D86 PolarHBondContact O-N 3.27Å
83	R	97.6	Very high	96.6	Very high	163 Å²	163	101 Å²	101	62%	0.615	50%	0.503	S	S	*	.	H	α-helix	trans	-60.5	-41.3	177.3	-69.1	178	-165.3	177.5	9.9	112.9	E79 R80 Q85 D86 S87	E79-R83 WeakPolarHBondContact O-CG 3.39Å; E79-R83 PolarHBondContact O-N 3.12Å; E79-R83 IonicContact OE2-NH2 3.08Å; R80-R83 PolarHBondContact O-N 3.45Å; R83-Q85 VanDerWaalsContact C-N 3.31Å; R83-D86 PolarHBondContact O-N 3.46Å; R83-S87 WeakPolarHBondContact O-CB 3.49Å; R83-S87 PolarHBondContact O-N 2.97Å
84	I	97.5	Very high	96.8	Very high	118 Å²	118	101.2 Å²	101.2	61%	0.605	51%	0.505	S	S	*	.	H	α-helix	trans	-62	-44.1	175.8	-70.2	166.5	0	0	0	109.8	R80 M81 A82 S87 Y88	R80-I84 VanDerWaalsContact O-CG1 3.29Å; R80-I84 WeakPolarHBondContact O-CG1 3.44Å; R80-I84 PolarHBondContact O-N 2.96Å; M81-I84 PolarHBondContact O-N 3.43Å; A82-I84 VanDerWaalsContact C-N 3.35Å; A82-I84 PolarHBondContact O-N 3.41Å; I84-S87 PolarHBondContact O-N 2.92Å; I84-Y88 WeakPolarHBondContact O-CB 3.46Å; I84-Y88 PolarHBondContact O-N 3.22Å
85	Q	97.4	Very high	96.9	Very high	98 Å²	98	100.5 Å²	100.5	46%	0.458	50%	0.504	S	S	.	.	H	α-helix	trans	-65.5	-41	-179.9	-167.1	174.2	15.1	0	0	112.2	M81 A82 R83 Y88 R89	M81-Q85 WeakPolarHBondContact O-CB 3.23Å; M81-Q85 PolarHBondContact O-N 3.02Å; A82-Q85 WeakPolarHBondContact O-CB 3.39Å; A82-Q85 PolarHBondContact O-N 2.92Å; A82-Q85 VanDerWaalsContact O-N 3.12Å; R83-Q85 VanDerWaalsContact C-N 3.31Å; Q85-Y88 PolarHBondContact O-N 3.15Å; Q85-R89 WeakPolarHBondContact O-CB 3.46Å; Q85-R89 VanDerWaalsContact O-CG 3.27Å; Q85-R89 WeakPolarHBondContact O-CG 3.39Å; Q85-R89 PolarHBondContact O-N 3.49Å
86	D	97.5	Very high	97	Very high	105 Å²	105	97.1 Å²	97.1	56%	0.561	50%	0.496	S	S	*	.	H	α-helix	trans	-65.9	-44	176.7	-70.3	-21	0	0	0	111.5	A82 R83 Y88 R89 G90	A82-D86 PolarHBondContact O-N 3.27Å; R83-D86 PolarHBondContact O-N 3.46Å; D86-Y88 VanDerWaalsContact C-N 3.33Å; D86-Y88 PolarHBondContact O-N 3.35Å; D86-R89 PolarHBondContact O-N 2.93Å; D86-G90 PolarHBondContact O-N 3.27Å
87	S	97.2	Very high	96.9	Very high	69 Å²	69	99.1 Å²	99.1	48%	0.483	51%	0.507	S	S	.	.	H	α-helix	trans	-60.6	-42.3	174.4	-179	0	0	0	0	111.9	R83 I84 G90 N91	R83-S87 WeakPolarHBondContact O-CB 3.49Å; R83-S87 PolarHBondContact O-N 2.97Å; I84-S87 PolarHBondContact O-N 2.92Å; S87-G90 PolarHBondContact O-N 2.85Å; S87-N91 WeakPolarHBondContact O-CB 3.27Å; S87-N91 PolarHBondContact O-N 2.9Å; S87-N91 VanDerWaalsContact O-N 3.15Å; S87-N91 PolarHBondContact O-ND2 3.49Å
88	Y	96.8	Very high	96.9	Very high	139 Å²	139	100.5 Å²	100.5	55%	0.545	51%	0.509	S	S	.	.	H	α-helix	trans	-60.9	-50.6	174.4	172.2	-97.6	0	0	0	111.1	I84 Q85 D86 G90 N91 R92	I84-Y88 WeakPolarHBondContact O-CB 3.46Å; I84-Y88 PolarHBondContact O-N 3.22Å; Q85-Y88 PolarHBondContact O-N 3.15Å; D86-Y88 VanDerWaalsContact C-N 3.33Å; D86-Y88 PolarHBondContact O-N 3.35Å; Y88-G90 VanDerWaalsContact C-N 3.31Å; Y88-G90 PolarHBondContact O-N 2.94Å; Y88-N91 PolarHBondContact O-N 3.38Å; Y88-R92 HydrophobicContact CE1-CB 4.48Å; Y88-R92 HydrophobicContact CE1-CG 4.23Å; Y88-R92 HydrophobicContact CE2-CG 4.4Å; Y88-R92 VanDerWaalsContact O-CB 3.31Å; Y88-R92 WeakPolarHBondContact O-CB 3.31Å; Y88-R92 PolarHBondContact O-N 3.37Å; Y88-R92 WeakPolarHBondContact OH-CD 3.32Å
89	R	96.3	Very high	96.8	Very high	158 Å²	158	102.1 Å²	102.1	60%	0.596	51%	0.508	S	S	*	.	H	α-helix	trans	-59.6	-41.3	-179.4	-73.5	174.2	-174.8	-155.3	6.9	112	Q85 D86 N91	Q85-R89 WeakPolarHBondContact O-CB 3.46Å; Q85-R89 VanDerWaalsContact O-CG 3.27Å; Q85-R89 WeakPolarHBondContact O-CG 3.39Å; Q85-R89 PolarHBondContact O-N 3.49Å; D86-R89 PolarHBondContact O-N 2.93Å; R89-N91 VanDerWaalsContact C-N 3.35Å; R89-N91 PolarHBondContact O-N 2.88Å
90	G	96.3	Very high	96.7	Very high	56 Å²	56	102.9 Å²	102.9	58%	0.577	52%	0.515	S	S	*	.	H	α-helix	trans	-66.4	-33.5	178.9	0	0	0	0	0	113.8	D86 S87 Y88	D86-G90 PolarHBondContact O-N 3.27Å; S87-G90 PolarHBondContact O-N 2.85Å; Y88-G90 VanDerWaalsContact C-N 3.31Å; Y88-G90 PolarHBondContact O-N 2.94Å
91	N	96.5	Very high	96.7	Very high	89 Å²	89	105.3 Å²	105.3	48%	0.476	52%	0.524	S	S	.	.	H	α-helix	trans	-100.7	-13	-174.7	-64.9	-46.9	0	0	0	114.1	S87 Y88 R89 E93 T94 V95	S87-N91 WeakPolarHBondContact O-CB 3.27Å; S87-N91 PolarHBondContact O-N 2.9Å; S87-N91 VanDerWaalsContact O-N 3.15Å; S87-N91 PolarHBondContact O-ND2 3.49Å; Y88-N91 PolarHBondContact O-N 3.38Å; R89-N91 VanDerWaalsContact C-N 3.35Å; R89-N91 PolarHBondContact O-N 2.88Å; N91-E93 PolarHBondContact O-N 3.29Å; N91-T94 PolarHBondContact O-N 3.06Å; N91-V95 WeakPolarHBondContact O-CG2 3.4Å; N91-V95 PolarHBondContact O-N 3.5Å
92	R	95.9	Very high	96.5	Very high	112 Å²	112	107.5 Å²	107.5	42%	0.423	53%	0.525	S	S	.	.	H	α-helix	trans	-53	-53.9	-172.3	-170.6	-174.6	90.4	142.4	3.4	112.8	Y88 T94 V95 L96	Y88-R92 HydrophobicContact CE1-CB 4.48Å; Y88-R92 HydrophobicContact CE1-CG 4.23Å; Y88-R92 HydrophobicContact CE2-CG 4.4Å; Y88-R92 VanDerWaalsContact O-CB 3.31Å; Y88-R92 WeakPolarHBondContact O-CB 3.31Å; Y88-R92 PolarHBondContact O-N 3.37Å; Y88-R92 WeakPolarHBondContact OH-CD 3.32Å; R92-T94 PolarHBondContact O-N 2.86Å; R92-V95 PolarHBondContact O-N 3.37Å; R92-L96 HydrophobicContact CG-CD1 3.94Å; R92-L96 WeakPolarHBondContact O-CB 3.34Å; R92-L96 WeakPolarHBondContact O-CG 3.47Å; R92-L96 PolarHBondContact O-N 3.43Å
93	E	96.2	Very high	96.3	Very high	91 Å²	91	110.7 Å²	110.7	43%	0.425	54%	0.535	S	S	.	.	H	α-helix	trans	-66.1	-40	-175.3	-64.2	-56	138.4	0	0	111.7	N91 V95 L96 N97	N91-E93 PolarHBondContact O-N 3.29Å; E93-V95 PolarHBondContact O-N 2.99Å; E93-L96 PolarHBondContact O-N 2.91Å; E93-N97 WeakPolarHBondContact O-CB 3.23Å; E93-N97 PolarHBondContact O-N 3.41Å; E93-N97 PolarHBondContact O-ND2 3.4Å
94	T	96.8	Very high	96.1	Very high	91 Å²	91	107.7 Å²	107.7	56%	0.558	54%	0.537	S	S	*	.	H	α-helix	trans	-60	-48.1	177.1	-52.7	0	0	0	0	111.2	N91 R92 N97 E98	N91-T94 PolarHBondContact O-N 3.06Å; R92-T94 PolarHBondContact O-N 2.86Å; T94-N97 PolarHBondContact O-N 2.98Å; T94-E98 PolarHBondContact O-N 3.33Å
95	V	96.9	Very high	95.9	Very high	95 Å²	95	106.4 Å²	106.4	58%	0.576	53%	0.532	S	S	*	.	H	α-helix	trans	-66.1	-42.6	-179.9	175.3	0	0	0	0	111.3	N91 R92 E93 E98 L99	N91-V95 WeakPolarHBondContact O-CG2 3.4Å; N91-V95 PolarHBondContact O-N 3.5Å; R92-V95 PolarHBondContact O-N 3.37Å; E93-V95 PolarHBondContact O-N 2.99Å; V95-E98 PolarHBondContact O-N 3.04Å; V95-L99 WeakPolarHBondContact O-CB 3.46Å; V95-L99 PolarHBondContact O-N 3.03Å
96	L	96.1	Very high	95.6	Very high	72 Å²	72	108.4 Å²	108.4	38%	0.377	54%	0.544	S	S	.	.	H	α-helix	trans	-61.8	-45.6	177	-76	173.7	0	0	0	111.7	R92 E93 E98 L99 L100	R92-L96 HydrophobicContact CG-CD1 3.94Å; R92-L96 WeakPolarHBondContact O-CB 3.34Å; R92-L96 WeakPolarHBondContact O-CG 3.47Å; R92-L96 PolarHBondContact O-N 3.43Å; E93-L96 PolarHBondContact O-N 2.91Å; L96-E98 PolarHBondContact O-N 2.91Å; L96-L99 PolarHBondContact O-N 3.45Å; L96-L100 WeakPolarHBondContact O-CB 3.43Å; L96-L100 VanDerWaalsContact O-CG 3.3Å; L96-L100 WeakPolarHBondContact O-CG 3.4Å; L96-L100 PolarHBondContact O-N 3.4Å
97	N	95.8	Very high	95.1	Very high	98 Å²	98	109.6 Å²	109.6	52%	0.524	55%	0.546	S	S	.	.	H	α-helix	trans	-63.9	-42	179.6	-74.6	-36.9	0	0	0	112	E93 T94 R101	E93-N97 WeakPolarHBondContact O-CB 3.23Å; E93-N97 PolarHBondContact O-N 3.41Å; E93-N97 PolarHBondContact O-ND2 3.4Å; T94-N97 PolarHBondContact O-N 2.98Å; N97-R101 VanDerWaalsContact O-CB 3.23Å; N97-R101 WeakPolarHBondContact O-CB 3.27Å; N97-R101 PolarHBondContact O-N 3.48Å
98	E	96.1	Very high	94.7	Very high	100 Å²	100	111.8 Å²	111.8	47%	0.467	56%	0.559	S	S	.	*	H	α-helix	trans	-66.7	-41.2	177	-172.7	166.8	171.5	0	0	112	T94 V95 L96 R101 R102	T94-E98 PolarHBondContact O-N 3.33Å; V95-E98 PolarHBondContact O-N 3.04Å; L96-E98 PolarHBondContact O-N 2.91Å; E98-R101 PolarHBondContact O-N 2.97Å; E98-R102 WeakPolarHBondContact O-CG 3.4Å; E98-R102 PolarHBondContact O-N 3.35Å; E98-R102 IonicContact OE1-CZ 3.55Å; E98-R102 IonicContact OE1-NE 3.33Å; E98-R102 PolarHBondContact OE1-NE 3.43Å; E98-R102 IonicContact OE1-NH2 3.55Å; E98-R102 PolarHBondContact OE1-NH2 3.11Å
99	L	96.1	Very high	94.4	Very high	95 Å²	95	113.4 Å²	113.4	50%	0.497	57%	0.572	S	S	.	*	H	α-helix	trans	-62.4	-48.7	176.7	-177.3	62.8	0	0	0	111.4	V95 L96 R101 R102 I103	V95-L99 WeakPolarHBondContact O-CB 3.46Å; V95-L99 PolarHBondContact O-N 3.03Å; L96-L99 PolarHBondContact O-N 3.45Å; L99-R101 PolarHBondContact O-N 3.01Å; L99-R102 PolarHBondContact O-N 3.5Å; L99-I103 HydrophobicContact CD1-CD1 3.97Å; L99-I103 HydrophobicContact CD1-CG1 4.46Å; L99-I103 HydrophobicContact CG-CD1 3.84Å; L99-I103 VanDerWaalsContact O-CG1 3.27Å; L99-I103 WeakPolarHBondContact O-CG1 3.34Å; L99-I103 PolarHBondContact O-N 3.49Å
100	L	95.6	Very high	94	Very high	98 Å²	98	113.4 Å²	113.4	51%	0.513	58%	0.576	S	S	.	*	H	α-helix	trans	-62.4	-42.7	177.9	-72.5	173.4	0	0	0	111.6	L96 R102 I103 C104	L96-L100 WeakPolarHBondContact O-CB 3.43Å; L96-L100 VanDerWaalsContact O-CG 3.3Å; L96-L100 WeakPolarHBondContact O-CG 3.4Å; L96-L100 PolarHBondContact O-N 3.4Å; L100-R102 VanDerWaalsContact C-N 3.34Å; L100-R102 PolarHBondContact O-N 2.93Å; L100-I103 PolarHBondContact O-N 3.24Å; L100-C104 WeakPolarHBondContact O-CB 3.3Å; L100-C104 PolarHBondContact O-N 3.42Å; L100-C104 PolarHBondContact O-SG 2.9Å; L100-C104 VanDerWaalsContact O-SG 3.4Å
101	R	95.8	Very high	93.7	Very high	194 Å²	194	117.4 Å²	117.4	73%	0.732	58%	0.58	S	S	*	*	H	α-helix	trans	-57.3	-46.9	176.3	-178.7	178.3	175.9	161.2	0.4	111.4	N97 E98 L99 C104 D105	N97-R101 VanDerWaalsContact O-CB 3.23Å; N97-R101 WeakPolarHBondContact O-CB 3.27Å; N97-R101 PolarHBondContact O-N 3.48Å; E98-R101 PolarHBondContact O-N 2.97Å; L99-R101 PolarHBondContact O-N 3.01Å; R101-C104 PolarHBondContact O-N 3.32Å; R101-D105 VanDerWaalsContact O-CB 3.3Å; R101-D105 WeakPolarHBondContact O-CB 3.3Å; R101-D105 PolarHBondContact O-N 2.75Å; R101-D105 VanDerWaalsContact O-N 3.11Å
102	R	93.5	Very high	93.5	Very high	173 Å²	173	117.8 Å²	117.8	65%	0.653	60%	0.595	S	S	*	*	H	α-helix	trans	-65.9	-37.5	178.5	-72.2	179.4	-175.2	-112.2	4.1	112.7	E98 L99 L100	E98-R102 WeakPolarHBondContact O-CG 3.4Å; E98-R102 PolarHBondContact O-N 3.35Å; E98-R102 IonicContact OE1-CZ 3.55Å; E98-R102 IonicContact OE1-NE 3.33Å; E98-R102 PolarHBondContact OE1-NE 3.43Å; E98-R102 IonicContact OE1-NH2 3.55Å; E98-R102 PolarHBondContact OE1-NH2 3.11Å; L99-R102 PolarHBondContact O-N 3.5Å; L100-R102 VanDerWaalsContact C-N 3.34Å; L100-R102 PolarHBondContact O-N 2.93Å
103	I	94.3	Very high	93.4	Very high	111 Å²	111	118.4 Å²	118.4	57%	0.569	61%	0.607	S	S	*	*	H	α-helix	trans	-69.9	-38.4	179.4	-69.3	168.2	0	0	0	111.2	L99 L100	L99-I103 HydrophobicContact CD1-CD1 3.97Å; L99-I103 HydrophobicContact CD1-CG1 4.46Å; L99-I103 HydrophobicContact CG-CD1 3.84Å; L99-I103 VanDerWaalsContact O-CG1 3.27Å; L99-I103 WeakPolarHBondContact O-CG1 3.34Å; L99-I103 PolarHBondContact O-N 3.49Å; L100-I103 PolarHBondContact O-N 3.24Å
104	C	93.4	Very high	93.1	Very high	99 Å²	99	120.8 Å²	120.8	67%	0.669	61%	0.613	S	S	*	*	H	α-helix	trans	-81.2	-13.5	-179.8	-65.9	0	0	0	0	113.7	L100 R101 I106	L100-C104 WeakPolarHBondContact O-CB 3.3Å; L100-C104 PolarHBondContact O-N 3.42Å; L100-C104 PolarHBondContact O-SG 2.9Å; L100-C104 VanDerWaalsContact O-SG 3.4Å; R101-C104 PolarHBondContact O-N 3.32Å; C104-I106 PolarHBondContact O-N 3.49Å
105	D	93.2	Very high	92.6	Very high	91 Å²	91	127.1 Å²	127.1	49%	0.487	63%	0.626	S	S	.	*			trans	-86.2	78.8	178	-170.9	18.5	0	0	0	111.1	R101 Q107	R101-D105 VanDerWaalsContact O-CB 3.3Å; R101-D105 WeakPolarHBondContact O-CB 3.3Å; R101-D105 PolarHBondContact O-N 2.75Å; R101-D105 VanDerWaalsContact O-N 3.11Å; D105-Q107 PolarHBondContact O-N 3.25Å; D105-Q107 PolarHBondContact OD1-NE2 3.18Å
106	I	90.6	Very high	91.9	Very high	140 Å²	140	128.4 Å²	128.4	72%	0.718	63%	0.634	S	S	*	*			trans	-75.7	111.6	177.5	-55.9	176	0	0	0	108.4	C104 P108	C104-I106 PolarHBondContact O-N 3.49Å; I106-P108 WeakPolarHBondContact O-CD 3.12Å
107	Q	88.6	Confident	90.8	Very high	130 Å²	130	129.6 Å²	129.6	61%	0.607	66%	0.655	S	S	*	*			trans	-103.6	89.2	173	-64.6	-62.4	-49.5	0	0	109.3	D105 E109	D105-Q107 PolarHBondContact O-N 3.25Å; D105-Q107 PolarHBondContact OD1-NE2 3.18Å; Q107-E109 PolarHBondContact O-N 3.15Å; Q107-E109 VanDerWaalsContact O-N 3.15Å
108	P	88.4	Confident	88.8	Confident	116 Å²	116	132.1 Å²	132.1	75%	0.753	70%	0.704	S	S	*	*			trans	-71.6	110.1	178.2	28.7	-32.2	0	0	0	109.4	I106	I106-P108 WeakPolarHBondContact O-CD 3.12Å
109	E	90.4	Very high	88.4	Confident	172 Å²	172	133.7 Å²	133.7	80%	0.804	72%	0.715	S	S	*	*			trans	-108.2	139.6	174.8	-66.5	-171.9	168.2	0	0	110.4	Q107 H111	Q107-E109 PolarHBondContact O-N 3.15Å; Q107-E109 VanDerWaalsContact O-N 3.15Å; E109-H111 PolarHBondContact O-N 3.48Å
110	F	87.8	Confident	88	Confident	158 Å²	158	135.7 Å²	135.7	69%	0.693	73%	0.727	S	S	*	*			trans	-66.1	135.1	165.2	-72.9	-78.5	0	0	0	108.4	A112 Y114	F110-A112 PolarHBondContact O-N 3.37Å; F110-Y114 HydrophobicContact CB-CD1 4.41Å; F110-Y114 HydrophobicContact CB-CG 4.37Å; F110-Y114 AromaticContact CD1-CD1 3.68Å; F110-Y114 HydrophobicContact CD1-CD1 3.68Å; F110-Y114 HydrophobicContact CD1-CD2 4.15Å; F110-Y114 AromaticContact CD1-CE1 3.98Å; F110-Y114 HydrophobicContact CD1-CE1 3.98Å; F110-Y114 HydrophobicContact CD1-CE2 4.42Å; F110-Y114 AromaticContact CD1-CG 3.78Å; F110-Y114 HydrophobicContact CD1-CG 3.78Å; F110-Y114 HydrophobicContact CE1-CD1 4.17Å; F110-Y114 AromaticContact CE1-CE1 3.98Å; F110-Y114 HydrophobicContact CE1-CE1 3.98Å; F110-Y114 HydrophobicContact CE1-CE2 4.49Å; F110-Y114 HydrophobicContact CG-CD1 4.1Å; F110-Y114 HydrophobicContact CG-CG 4.34Å
111	H	90	Very high	87.6	Confident	141 Å²	141	137.8 Å²	137.8	65%	0.653	74%	0.739	S	S	*	*			trans	-52.8	138.9	171.4	-172.5	-84.9	0	0	0	109.3	E109 N113 Y114	E109-H111 PolarHBondContact O-N 3.48Å; H111-N113 PolarHBondContact ND1-N 2.82Å; H111-N113 PolarHBondContact O-N 3.39Å; H111-Y114 WeakPolarHBondContact O-CB 3.33Å; H111-Y114 PolarHBondContact O-N 2.82Å
112	A	92.2	Very high	87.1	Confident	97 Å²	97	134.5 Å²	134.5	80%	0.802	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	-20	-171.5	0	0	0	0	0	115.2	F110	F110-A112 PolarHBondContact O-N 3.37Å
113	N	92.9	Very high	86.7	Confident	124 Å²	124	132.1 Å²	132.1	66%	0.663	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.6	5.9	179.8	-61.6	-26.3	0	0	0	114.1	H111 R115	H111-N113 PolarHBondContact ND1-N 2.82Å; H111-N113 PolarHBondContact O-N 3.39Å; N113-R115 PolarHBondContact O-N 3.26Å
114	Y	90.6	Very high	86.2	Confident	142 Å²	142	133.5 Å²	133.5	56%	0.557	76%	0.756	S	S	*	*			trans	-63	123.2	178.2	-178.1	-102.4	0	0	0	110	F110 H111 V116	F110-Y114 HydrophobicContact CB-CD1 4.41Å; F110-Y114 HydrophobicContact CB-CG 4.37Å; F110-Y114 AromaticContact CD1-CD1 3.68Å; F110-Y114 HydrophobicContact CD1-CD1 3.68Å; F110-Y114 HydrophobicContact CD1-CD2 4.15Å; F110-Y114 AromaticContact CD1-CE1 3.98Å; F110-Y114 HydrophobicContact CD1-CE1 3.98Å; F110-Y114 HydrophobicContact CD1-CE2 4.42Å; F110-Y114 AromaticContact CD1-CG 3.78Å; F110-Y114 HydrophobicContact CD1-CG 3.78Å; F110-Y114 HydrophobicContact CE1-CD1 4.17Å; F110-Y114 AromaticContact CE1-CE1 3.98Å; F110-Y114 HydrophobicContact CE1-CE1 3.98Å; F110-Y114 HydrophobicContact CE1-CE2 4.49Å; F110-Y114 HydrophobicContact CG-CD1 4.1Å; F110-Y114 HydrophobicContact CG-CG 4.34Å; H111-Y114 WeakPolarHBondContact O-CB 3.33Å; H111-Y114 PolarHBondContact O-N 2.82Å; Y114-V116 HydrophobicContact CE1-CG2 3.95Å
115	R	86.4	Confident	85.7	Confident	223 Å²	223	136 Å²	136	84%	0.842	76%	0.762	S	S	*	*			trans	-121.9	128.5	176.9	-66.4	-178.3	179.6	-174.6	-0.6	108	N113 A117	N113-R115 PolarHBondContact O-N 3.26Å; R115-A117 PolarHBondContact O-N 3.35Å
116	V	82	Confident	85.2	Confident	122 Å²	122	139.5 Å²	139.5	74%	0.739	78%	0.784	S	S	*	*			trans	-69.6	118.9	172.9	-177.4	0	0	0	0	107.3	Y114 G118	Y114-V116 HydrophobicContact CE1-CG2 3.95Å; V116-G118 PolarHBondContact O-N 3.3Å
117	A	73	Confident	84.7	Confident	98 Å²	98	139.4 Å²	139.4	81%	0.81	79%	0.789	S	S	*	*			trans	-71.1	118.3	172.1	0	0	0	0	0	108.4	R115	R115-A117 PolarHBondContact O-N 3.35Å
118	G	54.1	Low	84.4	Confident	150 Å²	150	140.3 Å²	140.3	100%	1.546	81%	0.806	S	S	*	*			trans	-84.4	0	162.3	0	0	0	0	0	110.7	V116	V116-G118 PolarHBondContact O-N 3.3Å

Retrieved 118 of 118 residues in 110.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).