A0A087Y5Q5_POEFO Loading...

Cytochrome c oxidase subunit

AlphaFold DB , UniProt , Accession A0A087Y5Q5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 130 aa.

						>A0A087Y5Q5_POEFO|A0A087Y5Q5
MAAFGRFSQMLLRSSLTQTRRQLAAAAGHGGDSAKTWKILTFVIALPGVAVCMLNTFLKEKEHSHDAPPEFVPYTHLRIRTKRFPWGDGNKTLFHNSHVNALPDGYEGHDYTCLVWDGKDRRILFLILCP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.9	Very low	60	Low	244 Å²	244	126.4 Å²	126.4	100%	1.202	66%	0.663	S	S	*	*				0	47.6	0	-61.7	-154	-123.7	0	0	113.2
2	A	56.9	Low	60.7	Low	85 Å²	85	124.7 Å²	124.7	70%	0.702	65%	0.654	S	S	*	*			trans	-116.4	-9.9	-174.1	0	0	0	0	0	115.3
3	A	56	Low	61.2	Low	66 Å²	66	128.8 Å²	128.8	55%	0.545	66%	0.655	S	S	.	*	S	Bend	trans	-77.2	-29.2	-174	0	0	0	0	0	113.7	G5 R6	A3-G5 PolarHBondContact O-N 3.46Å; A3-R6 PolarHBondContact O-N 3.48Å
4	F	56.7	Low	61.7	Low	180 Å²	180	123.6 Å²	123.6	79%	0.789	64%	0.636	S	S	*	*	H	α-helix	trans	-70.7	-30	-176.2	-70.3	-78.2	0	0	0	114.1	R6 S8	F4-R6 VanDerWaalsContact C-N 3.33Å; F4-R6 PolarHBondContact O-N 3.32Å; F4-S8 PolarHBondContact O-N 2.99Å
5	G	59.5	Low	62.3	Low	39 Å²	39	118.9 Å²	118.9	40%	0.402	62%	0.618	S	S	.	*	H	α-helix	trans	-71.7	-24.5	178.8	0	0	0	0	0	114.2	A3 S8 Q9	A3-G5 PolarHBondContact O-N 3.46Å; G5-S8 PolarHBondContact O-OG 3.16Å; G5-S8 VanDerWaalsContact O-OG 3.07Å; G5-Q9 WeakPolarHBondContact O-CB 3.42Å; G5-Q9 WeakPolarHBondContact O-CG 3.26Å; G5-Q9 PolarHBondContact O-N 2.97Å; G5-Q9 VanDerWaalsContact O-N 3.16Å
6	R	62.1	Low	63	Low	196 Å²	196	118.5 Å²	118.5	74%	0.74	62%	0.617	S	S	*	*	H	α-helix	trans	-76	-36.4	177.7	-75.7	-176.3	156	-159.4	-4.8	112.2	A3 F4 M10	A3-R6 PolarHBondContact O-N 3.48Å; F4-R6 VanDerWaalsContact C-N 3.33Å; F4-R6 PolarHBondContact O-N 3.32Å; R6-M10 WeakPolarHBondContact O-CB 3.39Å; R6-M10 PolarHBondContact O-N 3.01Å
7	F	61.2	Low	63.6	Low	146 Å²	146	115.9 Å²	115.9	64%	0.64	61%	0.608	S	S	*	*	H	α-helix	trans	-69.6	-41.8	175.6	-84.2	-81	0	0	0	112	Q9 M10 L11	F7-Q9 PolarHBondContact O-N 3.25Å; F7-M10 PolarHBondContact O-N 3.49Å; F7-L11 WeakPolarHBondContact O-CG 3.49Å; F7-L11 PolarHBondContact O-N 3.46Å
8	S	60.9	Low	64.3	Low	59 Å²	59	116.7 Å²	116.7	41%	0.413	61%	0.607	S	S	.	*	H	α-helix	trans	-64.6	-40	175.3	67.3	0	0	0	0	111.9	F4 G5 M10 L11 L12	F4-S8 PolarHBondContact O-N 2.99Å; G5-S8 PolarHBondContact O-OG 3.16Å; G5-S8 VanDerWaalsContact O-OG 3.07Å; S8-M10 PolarHBondContact O-N 3.07Å; S8-L11 PolarHBondContact O-N 3.38Å; S8-L12 WeakPolarHBondContact O-CB 3.41Å; S8-L12 PolarHBondContact O-N 3.06Å
9	Q	62	Low	64.9	Low	118 Å²	118	114.5 Å²	114.5	55%	0.551	60%	0.6	S	S	*	*	H	α-helix	trans	-64.5	-36.3	173.3	-82.8	-169	-31.1	0	0	113.4	G5 F7 R13	G5-Q9 WeakPolarHBondContact O-CB 3.42Å; G5-Q9 WeakPolarHBondContact O-CG 3.26Å; G5-Q9 PolarHBondContact O-N 2.97Å; G5-Q9 VanDerWaalsContact O-N 3.16Å; F7-Q9 PolarHBondContact O-N 3.25Å; Q9-R13 VanDerWaalsContact O-CB 3.32Å; Q9-R13 WeakPolarHBondContact O-CB 3.42Å; Q9-R13 VanDerWaalsContact O-CG 3.26Å; Q9-R13 WeakPolarHBondContact O-CG 3.44Å; Q9-R13 PolarHBondContact O-N 3.41Å
10	M	66.3	Low	65.5	Low	138 Å²	138	119 Å²	119	68%	0.68	61%	0.608	S	S	*	*	H	α-helix	trans	-67.5	-41.8	176	-108.2	-177.8	170.7	0	0	112.1	R6 F7 S8 R13 S14	R6-M10 WeakPolarHBondContact O-CB 3.39Å; R6-M10 PolarHBondContact O-N 3.01Å; F7-M10 PolarHBondContact O-N 3.49Å; S8-M10 PolarHBondContact O-N 3.07Å; M10-R13 PolarHBondContact O-N 3.49Å; M10-S14 WeakPolarHBondContact O-CB 3.32Å; M10-S14 PolarHBondContact O-N 3.43Å; M10-S14 PolarHBondContact O-OG 2.89Å
11	L	70.5	Confident	66	Low	119 Å²	119	122.2 Å²	122.2	62%	0.623	61%	0.613	S	S	*	*	H	α-helix	trans	-68	-38.8	177.3	-69.1	173.1	0	0	0	112	F7 S8 S14 S15	F7-L11 WeakPolarHBondContact O-CG 3.49Å; F7-L11 PolarHBondContact O-N 3.46Å; S8-L11 PolarHBondContact O-N 3.38Å; L11-S14 PolarHBondContact O-OG 2.93Å; L11-S15 WeakPolarHBondContact O-CB 3.41Å; L11-S15 PolarHBondContact O-N 2.62Å; L11-S15 PolarHBondContact O-OG 2.97Å
12	L	68.8	Low	67.4	Low	106 Å²	106	116.9 Å²	116.9	56%	0.555	59%	0.585	S	S	*	*	H	α-helix	trans	-66	-40.7	172.6	-91.7	148.1	0	0	0	112.2	S8 S15 L16	S8-L12 WeakPolarHBondContact O-CB 3.41Å; S8-L12 PolarHBondContact O-N 3.06Å; L12-S15 WeakPolarHBondContact CA-OG 3.46Å; L12-S15 PolarHBondContact O-OG 2.87Å; L12-S15 VanDerWaalsContact O-OG 3.06Å; L12-L16 WeakPolarHBondContact O-CB 3.36Å; L12-L16 WeakPolarHBondContact O-CD1 3.39Å; L12-L16 WeakPolarHBondContact O-CG 3.33Å; L12-L16 PolarHBondContact O-N 3.05Å
13	R	66.4	Low	68.3	Low	178 Å²	178	118.5 Å²	118.5	67%	0.672	58%	0.581	S	S	*	*	H	α-helix	trans	-67.4	-40.9	176.3	-78.4	178.8	177.5	-140.3	0.2	112.2	Q9 M10 T17	Q9-R13 VanDerWaalsContact O-CB 3.32Å; Q9-R13 WeakPolarHBondContact O-CB 3.42Å; Q9-R13 VanDerWaalsContact O-CG 3.26Å; Q9-R13 WeakPolarHBondContact O-CG 3.44Å; Q9-R13 PolarHBondContact O-N 3.41Å; M10-R13 PolarHBondContact O-N 3.49Å; R13-T17 WeakPolarHBondContact O-CG2 3.29Å; R13-T17 PolarHBondContact O-N 3.01Å; R13-T17 PolarHBondContact O-OG1 3.12Å; R13-T17 VanDerWaalsContact O-OG1 3.09Å
14	S	68.9	Low	69	Low	56 Å²	56	118.5 Å²	118.5	39%	0.392	58%	0.581	S	S	.	*	H	α-helix	trans	-66	-46.4	179.1	72.1	0	0	0	0	111.2	M10 L11 T17 Q18	M10-S14 WeakPolarHBondContact O-CB 3.32Å; M10-S14 PolarHBondContact O-N 3.43Å; M10-S14 PolarHBondContact O-OG 2.89Å; L11-S14 PolarHBondContact O-OG 2.93Å; S14-T17 WeakPolarHBondContact CA-OG1 3.28Å; S14-T17 PolarHBondContact O-N 2.72Å; S14-T17 PolarHBondContact O-OG1 3.08Å; S14-Q18 WeakPolarHBondContact O-CB 3.42Å; S14-Q18 PolarHBondContact O-N 3.09Å
15	S	71	Confident	69.5	Low	53 Å²	53	112.7 Å²	112.7	37%	0.371	57%	0.566	S	S	.	*	H	α-helix	trans	-61.3	-45.8	175.7	44.9	0	0	0	0	111.8	L11 L12 T17 Q18 T19	L11-S15 WeakPolarHBondContact O-CB 3.41Å; L11-S15 PolarHBondContact O-N 2.62Å; L11-S15 PolarHBondContact O-OG 2.97Å; L12-S15 WeakPolarHBondContact CA-OG 3.46Å; L12-S15 PolarHBondContact O-OG 2.87Å; L12-S15 VanDerWaalsContact O-OG 3.06Å; S15-T17 PolarHBondContact O-N 2.91Å; S15-Q18 WeakPolarHBondContact O-CB 3.43Å; S15-Q18 PolarHBondContact O-N 3.25Å; S15-Q18 VanDerWaalsContact O-N 3.12Å; S15-T19 PolarHBondContact O-N 2.98Å; S15-T19 PolarHBondContact O-OG1 2.98Å
16	L	73.2	Confident	69.7	Low	113 Å²	113	113.7 Å²	113.7	59%	0.592	57%	0.571	S	S	*	*	H	α-helix	trans	-61.5	-39.2	175.2	-71.3	170.9	0	0	0	113.2	L12 Q18 R20	L12-L16 WeakPolarHBondContact O-CB 3.36Å; L12-L16 WeakPolarHBondContact O-CD1 3.39Å; L12-L16 WeakPolarHBondContact O-CG 3.33Å; L12-L16 PolarHBondContact O-N 3.05Å; L16-Q18 VanDerWaalsContact C-N 3.33Å; L16-R20 VanDerWaalsContact O-CB 3.28Å; L16-R20 WeakPolarHBondContact O-CB 3.15Å; L16-R20 PolarHBondContact O-N 3.38Å
17	T	73.4	Confident	69.7	Low	75 Å²	75	107.8 Å²	107.8	46%	0.46	56%	0.564	S	S	.	*	H	α-helix	trans	-67.3	-34.5	174.5	51.7	0	0	0	0	112.7	R13 S14 S15 R21	R13-T17 WeakPolarHBondContact O-CG2 3.29Å; R13-T17 PolarHBondContact O-N 3.01Å; R13-T17 PolarHBondContact O-OG1 3.12Å; R13-T17 VanDerWaalsContact O-OG1 3.09Å; S14-T17 WeakPolarHBondContact CA-OG1 3.28Å; S14-T17 PolarHBondContact O-N 2.72Å; S14-T17 PolarHBondContact O-OG1 3.08Å; S15-T17 PolarHBondContact O-N 2.91Å; T17-R21 VanDerWaalsContact O-CG 3.29Å; T17-R21 WeakPolarHBondContact O-CG 3.5Å; T17-R21 PolarHBondContact O-N 2.86Å; T17-R21 VanDerWaalsContact O-N 3.08Å
18	Q	76.7	Confident	69.7	Low	129 Å²	129	103.4 Å²	103.4	60%	0.603	56%	0.56	S	S	*	*	H	α-helix	trans	-69.9	-46.1	176.5	-167.2	165.7	-39.9	0	0	110.8	S14 S15 L16 R20 R21 Q22	S14-Q18 WeakPolarHBondContact O-CB 3.42Å; S14-Q18 PolarHBondContact O-N 3.09Å; S15-Q18 WeakPolarHBondContact O-CB 3.43Å; S15-Q18 PolarHBondContact O-N 3.25Å; S15-Q18 VanDerWaalsContact O-N 3.12Å; L16-Q18 VanDerWaalsContact C-N 3.33Å; Q18-R20 VanDerWaalsContact C-N 3.32Å; Q18-R20 PolarHBondContact O-N 2.96Å; Q18-R21 PolarHBondContact O-N 3.41Å; Q18-Q22 VanDerWaalsContact O-CG 3.32Å; Q18-Q22 WeakPolarHBondContact O-CG 3.36Å; Q18-Q22 PolarHBondContact O-N 3.4Å
19	T	75.2	Confident	69.7	Low	76 Å²	76	107.9 Å²	107.9	47%	0.466	57%	0.574	S	S	.	*	H	α-helix	trans	-60.8	-40.7	174.9	-43.8	0	0	0	0	111.6	S15 R21 Q22 L23	S15-T19 PolarHBondContact O-N 2.98Å; S15-T19 PolarHBondContact O-OG1 2.98Å; T19-R21 VanDerWaalsContact C-N 3.34Å; T19-R21 PolarHBondContact O-N 2.93Å; T19-Q22 PolarHBondContact O-N 3.01Å; T19-L23 HydrophobicContact CG2-CD1 4.29Å; T19-L23 WeakPolarHBondContact O-CG 3.41Å; T19-L23 PolarHBondContact O-N 3.44Å
20	R	76.1	Confident	69.6	Low	203 Å²	203	103.9 Å²	103.9	77%	0.766	57%	0.565	S	S	*	*	H	α-helix	trans	-64.7	-36.5	177	-162.1	175.8	-167.6	154.6	2.5	112.6	L16 Q18 A24	L16-R20 VanDerWaalsContact O-CB 3.28Å; L16-R20 WeakPolarHBondContact O-CB 3.15Å; L16-R20 PolarHBondContact O-N 3.38Å; Q18-R20 VanDerWaalsContact C-N 3.32Å; Q18-R20 PolarHBondContact O-N 2.96Å; R20-A24 WeakPolarHBondContact O-CB 3.32Å; R20-A24 PolarHBondContact O-N 3.27Å
21	R	76.7	Confident	69.6	Low	188 Å²	188	99.3 Å²	99.3	71%	0.709	55%	0.552	S	S	*	*	H	α-helix	trans	-67.8	-41	173.4	-74.2	173.2	-177.5	178.3	1.4	112	T17 Q18 T19 A24 A25	T17-R21 VanDerWaalsContact O-CG 3.29Å; T17-R21 WeakPolarHBondContact O-CG 3.5Å; T17-R21 PolarHBondContact O-N 2.86Å; T17-R21 VanDerWaalsContact O-N 3.08Å; Q18-R21 PolarHBondContact O-N 3.41Å; T19-R21 VanDerWaalsContact C-N 3.34Å; T19-R21 PolarHBondContact O-N 2.93Å; R21-A24 PolarHBondContact O-N 3.19Å; R21-A25 WeakPolarHBondContact O-CB 3.37Å; R21-A25 PolarHBondContact O-N 3.45Å
22	Q	76.7	Confident	69.7	Low	132 Å²	132	98.5 Å²	98.5	62%	0.617	55%	0.549	S	S	*	.	H	α-helix	trans	-63.3	-44.2	176.2	-66.8	-67.1	-32.2	0	0	111.6	Q18 T19 A25 A26	Q18-Q22 VanDerWaalsContact O-CG 3.32Å; Q18-Q22 WeakPolarHBondContact O-CG 3.36Å; Q18-Q22 PolarHBondContact O-N 3.4Å; T19-Q22 PolarHBondContact O-N 3.01Å; Q22-A25 PolarHBondContact O-N 2.93Å; Q22-A26 WeakPolarHBondContact O-CB 3.37Å; Q22-A26 PolarHBondContact O-N 3.41Å
23	L	75.2	Confident	70.1	Confident	119 Å²	119	95.7 Å²	95.7	62%	0.623	54%	0.538	S	S	*	.	H	α-helix	trans	-66.1	-39.4	176.3	-69.7	169.9	0	0	0	112.5	T19 A26 A27	T19-L23 HydrophobicContact CG2-CD1 4.29Å; T19-L23 WeakPolarHBondContact O-CG 3.41Å; T19-L23 PolarHBondContact O-N 3.44Å; L23-A26 PolarHBondContact O-N 2.94Å; L23-A27 WeakPolarHBondContact O-CB 3.34Å; L23-A27 PolarHBondContact O-N 2.94Å
24	A	70.9	Confident	71.1	Confident	65 Å²	65	90 Å²	90	54%	0.537	53%	0.529	S	S	.	.	H	α-helix	trans	-66.4	-38.6	175.2	0	0	0	0	0	112.3	R20 R21 A27 G28	R20-A24 WeakPolarHBondContact O-CB 3.32Å; R20-A24 PolarHBondContact O-N 3.27Å; R21-A24 PolarHBondContact O-N 3.19Å; A24-A27 PolarHBondContact O-N 3.37Å; A24-G28 PolarHBondContact O-N 2.91Å
25	A	67	Low	71.9	Confident	58 Å²	58	93.7 Å²	93.7	48%	0.479	54%	0.538	S	S	.	.	H	α-helix	trans	-66.4	-41.3	174.7	0	0	0	0	0	112	R21 Q22 G28 H29	R21-A25 WeakPolarHBondContact O-CB 3.37Å; R21-A25 PolarHBondContact O-N 3.45Å; Q22-A25 PolarHBondContact O-N 2.93Å; A25-G28 PolarHBondContact O-N 3Å; A25-H29 PolarHBondContact O-N 3.32Å; A25-H29 VanDerWaalsContact O-N 3.08Å
26	A	64.3	Low	72.9	Confident	61 Å²	61	94.9 Å²	94.9	50%	0.504	54%	0.543	S	S	.	.	H	α-helix	trans	-64.2	-39.6	173.9	0	0	0	0	0	112.2	Q22 L23 G28 H29 G30	Q22-A26 WeakPolarHBondContact O-CB 3.37Å; Q22-A26 PolarHBondContact O-N 3.41Å; L23-A26 PolarHBondContact O-N 2.94Å; A26-G28 VanDerWaalsContact C-N 3.34Å; A26-G28 PolarHBondContact O-N 3.49Å; A26-H29 PolarHBondContact O-N 3.29Å; A26-G30 PolarHBondContact O-N 3.08Å
27	A	62.2	Low	73.8	Confident	72 Å²	72	97.3 Å²	97.3	60%	0.595	55%	0.545	S	S	*	.	H	α-helix	trans	-65	-36.3	174.5	0	0	0	0	0	112.5	L23 A24 G30 G31	L23-A27 WeakPolarHBondContact O-CB 3.34Å; L23-A27 PolarHBondContact O-N 2.94Å; A24-A27 PolarHBondContact O-N 3.37Å; A27-G30 PolarHBondContact O-N 3.29Å; A27-G31 PolarHBondContact O-N 3.44Å
28	G	60.4	Low	74.7	Confident	54 Å²	54	100.2 Å²	100.2	56%	0.557	55%	0.551	S	S	*	*	H	α-helix	trans	-64.6	-38	172.7	0	0	0	0	0	113.5	A24 A25 A26	A24-G28 PolarHBondContact O-N 2.91Å; A25-G28 PolarHBondContact O-N 3Å; A26-G28 VanDerWaalsContact C-N 3.34Å; A26-G28 PolarHBondContact O-N 3.49Å
29	H	60.9	Low	75.6	Confident	153 Å²	153	99.2 Å²	99.2	71%	0.708	55%	0.548	S	S	*	.	H	α-helix	trans	-74	-25.4	173.3	-92.9	62.6	0	0	0	113.6	A25 A26 S33	A25-H29 PolarHBondContact O-N 3.32Å; A25-H29 VanDerWaalsContact O-N 3.08Å; A26-H29 PolarHBondContact O-N 3.29Å; H29-S33 VanDerWaalsContact O-CB 3.3Å; H29-S33 WeakPolarHBondContact O-CB 3.46Å; H29-S33 PolarHBondContact O-N 2.87Å; H29-S33 PolarHBondContact O-OG 3.07Å
30	G	60.5	Low	76.6	Confident	34 Å²	34	99.1 Å²	99.1	35%	0.351	55%	0.545	S	S	.	.	H	α-helix	trans	-67.4	-39.7	177.4	0	0	0	0	0	113.4	A26 A27 S33 A34	A26-G30 PolarHBondContact O-N 3.08Å; A27-G30 PolarHBondContact O-N 3.29Å; G30-S33 VanDerWaalsContact CA-OG 3.31Å; G30-S33 WeakPolarHBondContact CA-OG 3.4Å; G30-S33 PolarHBondContact O-OG 3.01Å; G30-A34 WeakPolarHBondContact O-CB 3.31Å; G30-A34 PolarHBondContact O-N 2.92Å
31	G	66.3	Low	77.6	Confident	41 Å²	41	92.6 Å²	92.6	42%	0.423	53%	0.527	S	S	.	.	H	α-helix	trans	-68.6	-34.6	179.4	0	0	0	0	0	113.7	A27 K35	A27-G31 PolarHBondContact O-N 3.44Å; G31-K35 WeakPolarHBondContact O-CG 3.3Å
32	D	72.2	Confident	78.6	Confident	103 Å²	103	89.9 Å²	89.9	55%	0.551	52%	0.521	S	S	*	.	H	α-helix	trans	-80	-40	177.4	-151	33.6	0	0	0	111.5	A34 K35 T36	D32-A34 PolarHBondContact O-N 3.01Å; D32-K35 WeakPolarHBondContact O-CB 3.44Å; D32-K35 PolarHBondContact O-N 3.04Å; D32-K35 VanDerWaalsContact O-N 3.11Å; D32-T36 WeakPolarHBondContact O-CG2 3.46Å; D32-T36 PolarHBondContact O-N 3.4Å
33	S	78.8	Confident	79.5	Confident	47 Å²	47	88.1 Å²	88.1	33%	0.329	52%	0.519	S	S	.	.	H	α-helix	trans	-59.9	-44.1	174.1	58.3	0	0	0	0	111.9	H29 G30 K35 T36 W37	H29-S33 VanDerWaalsContact O-CB 3.3Å; H29-S33 WeakPolarHBondContact O-CB 3.46Å; H29-S33 PolarHBondContact O-N 2.87Å; H29-S33 PolarHBondContact O-OG 3.07Å; G30-S33 VanDerWaalsContact CA-OG 3.31Å; G30-S33 WeakPolarHBondContact CA-OG 3.4Å; G30-S33 PolarHBondContact O-OG 3.01Å; S33-K35 PolarHBondContact O-N 2.67Å; S33-T36 WeakPolarHBondContact CA-OG1 3.35Å; S33-T36 PolarHBondContact O-N 2.96Å; S33-T36 VanDerWaalsContact O-N 3.07Å; S33-T36 PolarHBondContact O-OG1 3.47Å; S33-W37 PolarHBondContact O-N 3.21Å
34	A	85.7	Confident	80.6	Confident	57 Å²	57	87.7 Å²	87.7	47%	0.471	52%	0.516	S	S	.	.	H	α-helix	trans	-57.8	-34.7	176	0	0	0	0	0	113.4	G30 D32 K38	G30-A34 WeakPolarHBondContact O-CB 3.31Å; G30-A34 PolarHBondContact O-N 2.92Å; D32-A34 PolarHBondContact O-N 3.01Å; A34-K38 WeakPolarHBondContact O-CB 3.5Å; A34-K38 PolarHBondContact O-N 3.11Å; A34-K38 VanDerWaalsContact O-N 3.11Å
35	K	86.6	Confident	81.8	Confident	134 Å²	134	86.7 Å²	86.7	58%	0.583	51%	0.508	S	S	*	.	H	α-helix	trans	-70.3	-44.1	174.4	-66.9	172.9	-173.8	175.7	0	111.3	G31 D32 S33 W37 K38 I39	G31-K35 WeakPolarHBondContact O-CG 3.3Å; D32-K35 WeakPolarHBondContact O-CB 3.44Å; D32-K35 PolarHBondContact O-N 3.04Å; D32-K35 VanDerWaalsContact O-N 3.11Å; S33-K35 PolarHBondContact O-N 2.67Å; K35-W37 PolarHBondContact O-N 3.47Å; K35-K38 PolarHBondContact O-N 3.25Å; K35-I39 WeakPolarHBondContact O-CG1 3.47Å; K35-I39 PolarHBondContact O-N 2.93Å
36	T	91	Very high	83.3	Confident	78 Å²	78	88.4 Å²	88.4	48%	0.479	51%	0.509	S	S	.	.	H	α-helix	trans	-59.9	-44.5	176.9	62.2	0	0	0	0	112.2	D32 S33 K38 I39 L40	D32-T36 WeakPolarHBondContact O-CG2 3.46Å; D32-T36 PolarHBondContact O-N 3.4Å; S33-T36 WeakPolarHBondContact CA-OG1 3.35Å; S33-T36 PolarHBondContact O-N 2.96Å; S33-T36 VanDerWaalsContact O-N 3.07Å; S33-T36 PolarHBondContact O-OG1 3.47Å; T36-K38 PolarHBondContact O-N 3.11Å; T36-I39 PolarHBondContact O-N 2.96Å; T36-L40 WeakPolarHBondContact O-CB 3.32Å; T36-L40 PolarHBondContact O-N 2.99Å
37	W	92.8	Very high	84.9	Confident	165 Å²	165	88.4 Å²	88.4	63%	0.625	50%	0.503	S	S	*	.	H	α-helix	trans	-65.6	-37.6	176.6	-71.1	110.2	0	0	0	112.6	S33 K35 L40 T41	S33-W37 PolarHBondContact O-N 3.21Å; K35-W37 PolarHBondContact O-N 3.47Å; W37-L40 HydrophobicContact CE3-CD2 4.02Å; W37-L40 HydrophobicContact CZ3-CD2 4Å; W37-L40 PolarHBondContact O-N 2.87Å; W37-T41 WeakPolarHBondContact O-CB 3.36Å; W37-T41 PolarHBondContact O-N 3.33Å; W37-T41 PolarHBondContact O-OG1 3.47Å
38	K	93.5	Very high	86.6	Confident	136 Å²	136	86.6 Å²	86.6	59%	0.591	49%	0.492	S	S	*	.	H	α-helix	trans	-62.7	-48.6	174.6	-171.3	175.8	-67	179.9	0	110.9	A34 K35 T36 L40 T41 F42	A34-K38 WeakPolarHBondContact O-CB 3.5Å; A34-K38 PolarHBondContact O-N 3.11Å; A34-K38 VanDerWaalsContact O-N 3.11Å; K35-K38 PolarHBondContact O-N 3.25Å; T36-K38 PolarHBondContact O-N 3.11Å; K38-L40 PolarHBondContact O-N 3.37Å; K38-T41 PolarHBondContact O-N 2.81Å; K38-F42 HydrophobicContact CD-CE2 4.39Å; K38-F42 HydrophobicContact CG-CD2 3.7Å; K38-F42 HydrophobicContact CG-CE2 3.69Å; K38-F42 WeakPolarHBondContact O-CD2 3.43Å; K38-F42 PolarHBondContact O-N 3.28Å
39	I	95.3	Very high	88.4	Confident	108 Å²	108	88.2 Å²	88.2	55%	0.554	49%	0.491	S	S	*	.	H	α-helix	trans	-60.2	-47.3	177.6	-67.5	166.5	0	0	0	110.1	K35 T36 T41 F42 V43	K35-I39 WeakPolarHBondContact O-CG1 3.47Å; K35-I39 PolarHBondContact O-N 2.93Å; T36-I39 PolarHBondContact O-N 2.96Å; I39-T41 VanDerWaalsContact C-N 3.33Å; I39-T41 PolarHBondContact O-N 3.48Å; I39-F42 PolarHBondContact O-N 3.33Å; I39-V43 HydrophobicContact CG2-CB 4.42Å; I39-V43 HydrophobicContact CG2-CG2 3.95Å; I39-V43 VanDerWaalsContact O-CB 3.22Å; I39-V43 WeakPolarHBondContact O-CB 3.33Å; I39-V43 WeakPolarHBondContact O-CG2 3.22Å; I39-V43 PolarHBondContact O-N 3.04Å
40	L	96.6	Very high	90.1	Very high	74 Å²	74	83.7 Å²	83.7	39%	0.387	48%	0.48	S	S	.	.	H	α-helix	trans	-58	-44.7	178.9	-174.4	64.3	0	0	0	111.9	T36 W37 K38 I44 A45	T36-L40 WeakPolarHBondContact O-CB 3.32Å; T36-L40 PolarHBondContact O-N 2.99Å; W37-L40 HydrophobicContact CE3-CD2 4.02Å; W37-L40 HydrophobicContact CZ3-CD2 4Å; W37-L40 PolarHBondContact O-N 2.87Å; K38-L40 PolarHBondContact O-N 3.37Å; L40-I44 HydrophobicContact CD1-CB 3.95Å; L40-I44 HydrophobicContact CD1-CD1 3.4Å; L40-I44 HydrophobicContact CD1-CG1 4.13Å; L40-I44 HydrophobicContact CD1-CG2 4.35Å; L40-I44 WeakPolarHBondContact O-CA 3.35Å; L40-I44 WeakPolarHBondContact O-CB 3.48Å; L40-I44 PolarHBondContact O-N 3.02Å; L40-A45 PolarHBondContact O-N 2.95Å
41	T	96.3	Very high	91.9	Very high	65 Å²	65	87 Å²	87	40%	0.399	49%	0.494	S	S	.	.	I	π-helix	trans	-63	-47.8	177.9	-61.2	0	0	0	0	111.8	W37 K38 I39 A45 L46	W37-T41 WeakPolarHBondContact O-CB 3.36Å; W37-T41 PolarHBondContact O-N 3.33Å; W37-T41 PolarHBondContact O-OG1 3.47Å; K38-T41 PolarHBondContact O-N 2.81Å; I39-T41 VanDerWaalsContact C-N 3.33Å; I39-T41 PolarHBondContact O-N 3.48Å; T41-A45 WeakPolarHBondContact O-CB 3.18Å; T41-A45 PolarHBondContact O-N 3.31Å; T41-L46 WeakPolarHBondContact O-CG 3.41Å; T41-L46 PolarHBondContact O-N 2.91Å
42	F	96.8	Very high	93.4	Very high	131 Å²	131	89 Å²	89	58%	0.575	50%	0.5	S	S	*	.	I	π-helix	trans	-77.5	-33.4	-175.6	-75.8	-71.3	0	0	0	113.9	K38 I39 L46 P47	K38-F42 HydrophobicContact CD-CE2 4.39Å; K38-F42 HydrophobicContact CG-CD2 3.7Å; K38-F42 HydrophobicContact CG-CE2 3.69Å; K38-F42 WeakPolarHBondContact O-CD2 3.43Å; K38-F42 PolarHBondContact O-N 3.28Å; I39-F42 PolarHBondContact O-N 3.33Å; F42-L46 HydrophobicContact CD1-CD1 3.47Å; F42-L46 VanDerWaalsContact CD1-CD1 3.47Å; F42-L46 HydrophobicContact CE1-CD1 3.85Å; F42-L46 HydrophobicContact CG-CD1 4.4Å; F42-P47 WeakPolarHBondContact O-CD 3.4Å
43	V	96.8	Very high	94.6	Very high	95 Å²	95	89.9 Å²	89.9	58%	0.576	50%	0.502	S	S	*	.	I	π-helix	trans	-94.6	-28	-173.6	-179.5	0	0	0	0	112.2	I39 P47	I39-V43 HydrophobicContact CG2-CB 4.42Å; I39-V43 HydrophobicContact CG2-CG2 3.95Å; I39-V43 VanDerWaalsContact O-CB 3.22Å; I39-V43 WeakPolarHBondContact O-CB 3.33Å; I39-V43 WeakPolarHBondContact O-CG2 3.22Å; I39-V43 PolarHBondContact O-N 3.04Å; V43-P47 WeakPolarHBondContact O-CG 3.32Å
44	I	97.2	Very high	95.5	Very high	110 Å²	110	92.5 Å²	92.5	56%	0.564	51%	0.512	S	S	*	.	I	π-helix	trans	-116.6	-54	-176.4	-65.1	170.9	0	0	0	111.1	L40 G48	L40-I44 HydrophobicContact CD1-CB 3.95Å; L40-I44 HydrophobicContact CD1-CD1 3.4Å; L40-I44 HydrophobicContact CD1-CG1 4.13Å; L40-I44 HydrophobicContact CD1-CG2 4.35Å; L40-I44 WeakPolarHBondContact O-CA 3.35Å; L40-I44 WeakPolarHBondContact O-CB 3.48Å; L40-I44 PolarHBondContact O-N 3.02Å; I44-G48 PolarHBondContact O-N 2.87Å
45	A	97.8	Very high	96	Very high	45 Å²	45	93.5 Å²	93.5	37%	0.372	51%	0.509	S	S	.	.	I	π-helix	trans	-66.6	-48.3	-173.1	0	0	0	0	0	112.3	L40 T41 G48 V49	L40-A45 PolarHBondContact O-N 2.95Å; T41-A45 WeakPolarHBondContact O-CB 3.18Å; T41-A45 PolarHBondContact O-N 3.31Å; A45-G48 PolarHBondContact O-N 2.91Å; A45-V49 VanDerWaalsContact O-CG2 3.32Å; A45-V49 WeakPolarHBondContact O-CG2 3.4Å; A45-V49 PolarHBondContact O-N 3.32Å
46	L	97.8	Very high	96.3	Very high	93 Å²	93	90.9 Å²	90.9	49%	0.487	51%	0.505	S	S	.	.	H	α-helix	trans	-63.6	-47.1	179.7	-69.3	-178.6	0	0	0	112.7	T41 F42 G48 V49 A50	T41-L46 WeakPolarHBondContact O-CG 3.41Å; T41-L46 PolarHBondContact O-N 2.91Å; F42-L46 HydrophobicContact CD1-CD1 3.47Å; F42-L46 VanDerWaalsContact CD1-CD1 3.47Å; F42-L46 HydrophobicContact CE1-CD1 3.85Å; F42-L46 HydrophobicContact CG-CD1 4.4Å; L46-G48 VanDerWaalsContact C-N 3.33Å; L46-G48 PolarHBondContact O-N 3.43Å; L46-V49 PolarHBondContact O-N 2.92Å; L46-A50 WeakPolarHBondContact O-CB 3.27Å; L46-A50 PolarHBondContact O-N 3.41Å
47	P	97.6	Very high	96.5	Very high	61 Å²	61	91.7 Å²	91.7	40%	0.396	50%	0.502	S	S	.	.	H	α-helix	trans	-62.7	-38.5	173.9	-27.9	39.8	0	0	0	112.9	F42 V43 A50 V51	F42-P47 WeakPolarHBondContact O-CD 3.4Å; V43-P47 WeakPolarHBondContact O-CG 3.32Å; P47-A50 PolarHBondContact O-N 3.07Å; P47-V51 WeakPolarHBondContact O-CG2 3.4Å; P47-V51 PolarHBondContact O-N 3.01Å
48	G	97.7	Very high	96.5	Very high	35 Å²	35	88.7 Å²	88.7	36%	0.361	50%	0.497	S	S	.	.	H	α-helix	trans	-60.3	-48.4	175.9	0	0	0	0	0	112.4	I44 A45 L46 A50 V51 C52	I44-G48 PolarHBondContact O-N 2.87Å; A45-G48 PolarHBondContact O-N 2.91Å; L46-G48 VanDerWaalsContact C-N 3.33Å; L46-G48 PolarHBondContact O-N 3.43Å; G48-A50 VanDerWaalsContact C-N 3.32Å; G48-A50 PolarHBondContact O-N 3.32Å; G48-V51 PolarHBondContact O-N 3.45Å; G48-C52 PolarHBondContact O-N 3.26Å; G48-C52 VanDerWaalsContact O-N 3.07Å; G48-C52 PolarHBondContact O-SG 3.45Å
49	V	98.1	Very high	96.2	Very high	87 Å²	87	87.1 Å²	87.1	53%	0.527	49%	0.49	S	S	.	.	H	α-helix	trans	-62.4	-40	175.3	172.2	0	0	0	0	111	A45 L46 V51 C52 M53	A45-V49 VanDerWaalsContact O-CG2 3.32Å; A45-V49 WeakPolarHBondContact O-CG2 3.4Å; A45-V49 PolarHBondContact O-N 3.32Å; L46-V49 PolarHBondContact O-N 2.92Å; V49-V51 VanDerWaalsContact C-N 3.35Å; V49-V51 PolarHBondContact O-N 2.81Å; V49-C52 PolarHBondContact O-N 3.29Å; V49-M53 VanDerWaalsContact O-CB 3.27Å; V49-M53 WeakPolarHBondContact O-CB 3.34Å; V49-M53 PolarHBondContact O-N 3.44Å
50	A	97.9	Very high	95.9	Very high	59 Å²	59	88.2 Å²	88.2	49%	0.488	49%	0.493	S	S	.	.	H	α-helix	trans	-61.5	-41.7	178.3	0	0	0	0	0	112.2	L46 P47 G48 M53 L54	L46-A50 WeakPolarHBondContact O-CB 3.27Å; L46-A50 PolarHBondContact O-N 3.41Å; P47-A50 PolarHBondContact O-N 3.07Å; G48-A50 VanDerWaalsContact C-N 3.32Å; G48-A50 PolarHBondContact O-N 3.32Å; A50-M53 PolarHBondContact O-N 2.89Å; A50-L54 WeakPolarHBondContact O-CB 3.47Å; A50-L54 PolarHBondContact O-N 3.45Å
51	V	97.9	Very high	95.2	Very high	104 Å²	104	91 Å²	91	63%	0.63	50%	0.503	S	S	*	.	H	α-helix	trans	-64.9	-45.4	175.5	173.7	0	0	0	0	111.1	P47 G48 V49 M53 L54 N55	P47-V51 WeakPolarHBondContact O-CG2 3.4Å; P47-V51 PolarHBondContact O-N 3.01Å; G48-V51 PolarHBondContact O-N 3.45Å; V49-V51 VanDerWaalsContact C-N 3.35Å; V49-V51 PolarHBondContact O-N 2.81Å; V51-M53 VanDerWaalsContact C-N 3.35Å; V51-M53 PolarHBondContact O-N 2.97Å; V51-L54 PolarHBondContact O-N 2.97Å; V51-N55 PolarHBondContact O-N 3Å
52	C	97.2	Very high	94.5	Very high	82 Å²	82	95.3 Å²	95.3	55%	0.554	52%	0.518	S	S	*	.	H	α-helix	trans	-61.5	-43.6	176.5	-68.9	0	0	0	0	111.8	G48 V49 L54 N55 T56	G48-C52 PolarHBondContact O-N 3.26Å; G48-C52 VanDerWaalsContact O-N 3.07Å; G48-C52 PolarHBondContact O-SG 3.45Å; V49-C52 PolarHBondContact O-N 3.29Å; C52-L54 VanDerWaalsContact C-N 3.35Å; C52-L54 PolarHBondContact O-N 3.2Å; C52-N55 WeakPolarHBondContact O-CB 3.5Å; C52-N55 PolarHBondContact O-N 3.47Å; C52-T56 PolarHBondContact O-N 2.91Å; C52-T56 PolarHBondContact O-OG1 3.44Å
53	M	97.7	Very high	93.2	Very high	121 Å²	121	95.2 Å²	95.2	60%	0.596	52%	0.519	S	S	*	.	H	α-helix	trans	-60.7	-43.5	177.4	-171.3	68.9	71.5	0	0	111.5	V49 A50 V51 N55 T56 F57	V49-M53 VanDerWaalsContact O-CB 3.27Å; V49-M53 WeakPolarHBondContact O-CB 3.34Å; V49-M53 PolarHBondContact O-N 3.44Å; A50-M53 PolarHBondContact O-N 2.89Å; V51-M53 VanDerWaalsContact C-N 3.35Å; V51-M53 PolarHBondContact O-N 2.97Å; M53-N55 VanDerWaalsContact C-N 3.35Å; M53-T56 WeakPolarHBondContact CA-OG1 3.23Å; M53-T56 PolarHBondContact O-N 3.48Å; M53-T56 PolarHBondContact O-OG1 3.15Å; M53-F57 VanDerWaalsContact O-CB 3.23Å; M53-F57 WeakPolarHBondContact O-CB 3.43Å; M53-F57 PolarHBondContact O-N 3.21Å
54	L	96.6	Very high	91.4	Very high	102 Å²	102	93.8 Å²	93.8	53%	0.534	51%	0.513	S	S	.	.	H	α-helix	trans	-63.4	-41.7	175.9	-178	62.7	0	0	0	111.3	A50 V51 C52 F57 L58	A50-L54 WeakPolarHBondContact O-CB 3.47Å; A50-L54 PolarHBondContact O-N 3.45Å; V51-L54 PolarHBondContact O-N 2.97Å; C52-L54 VanDerWaalsContact C-N 3.35Å; C52-L54 PolarHBondContact O-N 3.2Å; L54-F57 PolarHBondContact O-N 2.9Å; L54-L58 HydrophobicContact CD1-CD1 4.24Å; L54-L58 HydrophobicContact CD1-CG 4.25Å; L54-L58 HydrophobicContact CG-CD1 4.11Å; L54-L58 VanDerWaalsContact O-CG 3.29Å; L54-L58 WeakPolarHBondContact O-CG 3.46Å; L54-L58 PolarHBondContact O-N 3.28Å
55	N	96.2	Very high	89.4	Confident	79 Å²	79	96.5 Å²	96.5	42%	0.422	52%	0.523	S	S	.	.	H	α-helix	trans	-61.5	-47.1	177.3	-176.1	-105.5	0	0	0	112.1	V51 C52 M53 L58 K59	V51-N55 PolarHBondContact O-N 3Å; C52-N55 WeakPolarHBondContact O-CB 3.5Å; C52-N55 PolarHBondContact O-N 3.47Å; M53-N55 VanDerWaalsContact C-N 3.35Å; N55-L58 PolarHBondContact O-N 3.34Å; N55-K59 WeakPolarHBondContact O-CG 3.2Å; N55-K59 PolarHBondContact O-N 3.03Å; N55-K59 VanDerWaalsContact O-N 3.1Å; N55-K59 WeakPolarHBondContact OD1-CE 3.47Å; N55-K59 PolarHBondContact OD1-NZ 2.96Å
56	T	94.1	Very high	87.7	Confident	78 Å²	78	100.2 Å²	100.2	48%	0.479	54%	0.537	S	S	.	.	H	α-helix	trans	-66.7	-39.5	179.1	52	0	0	0	0	111.4	C52 M53 K59 E60	C52-T56 PolarHBondContact O-N 2.91Å; C52-T56 PolarHBondContact O-OG1 3.44Å; M53-T56 WeakPolarHBondContact CA-OG1 3.23Å; M53-T56 PolarHBondContact O-N 3.48Å; M53-T56 PolarHBondContact O-OG1 3.15Å; T56-K59 PolarHBondContact O-N 3.47Å; T56-E60 WeakPolarHBondContact O-CB 3.36Å; T56-E60 PolarHBondContact O-N 3.1Å
57	F	93.9	Very high	86.3	Confident	96 Å²	96	99.6 Å²	99.6	42%	0.421	55%	0.545	S	S	.	.	H	α-helix	trans	-63.7	-41.7	177.9	-179.4	-103.7	0	0	0	112.7	M53 L54 E60 K61	M53-F57 VanDerWaalsContact O-CB 3.23Å; M53-F57 WeakPolarHBondContact O-CB 3.43Å; M53-F57 PolarHBondContact O-N 3.21Å; L54-F57 PolarHBondContact O-N 2.9Å; F57-E60 PolarHBondContact O-N 3.06Å; F57-K61 HydrophobicContact CE1-CD 3.93Å; F57-K61 HydrophobicContact CZ-CD 4.12Å; F57-K61 PolarHBondContact O-N 3.19Å; F57-K61 VanDerWaalsContact O-N 3.12Å
58	L	93.3	Very high	85.2	Confident	102 Å²	102	97.8 Å²	97.8	53%	0.534	53%	0.533	S	S	.	.	H	α-helix	trans	-65.5	-42.4	175.9	-70.3	172	0	0	0	111.5	L54 N55 K61 E62	L54-L58 HydrophobicContact CD1-CD1 4.24Å; L54-L58 HydrophobicContact CD1-CG 4.25Å; L54-L58 HydrophobicContact CG-CD1 4.11Å; L54-L58 VanDerWaalsContact O-CG 3.29Å; L54-L58 WeakPolarHBondContact O-CG 3.46Å; L54-L58 PolarHBondContact O-N 3.28Å; N55-L58 PolarHBondContact O-N 3.34Å; L58-K61 PolarHBondContact O-N 3.5Å; L58-E62 PolarHBondContact O-N 3.1Å; L58-E62 VanDerWaalsContact O-N 3.14Å
59	K	88.7	Confident	84.3	Confident	102 Å²	102	100.8 Å²	100.8	44%	0.443	55%	0.546	S	S	.	.	H	α-helix	trans	-65.7	-40.3	175.9	-76.2	175.4	172.6	162.5	0	112.8	N55 T56 K61 E62 H63	N55-K59 WeakPolarHBondContact O-CG 3.2Å; N55-K59 PolarHBondContact O-N 3.03Å; N55-K59 VanDerWaalsContact O-N 3.1Å; N55-K59 WeakPolarHBondContact OD1-CE 3.47Å; N55-K59 PolarHBondContact OD1-NZ 2.96Å; T56-K59 PolarHBondContact O-N 3.47Å; K59-K61 VanDerWaalsContact C-N 3.28Å; K59-K61 PolarHBondContact O-N 2.82Å; K59-E62 PolarHBondContact O-N 3.12Å; K59-E62 VanDerWaalsContact O-N 3.13Å; K59-H63 WeakPolarHBondContact O-CB 3.38Å; K59-H63 PolarHBondContact O-CD2 3.11Å; K59-H63 PolarHBondContact O-N 3.42Å
60	E	86.9	Confident	83.6	Confident	132 Å²	132	105 Å²	105	62%	0.617	56%	0.56	S	S	*	*	H	α-helix	trans	-60.4	-41	176	-176.7	-174.6	-172.6	0	0	111.1	T56 F57 E62 H63 S64	T56-E60 WeakPolarHBondContact O-CB 3.36Å; T56-E60 PolarHBondContact O-N 3.1Å; F57-E60 PolarHBondContact O-N 3.06Å; E60-E62 VanDerWaalsContact C-N 3.32Å; E60-E62 PolarHBondContact O-N 3Å; E60-H63 PolarHBondContact O-N 3.5Å; E60-S64 PolarHBondContact O-N 3.46Å
61	K	83.3	Confident	83.1	Confident	133 Å²	133	104.9 Å²	104.9	58%	0.578	55%	0.549	S	S	*	.	H	α-helix	trans	-63.7	-35.7	173.8	-79.1	-169.8	156.6	-172.9	0	113.1	F57 L58 K59 S64	F57-K61 HydrophobicContact CE1-CD 3.93Å; F57-K61 HydrophobicContact CZ-CD 4.12Å; F57-K61 PolarHBondContact O-N 3.19Å; F57-K61 VanDerWaalsContact O-N 3.12Å; L58-K61 PolarHBondContact O-N 3.5Å; K59-K61 VanDerWaalsContact C-N 3.28Å; K59-K61 PolarHBondContact O-N 2.82Å; K61-S64 WeakPolarHBondContact O-CB 3.38Å; K61-S64 PolarHBondContact O-OG 3.32Å
62	E	81.7	Confident	82.7	Confident	155 Å²	155	102.7 Å²	102.7	72%	0.724	54%	0.536	S	S	*	.	H	α-helix	trans	-70.7	-37.9	174.9	-167.4	174.2	-179.1	0	0	111.6	L58 K59 E60 S64	L58-E62 PolarHBondContact O-N 3.1Å; L58-E62 VanDerWaalsContact O-N 3.14Å; K59-E62 PolarHBondContact O-N 3.12Å; K59-E62 VanDerWaalsContact O-N 3.13Å; E60-E62 VanDerWaalsContact C-N 3.32Å; E60-E62 PolarHBondContact O-N 3Å; E62-S64 PolarHBondContact O-N 3.32Å; E62-S64 VanDerWaalsContact O-N 3.16Å
63	H	69.6	Low	82.3	Confident	129 Å²	129	103.2 Å²	103.2	60%	0.597	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.5	10.1	178	-72.1	-50.1	0	0	0	115.1	K59 E60 H65	K59-H63 WeakPolarHBondContact O-CB 3.38Å; K59-H63 PolarHBondContact O-CD2 3.11Å; K59-H63 PolarHBondContact O-N 3.42Å; E60-H63 PolarHBondContact O-N 3.5Å; H63-H65 PolarHBondContact O-N 2.99Å
64	S	57.4	Low	82	Confident	65 Å²	65	103.5 Å²	103.5	46%	0.455	53%	0.534	S	S	.	.	S	Bend	trans	-80.7	-7.1	-163.2	56.5	0	0	0	0	116.2	E60 K61 E62	E60-S64 PolarHBondContact O-N 3.46Å; K61-S64 WeakPolarHBondContact O-CB 3.38Å; K61-S64 PolarHBondContact O-OG 3.32Å; E62-S64 PolarHBondContact O-N 3.32Å; E62-S64 VanDerWaalsContact O-N 3.16Å
65	H	55.5	Low	81.7	Confident	166 Å²	166	105 Å²	105	77%	0.769	55%	0.547	S	S	*	.			trans	-149.5	19.4	-172.8	-68.2	-75.1	0	0	0	116.1	H63 A67	H63-H65 PolarHBondContact O-N 2.99Å; H65-A67 PolarHBondContact O-N 3.41Å
66	D	63.3	Low	81.5	Confident	123 Å²	123	107.3 Å²	107.3	66%	0.658	56%	0.555	S	S	*	*	P	Polyproline II helix	trans	-69.5	119.9	173.1	-66.9	-30.2	0	0	0	108.7
67	A	68.7	Low	81.4	Confident	81 Å²	81	106.9 Å²	106.9	67%	0.669	55%	0.549	S	S	*	.	P	Polyproline II helix	trans	-53.3	138.7	171.8	0	0	0	0	0	108.6	H65	H65-A67 PolarHBondContact O-N 3.41Å
68	P	72.8	Confident	81.3	Confident	22 Å²	22	106.1 Å²	106.1	14%	0.143	54%	0.544	C	S	.	.	P	Polyproline II helix	trans	-53.8	141.6	177.4	22	-32.3	0	0	0	109.6	H98 Y106	P68-H98 WeakPolarHBondContact CB-O 3.42Å; P68-H98 WeakPolarHBondContact CG-O 3.48Å; P68-Y106 HydrophobicContact CB-CD1 4.34Å; P68-Y106 HydrophobicContact CB-CE1 3.7Å; P68-Y106 HydrophobicContact CB-CE2 4.28Å; P68-Y106 HydrophobicContact CG-CE1 4.35Å
69	P	80	Confident	81.3	Confident	98 Å²	98	106.3 Å²	106.3	64%	0.636	54%	0.544	S	S	*	.	P	Polyproline II helix	trans	-58.6	153.1	179.6	26.6	-34.7	0	0	0	110.1	F71 Y106	P69-F71 PolarHBondContact O-N 3.35Å; P69-Y106 VanDerWaalsContact O-CE2 3.32Å; P69-Y106 WeakPolarHBondContact O-CE2 3.33Å
70	E	82.9	Confident	81.4	Confident	176 Å²	176	105.3 Å²	105.3	82%	0.822	54%	0.538	S	S	*	.	P	Polyproline II helix	trans	-52.3	136.3	177.7	-173.1	-178.8	170	0	0	111.2	V72	E70-V72 PolarHBondContact O-N 3.23Å; E70-V72 VanDerWaalsContact O-N 3.15Å
71	F	87.2	Confident	81.7	Confident	56 Å²	56	105.8 Å²	105.8	25%	0.246	55%	0.55	C	S	.	.			trans	-71.6	111.2	-180	177.9	-105.8	0	0	0	110.9	P69 P73 A101 L102 Y106	P69-F71 PolarHBondContact O-N 3.35Å; F71-P73 HydrophobicContact CE1-CB 3.85Å; F71-P73 HydrophobicContact CE1-CG 4.35Å; F71-P73 HydrophobicContact CZ-CB 4.02Å; F71-A101 HydrophobicContact CD2-CB 3.38Å; F71-A101 HydrophobicContact CE2-CB 3.55Å; F71-L102 VanDerWaalsContact CE2-O 3.29Å; F71-L102 WeakPolarHBondContact CE2-O 3.32Å; F71-L102 WeakPolarHBondContact CZ-O 3.05Å; F71-Y106 HydrophobicContact CB-CD2 3.9Å; F71-Y106 HydrophobicContact CB-CE2 4.02Å; F71-Y106 HydrophobicContact CD2-CE2 4.46Å
72	V	88.9	Confident	82.2	Confident	58 Å²	58	107.7 Å²	107.7	35%	0.352	56%	0.558	S	S	.	*			trans	-109.8	120.1	169	-176.2	0	0	0	0	109.3	E70 Y74 R78	E70-V72 PolarHBondContact O-N 3.23Å; E70-V72 VanDerWaalsContact O-N 3.15Å; V72-Y74 HydrophobicContact CB-CD2 4.02Å; V72-Y74 HydrophobicContact CB-CE2 3.59Å; V72-Y74 HydrophobicContact CG1-CD1 4.15Å; V72-Y74 HydrophobicContact CG1-CD2 3.99Å; V72-Y74 HydrophobicContact CG1-CE1 3.8Å; V72-Y74 HydrophobicContact CG1-CE2 3.65Å; V72-Y74 HydrophobicContact CG1-CG 4.24Å; V72-Y74 HydrophobicContact CG2-CE2 4.46Å; V72-Y74 WeakPolarHBondContact O-CD2 3.29Å; V72-Y74 PolarHBondContact O-N 3.15Å; V72-R78 PolarHBondContact O-NH1 2.86Å
73	P	89.8	Confident	82.7	Confident	94 Å²	94	109.4 Å²	109.4	61%	0.61	56%	0.558	S	S	*	*			trans	-78.5	68.6	-178.1	32.3	-35.6	0	0	0	111.2	F71 T75	F71-P73 HydrophobicContact CE1-CB 3.85Å; F71-P73 HydrophobicContact CE1-CG 4.35Å; F71-P73 HydrophobicContact CZ-CB 4.02Å; P73-T75 PolarHBondContact O-N 2.89Å
74	Y	90.6	Very high	83.9	Confident	127 Å²	127	106 Å²	106	50%	0.498	54%	0.542	S	S	.	.			trans	-62.5	130.7	173.7	-67.4	-69	0	0	0	111.1	V72 H76 L77	V72-Y74 HydrophobicContact CB-CD2 4.02Å; V72-Y74 HydrophobicContact CB-CE2 3.59Å; V72-Y74 HydrophobicContact CG1-CD1 4.15Å; V72-Y74 HydrophobicContact CG1-CD2 3.99Å; V72-Y74 HydrophobicContact CG1-CE1 3.8Å; V72-Y74 HydrophobicContact CG1-CE2 3.65Å; V72-Y74 HydrophobicContact CG1-CG 4.24Å; V72-Y74 HydrophobicContact CG2-CE2 4.46Å; V72-Y74 WeakPolarHBondContact O-CD2 3.29Å; V72-Y74 PolarHBondContact O-N 3.15Å; Y74-H76 AromaticContact CG-CE1 3.98Å; Y74-H76 PolarHBondContact O-N 3.39Å; Y74-H76 VanDerWaalsContact O-N 3.1Å; Y74-L77 HydrophobicContact CD2-CD1 3.8Å; Y74-L77 HydrophobicContact CG-CD1 4.31Å; Y74-L77 PolarHBondContact O-N 3.05Å
75	T	91.1	Very high	85.8	Confident	133 Å²	133	108.5 Å²	108.5	82%	0.816	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.2	-22.8	-175.6	54.9	0	0	0	0	114.6	P73	P73-T75 PolarHBondContact O-N 2.89Å
76	H	92.4	Very high	87.6	Confident	128 Å²	128	105.5 Å²	105.5	59%	0.593	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.8	-11	179.1	64.5	-85.9	0	0	0	113.4	Y74	Y74-H76 AromaticContact CG-CE1 3.98Å; Y74-H76 PolarHBondContact O-N 3.39Å; Y74-H76 VanDerWaalsContact O-N 3.1Å
77	L	92.5	Very high	89	Confident	68 Å²	68	103.6 Å²	103.6	36%	0.356	55%	0.548	S	S	.	.	S	Bend	trans	-100.5	151.7	179.4	-60.5	-178.5	0	0	0	110.5	Y74 I79	Y74-L77 HydrophobicContact CD2-CD1 3.8Å; Y74-L77 HydrophobicContact CG-CD1 4.31Å; Y74-L77 PolarHBondContact O-N 3.05Å; L77-I79 PolarHBondContact O-N 3.4Å
78	R	91.8	Very high	90	Very high	81 Å²	81	103.2 Å²	103.2	31%	0.306	53%	0.534	S	S	.	.	S	Bend	trans	53.1	29	175.2	-51.8	105	-171.3	176.9	-3.8	114.8	V72 R80 P103	V72-R78 PolarHBondContact O-NH1 2.86Å; R78-R80 PolarHBondContact O-N 3.32Å; R78-P103 HydrophobicContact CB-CG 4.34Å; R78-P103 WeakPolarHBondContact O-CG 3.34Å
79	I	91.4	Very high	90.9	Very high	106 Å²	106	102.4 Å²	102.4	54%	0.544	53%	0.53	S	S	.	.			trans	-59.7	137.8	174.5	-59.5	170.3	0	0	0	109.9	L77 T81	L77-I79 PolarHBondContact O-N 3.4Å; I79-T81 HydrophobicContact CG2-CG2 3.96Å
80	R	91.3	Very high	91.5	Very high	81 Å²	81	99.7 Å²	99.7	31%	0.306	51%	0.51	S	S	.	.			trans	-130.1	92.5	176.1	-62.4	-65.4	-177.4	-97.9	0.1	109.8	R78 N90 P103	R78-R80 PolarHBondContact O-N 3.32Å; R80-N90 PolarHBondContact NE-O 3.46Å; R80-N90 VanDerWaalsContact NE-O 3.11Å; R80-N90 PolarHBondContact NH2-O 3.13Å; R80-P103 HydrophobicContact CG-CG 3.9Å
81	T	93.4	Very high	92	Very high	141 Å²	141	94.2 Å²	94.2	87%	0.865	48%	0.483	S	S	*	.	S	Bend	trans	-83.5	-29.2	176.1	53	0	0	0	0	112.6	I79	I79-T81 HydrophobicContact CG2-CG2 3.96Å
82	K	93.3	Very high	92.3	Very high	173 Å²	173	94.1 Å²	94.1	75%	0.752	49%	0.487	S	S	*	.	S	Bend	trans	-141.7	148.8	175.4	-172.3	179.9	177.2	-179.9	0	109.2
83	R	93.8	Very high	92.5	Very high	191 Å²	191	96.8 Å²	96.8	72%	0.721	50%	0.499	S	S	*	.			trans	-66.7	142.9	173.4	-68.2	-178.2	-179.2	-101.4	-0.1	111.3	D88 G89	R83-D88 PolarHBondContact NH1-O 3.1Å; R83-G89 WeakPolarHBondContact CA-O 3.45Å
84	F	94.9	Very high	92.7	Very high	59 Å²	59	100.7 Å²	100.7	26%	0.259	51%	0.507	S	S	.	.			trans	-66.2	151	171.2	-61.5	-60.5	0	0	0	111.2	W86 G89 K91 T92	F84-W86 HydrophobicContact CB-CD2 4.16Å; F84-W86 HydrophobicContact CB-CH2 4.36Å; F84-W86 HydrophobicContact CB-CZ2 3.82Å; F84-W86 HydrophobicContact CD1-CH2 4.17Å; F84-W86 AromaticContact CD1-CZ2 3.89Å; F84-W86 HydrophobicContact CD1-CZ2 3.89Å; F84-W86 HydrophobicContact CG-CH2 4.48Å; F84-W86 AromaticContact CG-CZ2 3.85Å; F84-W86 HydrophobicContact CG-CZ2 3.85Å; F84-W86 PolarHBondContact O-N 3.1Å; F84-W86 VanDerWaalsContact O-N 3.15Å; F84-G89 WeakPolarHBondContact CD2-O 3.48Å; F84-G89 PolarHBondContact N-O 3.14Å; F84-G89 WeakPolarHBondContact O-CA 3.29Å; F84-K91 WeakPolarHBondContact CD2-O 3.34Å; F84-T92 HydrophobicContact CE2-CG2 4.11Å; F84-T92 HydrophobicContact CZ-CG2 4.11Å
85	P	96.1	Very high	92.9	Very high	117 Å²	117	96.9 Å²	96.9	76%	0.76	49%	0.493	S	S	*	.	S	Bend	trans	-80.3	18	-177.4	32.8	-34.8	0	0	0	114.3
86	W	94.2	Very high	92.8	Very high	103 Å²	103	94.2 Å²	94.2	39%	0.39	47%	0.474	S	S	.	.	S	Bend	trans	-139.7	160.6	178.4	55.5	76.8	0	0	0	110.9	F84 D88 G89 K91 L93	F84-W86 HydrophobicContact CB-CD2 4.16Å; F84-W86 HydrophobicContact CB-CH2 4.36Å; F84-W86 HydrophobicContact CB-CZ2 3.82Å; F84-W86 HydrophobicContact CD1-CH2 4.17Å; F84-W86 AromaticContact CD1-CZ2 3.89Å; F84-W86 HydrophobicContact CD1-CZ2 3.89Å; F84-W86 HydrophobicContact CG-CH2 4.48Å; F84-W86 AromaticContact CG-CZ2 3.85Å; F84-W86 HydrophobicContact CG-CZ2 3.85Å; F84-W86 PolarHBondContact O-N 3.1Å; F84-W86 VanDerWaalsContact O-N 3.15Å; W86-D88 PolarHBondContact O-N 3.38Å; W86-G89 PolarHBondContact O-N 3.27Å; W86-K91 PolarHBondContact NE1-O 3.43Å; W86-L93 HydrophobicContact CD2-CD1 4.47Å; W86-L93 HydrophobicContact CH2-CB 4.43Å; W86-L93 HydrophobicContact CZ2-CB 3.92Å
87	G	91.5	Very high	92.6	Very high	83 Å²	83	91 Å²	91	86%	0.856	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.7	-135	176	0	0	0	0	0	113.1	G89	G87-G89 VanDerWaalsContact C-N 3.26Å
88	D	89.6	Confident	92.2	Very high	72 Å²	72	92.6 Å²	92.6	39%	0.385	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.1	-4.7	175.6	61.9	1.4	0	0	0	113.6	R83 W86 N90 K91	R83-D88 PolarHBondContact NH1-O 3.1Å; W86-D88 PolarHBondContact O-N 3.38Å; D88-N90 PolarHBondContact O-N 2.89Å; D88-N90 PolarHBondContact OD1-N 3.38Å; D88-K91 PolarHBondContact OD1-N 3.14Å; D88-K91 VanDerWaalsContact OD1-N 3.15Å; D88-K91 IonicContact OD2-NZ 2.73Å; D88-K91 PolarHBondContact OD2-NZ 3.35Å
89	G	92.8	Very high	91.9	Very high	5 Å²	5	92 Å²	92	5%	0.052	48%	0.477	C	S	.	.	S	Bend	trans	74.8	4.5	-175.6	0	0	0	0	0	114.9	R83 F84 W86 G87	R83-G89 WeakPolarHBondContact CA-O 3.45Å; F84-G89 WeakPolarHBondContact CD2-O 3.48Å; F84-G89 PolarHBondContact N-O 3.14Å; F84-G89 WeakPolarHBondContact O-CA 3.29Å; W86-G89 PolarHBondContact O-N 3.27Å; G87-G89 VanDerWaalsContact C-N 3.26Å
90	N	91.8	Very high	91.8	Very high	41 Å²	41	90 Å²	90	22%	0.219	47%	0.467	C	S	.	.	S	Bend	trans	-106.4	-33.7	-178.8	-161.6	21.3	0	0	0	112.5	R80 D88	R80-N90 PolarHBondContact NE-O 3.46Å; R80-N90 VanDerWaalsContact NE-O 3.11Å; R80-N90 PolarHBondContact NH2-O 3.13Å; D88-N90 PolarHBondContact O-N 2.89Å; D88-N90 PolarHBondContact OD1-N 3.38Å
91	K	93.6	Very high	91.8	Very high	62 Å²	62	86.5 Å²	86.5	27%	0.27	46%	0.455	S	S	.	.	S	Bend	trans	-82.6	135.9	-179.8	-65.8	174.5	176.5	64.6	0	112.3	F84 W86 D88 H95 L102 E107	F84-K91 WeakPolarHBondContact CD2-O 3.34Å; W86-K91 PolarHBondContact NE1-O 3.43Å; D88-K91 PolarHBondContact OD1-N 3.14Å; D88-K91 VanDerWaalsContact OD1-N 3.15Å; D88-K91 IonicContact OD2-NZ 2.73Å; D88-K91 PolarHBondContact OD2-NZ 3.35Å; K91-H95 HydrophobicContact CB-CB 3.95Å; K91-H95 HydrophobicContact CG-CB 4.46Å; K91-L102 HydrophobicContact CG-CD2 4.22Å; K91-E107 WeakPolarHBondContact CE-OE1 3.27Å; K91-E107 WeakPolarHBondContact CE-OE2 3.47Å; K91-E107 IonicContact NZ-OE1 3.35Å; K91-E107 PolarHBondContact NZ-OE1 2.63Å; K91-E107 IonicContact NZ-OE2 3.99Å
92	T	92.9	Very high	91.6	Very high	53 Å²	53	80.2 Å²	80.2	33%	0.325	42%	0.416	S	S	.	.			trans	-67.3	163.4	173.4	54.5	0	0	0	0	111.2	F84 F94 H95	F84-T92 HydrophobicContact CE2-CG2 4.11Å; F84-T92 HydrophobicContact CZ-CG2 4.11Å; T92-F94 VanDerWaalsContact C-N 3.27Å; T92-F94 PolarHBondContact O-N 3.36Å; T92-H95 WeakPolarHBondContact O-CB 3.47Å; T92-H95 PolarHBondContact O-N 2.81Å
93	L	94.2	Very high	91.4	Very high	115 Å²	115	74.8 Å²	74.8	60%	0.602	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.8	-39.2	-179.6	-173	65.3	0	0	0	113.1	W86	W86-L93 HydrophobicContact CD2-CD1 4.47Å; W86-L93 HydrophobicContact CH2-CB 4.43Å; W86-L93 HydrophobicContact CZ2-CB 3.92Å
94	F	94.6	Very high	91	Very high	176 Å²	176	71.8 Å²	71.8	77%	0.772	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-108.5	55	175	-56.5	-67.7	0	0	0	110.5	T92 N100	T92-F94 VanDerWaalsContact C-N 3.27Å; T92-F94 PolarHBondContact O-N 3.36Å; F94-N100 PolarHBondContact O-ND2 2.73Å
95	H	93	Very high	90.7	Very high	46 Å²	46	69.4 Å²	69.4	21%	0.213	39%	0.39	C	S	.	.			trans	-73.1	135.5	176	-172.5	66.5	0	0	0	111.2	K91 T92 N100 E107	K91-H95 HydrophobicContact CB-CB 3.95Å; K91-H95 HydrophobicContact CG-CB 4.46Å; T92-H95 WeakPolarHBondContact O-CB 3.47Å; T92-H95 PolarHBondContact O-N 2.81Å; H95-N100 PolarHBondContact CE1-O 3.16Å; H95-E107 IonicContact CD2-OE1 3.8Å; H95-E107 IonicContact CE1-OE1 3.62Å; H95-E107 IonicContact NE2-OE1 2.85Å; H95-E107 PolarHBondContact NE2-OE1 3.47Å; H95-E107 IonicContact NE2-OE2 3.51Å
96	N	90.6	Very high	90.2	Very high	78 Å²	78	65.5 Å²	65.5	42%	0.417	36%	0.36	S	S	.	.			trans	-129.5	111.8	174.1	177	-8.5	0	0	0	107.3	H98 V99 N100	N96-H98 PolarHBondContact O-N 3.14Å; N96-H98 VanDerWaalsContact O-N 3.14Å; N96-H98 WeakPolarHBondContact OD1-CB 2.96Å; N96-H98 PolarHBondContact OD1-N 3.1Å; N96-H98 VanDerWaalsContact OD1-N 3.1Å; N96-V99 HydrophobicContact CB-CG2 3.8Å; N96-V99 PolarHBondContact O-N 2.86Å; N96-N100 PolarHBondContact N-ND2 2.85Å; N96-N100 WeakPolarHBondContact O-CB 3.3Å; N96-N100 PolarHBondContact O-N 3.18Å
97	S	88.4	Confident	89.6	Confident	59 Å²	59	63.5 Å²	63.5	41%	0.413	36%	0.355	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.5	-29.1	-174.9	50.8	0	0	0	0	113.3
98	H	82.4	Confident	88.5	Confident	103 Å²	103	63.3 Å²	63.3	48%	0.477	35%	0.353	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.7	-30	-178	-174.2	-100	0	0	0	113.6	P68 N96	P68-H98 WeakPolarHBondContact CB-O 3.42Å; P68-H98 WeakPolarHBondContact CG-O 3.48Å; N96-H98 PolarHBondContact O-N 3.14Å; N96-H98 VanDerWaalsContact O-N 3.14Å; N96-H98 WeakPolarHBondContact OD1-CB 2.96Å; N96-H98 PolarHBondContact OD1-N 3.1Å; N96-H98 VanDerWaalsContact OD1-N 3.1Å
99	V	86	Confident	86.9	Confident	69 Å²	69	64 Å²	64	42%	0.418	35%	0.354	S	S	.	.	T	Hydrogen-bonded Turn	trans	-125.1	-20.4	-170.7	-57.6	0	0	0	0	114	N96 Y106	N96-V99 HydrophobicContact CB-CG2 3.8Å; N96-V99 PolarHBondContact O-N 2.86Å; V99-Y106 VanDerWaalsContact C-CE1 3.47Å; V99-Y106 WeakPolarHBondContact O-CE1 2.99Å; V99-Y106 PolarHBondContact O-OH 3.16Å
100	N	90	Very high	84.8	Confident	63 Å²	63	71 Å²	71	34%	0.337	39%	0.39	S	S	.	.			trans	-105.4	101	-178.9	-63.9	-26.2	0	0	0	110	F94 H95 N96	F94-N100 PolarHBondContact O-ND2 2.73Å; H95-N100 PolarHBondContact CE1-O 3.16Å; N96-N100 PolarHBondContact N-ND2 2.85Å; N96-N100 WeakPolarHBondContact O-CB 3.3Å; N96-N100 PolarHBondContact O-N 3.18Å
101	A	90.2	Very high	82.6	Confident	7 Å²	7	76.6 Å²	76.6	6%	0.058	41%	0.409	C	S	.	.			trans	-68	142.6	171	0	0	0	0	0	111.8	F71 Y106	F71-A101 HydrophobicContact CD2-CB 3.38Å; F71-A101 HydrophobicContact CE2-CB 3.55Å; A101-Y106 HydrophobicContact CB-CD1 4.06Å; A101-Y106 HydrophobicContact CB-CD2 3.96Å; A101-Y106 HydrophobicContact CB-CE1 4.01Å; A101-Y106 HydrophobicContact CB-CE2 3.88Å; A101-Y106 HydrophobicContact CB-CG 4.02Å
102	L	90.9	Very high	80	Confident	9 Å²	9	78.6 Å²	78.6	5%	0.047	43%	0.426	C	S	.	.	B	Isolated β-bridge	trans	-78.7	173	165.1	-68.4	-176.3	0	0	0	110.7	F71 K91 D104 G105 E107	F71-L102 VanDerWaalsContact CE2-O 3.29Å; F71-L102 WeakPolarHBondContact CE2-O 3.32Å; F71-L102 WeakPolarHBondContact CZ-O 3.05Å; K91-L102 HydrophobicContact CG-CD2 4.22Å; L102-D104 WeakPolarHBondContact CB-OD1 3.37Å; L102-D104 PolarHBondContact O-N 3.38Å; L102-D104 VanDerWaalsContact O-N 3.14Å; L102-G105 PolarHBondContact N-O 3.35Å; L102-G105 PolarHBondContact O-N 3.15Å; L102-G105 VanDerWaalsContact O-N 3.1Å; L102-E107 HydrophobicContact CD1-CG 3.98Å; L102-E107 WeakPolarHBondContact CD1-OE1 3.33Å; L102-E107 HydrophobicContact CG-CG 4.34Å; L102-E107 VanDerWaalsContact CG-OE1 3.3Å; L102-E107 WeakPolarHBondContact CG-OE1 3.32Å
103	P	88.5	Confident	77.7	Confident	59 Å²	59	78.7 Å²	78.7	38%	0.383	43%	0.429	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57	-24.5	174.9	-24.2	35.2	0	0	0	114	R78 R80	R78-P103 HydrophobicContact CB-CG 4.34Å; R78-P103 WeakPolarHBondContact O-CG 3.34Å; R80-P103 HydrophobicContact CG-CG 3.9Å
104	D	85.6	Confident	75.3	Confident	128 Å²	128	76.9 Å²	76.9	68%	0.684	42%	0.42	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.2	-6	179.4	52	-40.6	0	0	0	114.2	L102	L102-D104 WeakPolarHBondContact CB-OD1 3.37Å; L102-D104 PolarHBondContact O-N 3.38Å; L102-D104 VanDerWaalsContact O-N 3.14Å
105	G	87	Confident	73.1	Confident	10 Å²	10	72.4 Å²	72.4	10%	0.103	41%	0.406	C	S	.	.	B	Isolated β-bridge	trans	126.8	-170	177.6	0	0	0	0	0	114.3	L102	L102-G105 PolarHBondContact N-O 3.35Å; L102-G105 PolarHBondContact O-N 3.15Å; L102-G105 VanDerWaalsContact O-N 3.1Å
106	Y	87.4	Confident	70.7	Confident	35 Å²	35	78 Å²	78	14%	0.137	43%	0.426	C	S	.	.			trans	-78.9	140.1	175.3	-75.8	-85.1	0	0	0	111.5	P68 P69 F71 V99 A101 G108 H109	P68-Y106 HydrophobicContact CB-CD1 4.34Å; P68-Y106 HydrophobicContact CB-CE1 3.7Å; P68-Y106 HydrophobicContact CB-CE2 4.28Å; P68-Y106 HydrophobicContact CG-CE1 4.35Å; P69-Y106 VanDerWaalsContact O-CE2 3.32Å; P69-Y106 WeakPolarHBondContact O-CE2 3.33Å; F71-Y106 HydrophobicContact CB-CD2 3.9Å; F71-Y106 HydrophobicContact CB-CE2 4.02Å; F71-Y106 HydrophobicContact CD2-CE2 4.46Å; V99-Y106 VanDerWaalsContact C-CE1 3.47Å; V99-Y106 WeakPolarHBondContact O-CE1 2.99Å; V99-Y106 PolarHBondContact O-OH 3.16Å; A101-Y106 HydrophobicContact CB-CD1 4.06Å; A101-Y106 HydrophobicContact CB-CD2 3.96Å; A101-Y106 HydrophobicContact CB-CE1 4.01Å; A101-Y106 HydrophobicContact CB-CE2 3.88Å; A101-Y106 HydrophobicContact CB-CG 4.02Å; Y106-G108 PolarHBondContact O-N 3.18Å; Y106-H109 WeakPolarHBondContact CB-CD2 3.44Å
107	E	80.4	Confident	68.5	Low	61 Å²	61	77.5 Å²	77.5	29%	0.285	42%	0.423	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.5	119.6	176.1	-66.6	173.5	-156.5	0	0	109.5	K91 H95 L102	K91-E107 WeakPolarHBondContact CE-OE1 3.27Å; K91-E107 WeakPolarHBondContact CE-OE2 3.47Å; K91-E107 IonicContact NZ-OE1 3.35Å; K91-E107 PolarHBondContact NZ-OE1 2.63Å; K91-E107 IonicContact NZ-OE2 3.99Å; H95-E107 IonicContact CD2-OE1 3.8Å; H95-E107 IonicContact CE1-OE1 3.62Å; H95-E107 IonicContact NE2-OE1 2.85Å; H95-E107 PolarHBondContact NE2-OE1 3.47Å; H95-E107 IonicContact NE2-OE2 3.51Å; L102-E107 HydrophobicContact CD1-CG 3.98Å; L102-E107 WeakPolarHBondContact CD1-OE1 3.33Å; L102-E107 HydrophobicContact CG-CG 4.34Å; L102-E107 VanDerWaalsContact CG-OE1 3.3Å; L102-E107 WeakPolarHBondContact CG-OE1 3.32Å
108	G	69	Low	66.7	Low	79 Å²	79	78.7 Å²	78.7	81%	0.814	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	98.2	8.2	175.1	0	0	0	0	0	116.2	Y106 D110	Y106-G108 PolarHBondContact O-N 3.18Å; G108-D110 PolarHBondContact O-N 3.31Å
109	H	55.7	Low	65.4	Low	86 Å²	86	82.4 Å²	82.4	40%	0.398	46%	0.46	S	S	.	.			trans	-88.7	81	167.4	-72.2	-102.8	0	0	0	110	Y106 Y111	Y106-H109 WeakPolarHBondContact CB-CD2 3.44Å; H109-Y111 WeakPolarHBondContact O-CD1 3.16Å; H109-Y111 WeakPolarHBondContact O-CE1 3.21Å; H109-Y111 PolarHBondContact O-N 3.1Å; H109-Y111 VanDerWaalsContact O-N 3.1Å
110	D	48.7	Very low	63.7	Low	153 Å²	153	83.4 Å²	83.4	82%	0.818	46%	0.462	S	S	*	.			trans	-66.5	102.9	152.7	-78.6	-36	0	0	0	106.5	G108 T112	G108-D110 PolarHBondContact O-N 3.31Å; D110-T112 VanDerWaalsContact C-N 3.35Å; D110-T112 PolarHBondContact O-N 2.83Å
111	Y	44.4	Very low	62	Low	157 Å²	157	90.5 Å²	90.5	62%	0.616	49%	0.485	S	S	*	.			trans	-64.7	90.7	-177.9	-3.6	-93.8	0	0	0	110	H109 C113	H109-Y111 WeakPolarHBondContact O-CD1 3.16Å; H109-Y111 WeakPolarHBondContact O-CE1 3.21Å; H109-Y111 PolarHBondContact O-N 3.1Å; H109-Y111 VanDerWaalsContact O-N 3.1Å; Y111-C113 VanDerWaalsContact CB-SG 3.58Å; Y111-C113 PolarHBondContact O-N 3.28Å
112	T	40.5	Very low	60.2	Low	104 Å²	104	98 Å²	98	64%	0.638	51%	0.511	S	S	*	.			trans	-81.4	85.5	140.7	32.8	0	0	0	0	106.5	D110 L114 L126	D110-T112 VanDerWaalsContact C-N 3.35Å; D110-T112 PolarHBondContact O-N 2.83Å; T112-L114 PolarHBondContact O-N 2.83Å; T112-L126 HydrophobicContact CG2-CD2 3.74Å
113	C	43.7	Very low	58.4	Low	56 Å²	56	102.6 Å²	102.6	38%	0.378	54%	0.535	S	S	.	.			trans	-65.3	86	167.5	-64.5	0	0	0	0	108.1	Y111 V115	Y111-C113 VanDerWaalsContact CB-SG 3.58Å; Y111-C113 PolarHBondContact O-N 3.28Å; C113-V115 VanDerWaalsContact C-N 3.31Å; C113-V115 PolarHBondContact O-N 3.04Å
114	L	45.3	Very low	56.5	Low	77 Å²	77	104.2 Å²	104.2	40%	0.403	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.1	92.1	165.8	-65.1	180	0	0	0	107.2	T112 W116 I123 L126	T112-L114 PolarHBondContact O-N 2.83Å; L114-W116 PolarHBondContact O-N 3.01Å; L114-I123 HydrophobicContact CD1-CD1 4.43Å; L114-I123 HydrophobicContact CD2-CD1 4.2Å; L114-I123 HydrophobicContact CD2-CG1 4.33Å; L114-I123 HydrophobicContact CD2-CG2 3.64Å; L114-L126 HydrophobicContact CD2-CD2 4.2Å
115	V	47.1	Very low	54.8	Low	82 Å²	82	104.5 Å²	104.5	50%	0.497	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.6	106.3	166.3	178.3	0	0	0	0	107.3	C113 D117	C113-V115 VanDerWaalsContact C-N 3.31Å; C113-V115 PolarHBondContact O-N 3.04Å; V115-D117 PolarHBondContact O-N 3.07Å
116	W	42.3	Very low	52.8	Low	163 Å²	163	110 Å²	110	62%	0.617	56%	0.562	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-81.4	109.5	172	-92.2	82.1	0	0	0	109.1	L114 G118 R121	L114-W116 PolarHBondContact O-N 3.01Å; W116-G118 PolarHBondContact O-N 3.34Å; W116-R121 HydrophobicContact CZ3-CB 3.95Å; W116-R121 HydrophobicContact CZ3-CG 4.06Å
117	D	45.8	Very low	50.9	Low	68 Å²	68	113 Å²	113	36%	0.364	58%	0.579	S	S	.	*			trans	-73.7	109.8	164	-179.5	11.7	0	0	0	108.6	V115 K119 D120	V115-D117 PolarHBondContact O-N 3.07Å; D117-K119 PolarHBondContact O-N 3.26Å; D117-K119 PolarHBondContact OD1-N 3.44Å; D117-D120 PolarHBondContact O-N 3.47Å
118	G	50.8	Low	49	Very low	84 Å²	84	117.6 Å²	117.6	87%	0.866	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.5	-3.2	-177.6	0	0	0	0	0	114.7	W116	W116-G118 PolarHBondContact O-N 3.34Å
119	K	53.8	Low	47.3	Very low	181 Å²	181	117.6 Å²	117.6	79%	0.787	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	-28.2	-179.5	-155.7	166	-175.5	175.3	0	114.4	D117	D117-K119 PolarHBondContact O-N 3.26Å; D117-K119 PolarHBondContact OD1-N 3.44Å
120	D	50.6	Low	46.8	Very low	89 Å²	89	122.7 Å²	122.7	48%	0.476	63%	0.632	S	S	.	*	T	Hydrogen-bonded Turn	trans	-138.4	5.3	-163.2	-121	33.4	0	0	0	116.2	D117 R122	D117-D120 PolarHBondContact O-N 3.47Å; D120-R122 PolarHBondContact O-N 2.98Å; D120-R122 IonicContact OD2-CZ 3.72Å; D120-R122 IonicContact OD2-NE 3.72Å; D120-R122 IonicContact OD2-NH2 2.87Å; D120-R122 PolarHBondContact OD2-NH2 3.41Å
121	R	54.5	Low	46.7	Very low	213 Å²	213	121.2 Å²	121.2	80%	0.804	62%	0.623	S	S	*	*	S	Bend	trans	45	38.5	179.6	-62.5	-166.7	-77.6	-154.1	-6.2	113.8	W116	W116-R121 HydrophobicContact CZ3-CB 3.95Å; W116-R121 HydrophobicContact CZ3-CG 4.06Å
122	R	51.7	Low	46.9	Very low	163 Å²	163	119.3 Å²	119.3	62%	0.615	62%	0.623	S	S	*	*			trans	-125.7	139.5	174.8	-75.9	-170.8	-82.6	-176	-3.2	109.9	D120 L124	D120-R122 PolarHBondContact O-N 2.98Å; D120-R122 IonicContact OD2-CZ 3.72Å; D120-R122 IonicContact OD2-NE 3.72Å; D120-R122 IonicContact OD2-NH2 2.87Å; D120-R122 PolarHBondContact OD2-NH2 3.41Å; R122-L124 PolarHBondContact O-N 3.34Å
123	I	53.3	Low	47.2	Very low	107 Å²	107	120.1 Å²	120.1	55%	0.549	62%	0.622	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-70.8	114.7	176.4	-63.7	166.6	0	0	0	107.5	L114	L114-I123 HydrophobicContact CD1-CD1 4.43Å; L114-I123 HydrophobicContact CD2-CD1 4.2Å; L114-I123 HydrophobicContact CD2-CG1 4.33Å; L114-I123 HydrophobicContact CD2-CG2 3.64Å
124	L	50	Low	47.4	Very low	92 Å²	92	123.9 Å²	123.9	48%	0.482	64%	0.636	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.7	-35.8	-174.2	-118.9	90.2	0	0	0	114.3	R122	R122-L124 PolarHBondContact O-N 3.34Å
125	F	48.1	Very low	47.6	Very low	134 Å²	134	126.8 Å²	126.8	59%	0.588	65%	0.651	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-152.5	132.4	179.3	-70.6	-78.6	0	0	0	113.2	I127	F125-I127 HydrophobicContact CB-CD1 4.35Å; F125-I127 HydrophobicContact CB-CG1 3.83Å; F125-I127 PolarHBondContact O-N 3.03Å
126	L	47	Very low	47.6	Very low	126 Å²	126	129.8 Å²	129.8	66%	0.66	66%	0.661	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-84.1	87.3	158.9	-79.3	167.4	0	0	0	107.4	T112 L114 L128	T112-L126 HydrophobicContact CG2-CD2 3.74Å; L114-L126 HydrophobicContact CD2-CD2 4.2Å; L126-L128 PolarHBondContact O-N 3.38Å
127	I	45.5	Very low	48	Very low	99 Å²	99	127.4 Å²	127.4	51%	0.508	66%	0.664	S	S	.	*			trans	-86.4	106.1	170.5	-55.6	-178	0	0	0	106.9	F125 C129	F125-I127 HydrophobicContact CB-CD1 4.35Å; F125-I127 HydrophobicContact CB-CG1 3.83Å; F125-I127 PolarHBondContact O-N 3.03Å; I127-C129 PolarHBondContact O-N 2.87Å; I127-C129 VanDerWaalsContact O-N 3.07Å
128	L	42.5	Very low	48.2	Very low	156 Å²	156	132 Å²	132	82%	0.817	69%	0.687	S	S	*	*			trans	-61.8	102	156	-90.4	145.3	0	0	0	106.4	L126	L126-L128 PolarHBondContact O-N 3.38Å
129	C	31.9	Very low	47.9	Very low	80 Å²	80	136 Å²	136	54%	0.541	67%	0.673	S	S	.	*			trans	-73.8	132	169.2	-152.5	0	0	0	0	107.6	I127	I127-C129 PolarHBondContact O-N 2.87Å; I127-C129 VanDerWaalsContact O-N 3.07Å
130	P	46.4	Very low	47.4	Very low	192 Å²	192	131.9 Å²	131.9	100%	1.247	66%	0.662	S	S	*	*			trans	-65.9	0	177	28.7	-35	0	0	0	113.2

Retrieved 130 of 130 residues in 295.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).