A0A087Y6Z8_POEFO Loading...

Unique cartilage matrix-associated protein

May be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.

AlphaFold DB , UniProt , Accession A0A087Y6Z8, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 136 aa.

						>A0A087Y6Z8_POEFO|A0A087Y6Z8
MSWTRAFILSSLSILLIITFSSVVKSAAVRDDSKPADAQGAARQVFMAESDASNFFSQKRRSRRSPKSYAEVQAEQRMKRAASERRREYNEEQRDEYENYLEEDRDAEVNERSRETNEQLREYHYDGLYPRFYWFH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.6	Low	79.5	Confident	214 Å²	214	115.9 Å²	115.9	100%	1.054	60%	0.598	S	S	*	*				0	53.6	0	-68.9	-158.9	157.1	0	0	111.9
2	S	66.6	Low	80.2	Confident	93 Å²	93	114.6 Å²	114.6	65%	0.65	59%	0.592	S	S	*	*			trans	-104.7	-22	174	47.7	0	0	0	0	111.9	R5 A6	S2-R5 WeakPolarHBondContact O-CB 3.38Å; S2-R5 PolarHBondContact O-N 3.23Å; S2-A6 PolarHBondContact O-N 3.26Å; S2-A6 VanDerWaalsContact O-N 3.13Å
3	W	71.1	Confident	80.7	Confident	190 Å²	190	110 Å²	110	72%	0.72	58%	0.576	S	S	*	*	H	α-helix	trans	-68.5	-37	-176.8	-160.5	35.6	0	0	0	112.8	R5 A6 F7	W3-R5 VanDerWaalsContact C-N 3.31Å; W3-R5 PolarHBondContact O-N 3.48Å; W3-A6 WeakPolarHBondContact O-CB 3.29Å; W3-A6 PolarHBondContact O-N 3.2Å; W3-F7 AromaticContact CD1-CE2 3.74Å; W3-F7 HydrophobicContact CD2-CD2 4.24Å; W3-F7 AromaticContact CD2-CE2 3.4Å; W3-F7 HydrophobicContact CD2-CE2 3.4Å; W3-F7 VanDerWaalsContact CD2-CE2 3.4Å; W3-F7 HydrophobicContact CD2-CZ 4.17Å; W3-F7 AromaticContact CE2-CE2 3.17Å; W3-F7 AromaticContact CE2-CZ 3.44Å; W3-F7 VanDerWaalsContact CE2-CZ 3.44Å; W3-F7 AromaticContact CE3-CE2 3.94Å; W3-F7 HydrophobicContact CE3-CE2 3.94Å; W3-F7 HydrophobicContact CG-CD2 4.23Å; W3-F7 AromaticContact CG-CE2 3.79Å; W3-F7 HydrophobicContact CG-CE2 3.79Å; W3-F7 HydrophobicContact CH2-CE2 4.05Å; W3-F7 HydrophobicContact CH2-CZ 4.16Å; W3-F7 AromaticContact CZ2-CE2 3.54Å; W3-F7 HydrophobicContact CZ2-CE2 3.54Å; W3-F7 AromaticContact CZ2-CZ 3.45Å; W3-F7 HydrophobicContact CZ2-CZ 3.45Å; W3-F7 VanDerWaalsContact CZ2-CZ 3.45Å; W3-F7 HydrophobicContact CZ3-CE2 4.23Å; W3-F7 AromaticContact NE1-CE2 3.38Å; W3-F7 AromaticContact NE1-CZ 3.55Å; W3-F7 WeakPolarHBondContact O-CD2 3.04Å; W3-F7 PolarHBondContact O-N 3.42Å
4	T	81.6	Confident	81.2	Confident	82 Å²	82	108.5 Å²	108.5	50%	0.503	57%	0.567	S	S	.	*	H	α-helix	trans	-61.8	-38.9	173	51.1	0	0	0	0	112	F7 I8	T4-F7 PolarHBondContact O-N 3.02Å; T4-I8 WeakPolarHBondContact O-CD1 3.48Å; T4-I8 WeakPolarHBondContact O-CG1 3.23Å; T4-I8 PolarHBondContact O-N 3.44Å
5	R	79.8	Confident	81.5	Confident	183 Å²	183	108.3 Å²	108.3	69%	0.691	57%	0.566	S	S	*	*	H	α-helix	trans	-65.8	-39.6	175.9	-62.1	-177	178.5	-176.3	-1.7	111.6	S2 W3 I8 L9	S2-R5 WeakPolarHBondContact O-CB 3.38Å; S2-R5 PolarHBondContact O-N 3.23Å; W3-R5 VanDerWaalsContact C-N 3.31Å; W3-R5 PolarHBondContact O-N 3.48Å; R5-I8 PolarHBondContact O-N 3.47Å; R5-L9 WeakPolarHBondContact O-CB 3.47Å; R5-L9 VanDerWaalsContact O-CG 3.28Å; R5-L9 WeakPolarHBondContact O-CG 3.42Å; R5-L9 PolarHBondContact O-N 2.7Å
6	A	83.4	Confident	81.7	Confident	56 Å²	56	106.9 Å²	106.9	46%	0.463	56%	0.559	S	S	.	*	H	α-helix	trans	-63.4	-42.8	175.7	0	0	0	0	0	112.1	S2 W3 L9 S10	S2-A6 PolarHBondContact O-N 3.26Å; S2-A6 VanDerWaalsContact O-N 3.13Å; W3-A6 WeakPolarHBondContact O-CB 3.29Å; W3-A6 PolarHBondContact O-N 3.2Å; A6-L9 PolarHBondContact O-N 3.35Å; A6-S10 WeakPolarHBondContact O-CB 3.38Å; A6-S10 PolarHBondContact O-N 3.25Å
7	F	84.6	Confident	81.8	Confident	113 Å²	113	107.2 Å²	107.2	50%	0.496	56%	0.56	S	S	.	*	H	α-helix	trans	-64.5	-41.6	175.5	-76.5	-62.8	0	0	0	113.1	W3 T4 S10 S11	W3-F7 AromaticContact CD1-CE2 3.74Å; W3-F7 HydrophobicContact CD2-CD2 4.24Å; W3-F7 AromaticContact CD2-CE2 3.4Å; W3-F7 HydrophobicContact CD2-CE2 3.4Å; W3-F7 VanDerWaalsContact CD2-CE2 3.4Å; W3-F7 HydrophobicContact CD2-CZ 4.17Å; W3-F7 AromaticContact CE2-CE2 3.17Å; W3-F7 AromaticContact CE2-CZ 3.44Å; W3-F7 VanDerWaalsContact CE2-CZ 3.44Å; W3-F7 AromaticContact CE3-CE2 3.94Å; W3-F7 HydrophobicContact CE3-CE2 3.94Å; W3-F7 HydrophobicContact CG-CD2 4.23Å; W3-F7 AromaticContact CG-CE2 3.79Å; W3-F7 HydrophobicContact CG-CE2 3.79Å; W3-F7 HydrophobicContact CH2-CE2 4.05Å; W3-F7 HydrophobicContact CH2-CZ 4.16Å; W3-F7 AromaticContact CZ2-CE2 3.54Å; W3-F7 HydrophobicContact CZ2-CE2 3.54Å; W3-F7 AromaticContact CZ2-CZ 3.45Å; W3-F7 HydrophobicContact CZ2-CZ 3.45Å; W3-F7 VanDerWaalsContact CZ2-CZ 3.45Å; W3-F7 HydrophobicContact CZ3-CE2 4.23Å; W3-F7 AromaticContact NE1-CE2 3.38Å; W3-F7 AromaticContact NE1-CZ 3.55Å; W3-F7 WeakPolarHBondContact O-CD2 3.04Å; W3-F7 PolarHBondContact O-N 3.42Å; T4-F7 PolarHBondContact O-N 3.02Å; F7-S10 PolarHBondContact O-N 3.41Å; F7-S11 PolarHBondContact O-N 2.8Å; F7-S11 PolarHBondContact O-OG 2.92Å
8	I	86.1	Confident	81.7	Confident	105 Å²	105	106.8 Å²	106.8	54%	0.538	56%	0.557	S	S	.	*	H	α-helix	trans	-64.6	-42.8	177.9	-67.2	162.8	0	0	0	110.7	T4 R5 S10 S11 L12	T4-I8 WeakPolarHBondContact O-CD1 3.48Å; T4-I8 WeakPolarHBondContact O-CG1 3.23Å; T4-I8 PolarHBondContact O-N 3.44Å; R5-I8 PolarHBondContact O-N 3.47Å; I8-S10 VanDerWaalsContact C-N 3.33Å; I8-S10 PolarHBondContact O-N 3.26Å; I8-S11 PolarHBondContact O-N 2.88Å; I8-S11 PolarHBondContact O-OG 3.3Å; I8-L12 WeakPolarHBondContact O-CB 3.26Å; I8-L12 PolarHBondContact O-N 3.48Å
9	L	87.2	Confident	81.4	Confident	119 Å²	119	105.1 Å²	105.1	62%	0.623	55%	0.552	S	S	*	*	H	α-helix	trans	-66.7	-36.8	177.3	-71	170.6	0	0	0	111.9	R5 A6 S13	R5-L9 WeakPolarHBondContact O-CB 3.47Å; R5-L9 VanDerWaalsContact O-CG 3.28Å; R5-L9 WeakPolarHBondContact O-CG 3.42Å; R5-L9 PolarHBondContact O-N 2.7Å; A6-L9 PolarHBondContact O-N 3.35Å; L9-S13 PolarHBondContact O-N 2.91Å; L9-S13 PolarHBondContact O-OG 3Å
10	S	87.4	Confident	81	Confident	61 Å²	61	106.7 Å²	106.7	43%	0.427	55%	0.554	S	S	.	*	H	α-helix	trans	-68.1	-39.8	175.5	-179.2	0	0	0	0	112.8	A6 F7 I8 S13 I14	A6-S10 WeakPolarHBondContact O-CB 3.38Å; A6-S10 PolarHBondContact O-N 3.25Å; F7-S10 PolarHBondContact O-N 3.41Å; I8-S10 VanDerWaalsContact C-N 3.33Å; I8-S10 PolarHBondContact O-N 3.26Å; S10-S13 PolarHBondContact O-OG 3.36Å; S10-I14 WeakPolarHBondContact O-CD1 3.34Å; S10-I14 VanDerWaalsContact O-CG1 3.26Å; S10-I14 WeakPolarHBondContact O-CG1 3.46Å; S10-I14 PolarHBondContact O-N 3.16Å
11	S	85.9	Confident	80.2	Confident	59 Å²	59	105.1 Å²	105.1	41%	0.413	55%	0.552	S	S	.	*	H	α-helix	trans	-71.2	-36.8	177.5	63.1	0	0	0	0	111.2	F7 I8 I14 L15	F7-S11 PolarHBondContact O-N 2.8Å; F7-S11 PolarHBondContact O-OG 2.92Å; I8-S11 PolarHBondContact O-N 2.88Å; I8-S11 PolarHBondContact O-OG 3.3Å; S11-I14 PolarHBondContact O-N 3.1Å; S11-L15 WeakPolarHBondContact O-CG 3.38Å; S11-L15 PolarHBondContact O-N 3.19Å
12	L	87.9	Confident	80.2	Confident	100 Å²	100	98.8 Å²	98.8	52%	0.524	53%	0.529	S	S	.	.	H	α-helix	trans	-63.6	-41.6	176	-156.1	101.1	0	0	0	111.6	I8 L15 L16	I8-L12 WeakPolarHBondContact O-CB 3.26Å; I8-L12 PolarHBondContact O-N 3.48Å; L12-L15 PolarHBondContact O-N 3.16Å; L12-L16 WeakPolarHBondContact O-CB 3.4Å; L12-L16 PolarHBondContact O-N 2.87Å
13	S	87.1	Confident	79.7	Confident	55 Å²	55	99.9 Å²	99.9	39%	0.385	53%	0.532	S	S	.	.	H	α-helix	trans	-65.6	-40.3	178.1	68.1	0	0	0	0	112.3	L9 S10 L16 I17	L9-S13 PolarHBondContact O-N 2.91Å; L9-S13 PolarHBondContact O-OG 3Å; S10-S13 PolarHBondContact O-OG 3.36Å; S13-L16 WeakPolarHBondContact O-CB 3.09Å; S13-L16 PolarHBondContact O-N 3.38Å; S13-I17 WeakPolarHBondContact O-CG1 3.42Å; S13-I17 PolarHBondContact O-N 3.11Å
14	I	88.1	Confident	78.9	Confident	89 Å²	89	96.1 Å²	96.1	46%	0.456	53%	0.53	S	S	.	.	H	α-helix	trans	-63.1	-45	175.5	-66.6	164.2	0	0	0	110.6	S10 S11 L16 I17 I18	S10-I14 WeakPolarHBondContact O-CD1 3.34Å; S10-I14 VanDerWaalsContact O-CG1 3.26Å; S10-I14 WeakPolarHBondContact O-CG1 3.46Å; S10-I14 PolarHBondContact O-N 3.16Å; S11-I14 PolarHBondContact O-N 3.1Å; I14-L16 VanDerWaalsContact C-N 3.28Å; I14-L16 PolarHBondContact O-N 3.46Å; I14-I17 PolarHBondContact O-N 3.1Å; I14-I18 HydrophobicContact CG2-CD1 3.84Å; I14-I18 VanDerWaalsContact O-CG1 3.3Å; I14-I18 WeakPolarHBondContact O-CG1 3.17Å; I14-I18 PolarHBondContact O-N 2.83Å
15	L	85.2	Confident	77.2	Confident	106 Å²	106	101 Å²	101	56%	0.555	54%	0.544	S	S	*	.	H	α-helix	trans	-61	-39.1	175.7	-76.6	168.6	0	0	0	111.8	S11 L12 I18 T19	S11-L15 WeakPolarHBondContact O-CG 3.38Å; S11-L15 PolarHBondContact O-N 3.19Å; L12-L15 PolarHBondContact O-N 3.16Å; L15-I18 PolarHBondContact O-N 3.33Å; L15-T19 WeakPolarHBondContact O-CG2 3.33Å; L15-T19 PolarHBondContact O-N 3.21Å; L15-T19 PolarHBondContact O-OG1 3.12Å
16	L	84.8	Confident	75.9	Confident	86 Å²	86	97 Å²	97	45%	0.45	54%	0.543	S	S	.	.	H	α-helix	trans	-62.3	-45.4	175	-131.5	144.9	0	0	0	111	L12 S13 I14 I18 T19 F20	L12-L16 WeakPolarHBondContact O-CB 3.4Å; L12-L16 PolarHBondContact O-N 2.87Å; S13-L16 WeakPolarHBondContact O-CB 3.09Å; S13-L16 PolarHBondContact O-N 3.38Å; I14-L16 VanDerWaalsContact C-N 3.28Å; I14-L16 PolarHBondContact O-N 3.46Å; L16-I18 VanDerWaalsContact C-N 3.3Å; L16-I18 PolarHBondContact O-N 3.06Å; L16-T19 PolarHBondContact O-N 3.04Å; L16-T19 PolarHBondContact O-OG1 2.91Å; L16-F20 HydrophobicContact CD2-CD2 3.55Å; L16-F20 HydrophobicContact CD2-CE2 3.27Å; L16-F20 HydrophobicContact CD2-CZ 4.32Å; L16-F20 HydrophobicContact CG-CD2 4.44Å; L16-F20 HydrophobicContact CG-CE2 4.26Å; L16-F20 VanDerWaalsContact O-CD2 3.23Å; L16-F20 WeakPolarHBondContact O-CD2 3.46Å; L16-F20 PolarHBondContact O-N 3.01Å
17	I	83.6	Confident	74.2	Confident	112 Å²	112	99.6 Å²	99.6	57%	0.574	57%	0.565	S	S	*	*	H	α-helix	trans	-61.7	-40.7	176.8	-66.4	162.3	0	0	0	111	S13 I14 S21	S13-I17 WeakPolarHBondContact O-CG1 3.42Å; S13-I17 PolarHBondContact O-N 3.11Å; I14-I17 PolarHBondContact O-N 3.1Å; I17-S21 VanDerWaalsContact O-CB 3.25Å; I17-S21 WeakPolarHBondContact O-CB 3.48Å; I17-S21 PolarHBondContact O-N 3.35Å; I17-S21 PolarHBondContact O-OG 2.84Å
18	I	79.3	Confident	72.6	Confident	100 Å²	100	97.5 Å²	97.5	51%	0.513	57%	0.569	S	S	.	*	H	α-helix	trans	-67.4	-41.5	179.4	-66.7	166.1	0	0	0	111.5	I14 L15 L16 S21 S22	I14-I18 HydrophobicContact CG2-CD1 3.84Å; I14-I18 VanDerWaalsContact O-CG1 3.3Å; I14-I18 WeakPolarHBondContact O-CG1 3.17Å; I14-I18 PolarHBondContact O-N 2.83Å; L15-I18 PolarHBondContact O-N 3.33Å; L16-I18 VanDerWaalsContact C-N 3.3Å; L16-I18 PolarHBondContact O-N 3.06Å; I18-S21 PolarHBondContact O-N 2.94Å; I18-S22 PolarHBondContact O-N 2.82Å
19	T	76.4	Confident	70.6	Confident	73 Å²	73	98.6 Å²	98.6	45%	0.448	58%	0.58	S	S	.	*	H	α-helix	trans	-70.1	-37.6	178.6	56.3	0	0	0	0	112.3	L15 L16 S22 V23	L15-T19 WeakPolarHBondContact O-CG2 3.33Å; L15-T19 PolarHBondContact O-N 3.21Å; L15-T19 PolarHBondContact O-OG1 3.12Å; L16-T19 PolarHBondContact O-N 3.04Å; L16-T19 PolarHBondContact O-OG1 2.91Å; T19-S22 PolarHBondContact O-N 3.22Å; T19-S22 PolarHBondContact O-OG 3.4Å; T19-V23 VanDerWaalsContact O-CG2 3.3Å; T19-V23 WeakPolarHBondContact O-CG2 3.09Å; T19-V23 PolarHBondContact O-N 2.98Å; T19-V23 VanDerWaalsContact O-N 3.12Å
20	F	72.5	Confident	68.6	Low	138 Å²	138	102.3 Å²	102.3	61%	0.605	59%	0.586	S	S	*	*	H	α-helix	trans	-69.8	-34.9	173.2	-83.4	-94.4	0	0	0	111.9	L16 S22 V23 V24	L16-F20 HydrophobicContact CD2-CD2 3.55Å; L16-F20 HydrophobicContact CD2-CE2 3.27Å; L16-F20 HydrophobicContact CD2-CZ 4.32Å; L16-F20 HydrophobicContact CG-CD2 4.44Å; L16-F20 HydrophobicContact CG-CE2 4.26Å; L16-F20 VanDerWaalsContact O-CD2 3.23Å; L16-F20 WeakPolarHBondContact O-CD2 3.46Å; L16-F20 PolarHBondContact O-N 3.01Å; F20-S22 VanDerWaalsContact C-N 3.34Å; F20-S22 PolarHBondContact O-N 3.29Å; F20-V23 PolarHBondContact O-N 2.81Å; F20-V24 PolarHBondContact O-N 2.85Å
21	S	64.8	Low	66.9	Low	73 Å²	73	106.9 Å²	106.9	51%	0.51	61%	0.606	S	S	.	*	H	α-helix	trans	-68.8	-29.5	174.6	-58.3	0	0	0	0	113	I17 I18 V24	I17-S21 VanDerWaalsContact O-CB 3.25Å; I17-S21 WeakPolarHBondContact O-CB 3.48Å; I17-S21 PolarHBondContact O-N 3.35Å; I17-S21 PolarHBondContact O-OG 2.84Å; I18-S21 PolarHBondContact O-N 2.94Å; S21-V24 CarbonylContact O-C 3.58Å
22	S	60.8	Low	65.1	Low	82 Å²	82	109.3 Å²	109.3	57%	0.573	61%	0.614	S	S	*	*	H	α-helix	trans	-79.4	-25.3	173.6	70.2	0	0	0	0	113.2	I18 T19 F20	I18-S22 PolarHBondContact O-N 2.82Å; T19-S22 PolarHBondContact O-N 3.22Å; T19-S22 PolarHBondContact O-OG 3.4Å; F20-S22 VanDerWaalsContact C-N 3.34Å; F20-S22 PolarHBondContact O-N 3.29Å
23	V	56.4	Low	63.5	Low	116 Å²	116	110.4 Å²	110.4	70%	0.703	63%	0.63	S	S	*	*	H	α-helix	trans	-72.2	-31.3	170.2	171.1	0	0	0	0	111.2	T19 F20 K25	T19-V23 VanDerWaalsContact O-CG2 3.3Å; T19-V23 WeakPolarHBondContact O-CG2 3.09Å; T19-V23 PolarHBondContact O-N 2.98Å; T19-V23 VanDerWaalsContact O-N 3.12Å; F20-V23 PolarHBondContact O-N 2.81Å; V23-K25 PolarHBondContact O-N 2.98Å
24	V	53	Low	61.9	Low	111 Å²	111	116.5 Å²	116.5	67%	0.673	65%	0.65	S	S	*	*	S	Bend	trans	-73.8	71.8	160.1	-175.3	0	0	0	0	107.9	F20 S21 S26	F20-V24 PolarHBondContact O-N 2.85Å; S21-V24 CarbonylContact O-C 3.58Å; V24-S26 PolarHBondContact O-N 3.32Å
25	K	47.7	Very low	60.1	Low	185 Å²	185	118 Å²	118	80%	0.804	67%	0.665	S	S	*	*			trans	-43	113.3	167.6	-106.4	164.9	173.3	155.3	0	107.9	V23 A27	V23-K25 PolarHBondContact O-N 2.98Å; K25-A27 PolarHBondContact O-N 3.38Å
26	S	51.8	Low	58.5	Low	97 Å²	97	117.3 Å²	117.3	68%	0.678	68%	0.675	S	S	*	*			trans	-33.6	133.8	171.1	-61.3	0	0	0	0	110.9	V24 A28	V24-S26 PolarHBondContact O-N 3.32Å; S26-A28 PolarHBondContact O-N 3.44Å
27	A	47.5	Very low	57.2	Low	112 Å²	112	119.1 Å²	119.1	93%	0.926	69%	0.685	S	S	*	*			trans	-66.4	36	154.5	0	0	0	0	0	111	K25 V29	K25-A27 PolarHBondContact O-N 3.38Å; A27-V29 PolarHBondContact O-N 3.46Å; A27-V29 VanDerWaalsContact O-N 3.16Å
28	A	50.5	Low	55.9	Low	69 Å²	69	117.1 Å²	117.1	57%	0.57	69%	0.685	S	S	*	*			trans	-75.7	103.2	171.3	0	0	0	0	0	105.9	S26 R30	S26-A28 PolarHBondContact O-N 3.44Å; A28-R30 PolarHBondContact O-N 3.24Å; A28-R30 VanDerWaalsContact O-N 3.14Å
29	V	44.4	Very low	54.8	Low	128 Å²	128	117.4 Å²	117.4	78%	0.776	68%	0.684	S	S	*	*			trans	-47.1	119.8	158.1	173.1	0	0	0	0	106.4	A27 D31	A27-V29 PolarHBondContact O-N 3.46Å; A27-V29 VanDerWaalsContact O-N 3.16Å; V29-D31 PolarHBondContact O-N 2.71Å
30	R	46.4	Very low	53.9	Low	196 Å²	196	116.7 Å²	116.7	74%	0.74	69%	0.691	S	S	*	*			trans	-68.8	124.6	171.3	-63.6	-163	-175.4	-174.2	1.3	107.3	A28 D32	A28-R30 PolarHBondContact O-N 3.24Å; A28-R30 VanDerWaalsContact O-N 3.14Å; R30-D32 HydrophobicContact CB-CB 4.21Å; R30-D32 WeakPolarHBondContact CD-OD2 3.35Å; R30-D32 IonicContact NH1-OD2 3.61Å; R30-D32 PolarHBondContact O-N 2.97Å
31	D	50.1	Low	53.3	Low	158 Å²	158	113.7 Å²	113.7	85%	0.845	69%	0.692	S	S	*	*			trans	-72.2	40.5	163.6	-82.2	-26	0	0	0	111	V29 S33	V29-D31 PolarHBondContact O-N 2.71Å; D31-S33 PolarHBondContact O-N 3.3Å; D31-S33 VanDerWaalsContact O-N 3.08Å
32	D	49.1	Very low	52.9	Low	110 Å²	110	112.4 Å²	112.4	59%	0.588	69%	0.686	S	S	*	*			trans	-77.3	97.6	168.9	-67.5	-21.1	0	0	0	105.6	R30 K34	R30-D32 HydrophobicContact CB-CB 4.21Å; R30-D32 WeakPolarHBondContact CD-OD2 3.35Å; R30-D32 IonicContact NH1-OD2 3.61Å; R30-D32 PolarHBondContact O-N 2.97Å; D32-K34 PolarHBondContact O-N 3.32Å
33	S	54.4	Low	52.8	Low	122 Å²	122	116.7 Å²	116.7	85%	0.853	69%	0.689	S	S	*	*	S	Bend	trans	-68.9	50.9	-178.7	51.3	0	0	0	0	113.6	D31	D31-S33 PolarHBondContact O-N 3.3Å; D31-S33 VanDerWaalsContact O-N 3.08Å
34	K	53.8	Low	53	Low	184 Å²	184	119.5 Å²	119.5	80%	0.8	70%	0.695	S	S	*	*			trans	-144.2	105	163	-119.9	176.5	-178.2	177.7	0	109	D32 A36	D32-K34 PolarHBondContact O-N 3.32Å; K34-A36 PolarHBondContact O-N 2.94Å
35	P	49.2	Very low	53.7	Low	121 Å²	121	119.6 Å²	119.6	79%	0.786	70%	0.695	S	S	*	*			trans	-66.8	101.2	170.4	27.7	-30.7	0	0	0	107.4	D37	P35-D37 PolarHBondContact O-N 3.49Å
36	A	52.2	Low	54.8	Low	91 Å²	91	118.1 Å²	118.1	75%	0.752	69%	0.689	S	S	*	*			trans	-57.9	121.7	154.7	0	0	0	0	0	105.6	K34 A38	K34-A36 PolarHBondContact O-N 2.94Å; A36-A38 VanDerWaalsContact C-N 3.34Å; A36-A38 PolarHBondContact O-N 3.43Å
37	D	57.9	Low	56	Low	124 Å²	124	118 Å²	118	66%	0.663	68%	0.679	S	S	*	*			trans	-41.5	88.6	-168.3	-73.5	-63.3	0	0	0	114	P35 Q39	P35-D37 PolarHBondContact O-N 3.49Å; D37-Q39 HydrophobicContact CB-CB 4.36Å; D37-Q39 HydrophobicContact CB-CG 4.09Å; D37-Q39 PolarHBondContact O-N 3.33Å; D37-Q39 PolarHBondContact OD1-NE2 2.97Å
38	A	55.7	Low	57.5	Low	70 Å²	70	115.3 Å²	115.3	58%	0.579	66%	0.657	S	S	*	*			trans	-77.2	50.6	165.9	0	0	0	0	0	108.8	A36 G40 A42	A36-A38 VanDerWaalsContact C-N 3.34Å; A36-A38 PolarHBondContact O-N 3.43Å; A38-G40 VanDerWaalsContact C-N 3.33Å; A38-G40 PolarHBondContact O-N 3.44Å; A38-A42 HydrophobicContact CB-CB 4.46Å
39	Q	55.9	Low	58.6	Low	105 Å²	105	120.4 Å²	120.4	49%	0.491	67%	0.669	S	S	.	*			trans	-78.2	-14.8	-168.5	-94.1	179.6	21.6	0	0	113.6	D37 R43	D37-Q39 HydrophobicContact CB-CB 4.36Å; D37-Q39 HydrophobicContact CB-CG 4.09Å; D37-Q39 PolarHBondContact O-N 3.33Å; D37-Q39 PolarHBondContact OD1-NE2 2.97Å; Q39-R43 WeakPolarHBondContact O-CD 3.34Å
40	G	58	Low	60	Low	58 Å²	58	118 Å²	118	60%	0.598	66%	0.657	S	S	*	*	S	Bend	trans	-91.2	-61.3	-175	0	0	0	0	0	114.7	A38	A38-G40 VanDerWaalsContact C-N 3.33Å; A38-G40 PolarHBondContact O-N 3.44Å
41	A	59.4	Low	61.4	Low	75 Å²	75	112.8 Å²	112.8	62%	0.62	65%	0.645	S	S	*	*	S	Bend	trans	-89.5	-39.4	-168.7	0	0	0	0	0	113.8	R43 Q44	A41-R43 VanDerWaalsContact C-N 3.34Å; A41-R43 PolarHBondContact O-N 3.27Å; A41-Q44 PolarHBondContact O-N 3.43Å
42	A	57.2	Low	62.7	Low	47 Å²	47	106.2 Å²	106.2	39%	0.388	61%	0.612	S	S	.	*	H	α-helix	trans	-69.9	-31.9	-177.9	0	0	0	0	0	112.4	A38 Q44 V45 F46	A38-A42 HydrophobicContact CB-CB 4.46Å; A42-Q44 VanDerWaalsContact C-N 3.28Å; A42-Q44 PolarHBondContact O-N 2.91Å; A42-V45 PolarHBondContact O-N 2.94Å; A42-F46 WeakPolarHBondContact O-CD2 3.49Å; A42-F46 PolarHBondContact O-N 2.66Å
43	R	58.4	Low	63.7	Low	171 Å²	171	103.8 Å²	103.8	65%	0.645	60%	0.604	S	S	*	*	H	α-helix	trans	-69.3	-20.7	174.7	-76.3	-170.6	174.4	-178.1	-0.6	114	Q39 A41 F46	Q39-R43 WeakPolarHBondContact O-CD 3.34Å; A41-R43 VanDerWaalsContact C-N 3.34Å; A41-R43 PolarHBondContact O-N 3.27Å; R43-F46 VanDerWaalsContact O-O 3.1Å
44	Q	60.7	Low	64.3	Low	176 Å²	176	102.4 Å²	102.4	82%	0.822	59%	0.587	S	S	*	*	H	α-helix	trans	-79.1	-31.4	175.1	-88.9	-178.3	-3.1	0	0	112.5	A41 A42	A41-Q44 PolarHBondContact O-N 3.43Å; A42-Q44 VanDerWaalsContact C-N 3.28Å; A42-Q44 PolarHBondContact O-N 2.91Å
45	V	67.1	Low	65	Low	112 Å²	112	98.9 Å²	98.9	68%	0.679	57%	0.572	S	S	*	*	H	α-helix	trans	-88	-33.6	180	-177.2	0	0	0	0	111.4	A42	A42-V45 PolarHBondContact O-N 2.94Å
46	F	70.7	Confident	65.7	Low	154 Å²	154	99.4 Å²	99.4	68%	0.675	56%	0.562	S	S	*	*	S	Bend	trans	-113.7	121.2	-178.9	-61.3	-75.9	0	0	0	111.5	A42 R43	A42-F46 WeakPolarHBondContact O-CD2 3.49Å; A42-F46 PolarHBondContact O-N 2.66Å; R43-F46 VanDerWaalsContact O-O 3.1Å
47	M	77.8	Confident	66.1	Low	95 Å²	95	98 Å²	98	47%	0.468	55%	0.547	S	S	.	.			trans	-67.9	144.1	173.1	-178.6	170	53.4	0	0	110.9	D51 A52 F55	M47-D51 HydrophobicContact CG-CB 3.56Å; M47-D51 HydrophobicContact SD-CB 3.78Å; M47-A52 VanDerWaalsContact CE-CA 3.48Å; M47-A52 HydrophobicContact CE-CB 3.78Å; M47-F55 HydrophobicContact CE-CD2 3.4Å; M47-F55 HydrophobicContact CE-CE2 3.36Å; M47-F55 HydrophobicContact CE-CG 4.25Å; M47-F55 HydrophobicContact CE-CZ 4.16Å; M47-F55 HydrophobicContact SD-CD2 3.93Å; M47-F55 HydrophobicContact SD-CE2 3.29Å; M47-F55 WeakPolarHBondContact SD-CE2 3.34Å; M47-F55 HydrophobicContact SD-CZ 4.05Å
48	A	79.6	Confident	65.9	Low	55 Å²	55	98.1 Å²	98.1	46%	0.455	54%	0.543	S	S	.	.			trans	-59.8	146.1	177.3	0	0	0	0	0	111.7	S50 D51 A52	A48-S50 VanDerWaalsContact C-N 3.28Å; A48-S50 PolarHBondContact O-N 2.6Å; A48-D51 PolarHBondContact O-N 2.89Å; A48-A52 PolarHBondContact O-N 3.31Å
49	E	73	Confident	65.9	Low	177 Å²	177	101.1 Å²	101.1	83%	0.827	54%	0.543	S	S	*	.	H	α-helix	trans	-57.1	-39.5	-176.2	-174.4	-178.3	172.1	0	0	112.8	D51 A52 S53	E49-D51 VanDerWaalsContact C-N 3.33Å; E49-D51 PolarHBondContact O-N 2.76Å; E49-A52 PolarHBondContact O-N 3.15Å; E49-S53 WeakPolarHBondContact O-CB 3.39Å; E49-S53 PolarHBondContact O-N 3.02Å
50	S	74.4	Confident	65.8	Low	76 Å²	76	106.9 Å²	106.9	53%	0.531	56%	0.56	S	S	.	*	H	α-helix	trans	-60.2	-42.1	175.8	53.6	0	0	0	0	112.1	A48 S53 N54	A48-S50 VanDerWaalsContact C-N 3.28Å; A48-S50 PolarHBondContact O-N 2.6Å; S50-S53 PolarHBondContact O-OG 3.3Å; S50-N54 PolarHBondContact O-ND2 3.31Å
51	D	75.9	Confident	65.5	Low	88 Å²	88	113.6 Å²	113.6	47%	0.471	57%	0.568	S	S	.	*	H	α-helix	trans	-73.5	-39.6	177.9	-72.7	-15.4	0	0	0	111.1	M47 A48 E49 S53 N54 F55	M47-D51 HydrophobicContact CG-CB 3.56Å; M47-D51 HydrophobicContact SD-CB 3.78Å; A48-D51 PolarHBondContact O-N 2.89Å; E49-D51 VanDerWaalsContact C-N 3.33Å; E49-D51 PolarHBondContact O-N 2.76Å; D51-S53 VanDerWaalsContact C-N 3.32Å; D51-S53 PolarHBondContact O-N 2.97Å; D51-N54 WeakPolarHBondContact O-CB 3.46Å; D51-N54 PolarHBondContact O-N 2.96Å; D51-F55 VanDerWaalsContact O-CD2 3.23Å; D51-F55 WeakPolarHBondContact O-CD2 3.49Å
52	A	75.5	Confident	65.2	Low	20 Å²	20	114.7 Å²	114.7	17%	0.165	57%	0.571	C	S	.	*	H	α-helix	trans	-63.3	-36.2	175.2	0	0	0	0	0	112.9	M47 A48 E49 N54 F55 F56	M47-A52 VanDerWaalsContact CE-CA 3.48Å; M47-A52 HydrophobicContact CE-CB 3.78Å; A48-A52 PolarHBondContact O-N 3.31Å; E49-A52 PolarHBondContact O-N 3.15Å; A52-N54 PolarHBondContact O-N 3.25Å; A52-F55 WeakPolarHBondContact O-CB 3.38Å; A52-F55 PolarHBondContact O-N 3.47Å; A52-F56 HydrophobicContact CB-CE2 4.38Å; A52-F56 WeakPolarHBondContact O-CD2 3.44Å; A52-F56 PolarHBondContact O-N 2.8Å
53	S	70.9	Confident	65.2	Low	59 Å²	59	123.5 Å²	123.5	41%	0.413	59%	0.594	S	S	.	*	H	α-helix	trans	-60.2	-31.2	179	79.3	0	0	0	0	112	E49 S50 D51 F56 S57	E49-S53 WeakPolarHBondContact O-CB 3.39Å; E49-S53 PolarHBondContact O-N 3.02Å; S50-S53 PolarHBondContact O-OG 3.3Å; D51-S53 VanDerWaalsContact C-N 3.32Å; D51-S53 PolarHBondContact O-N 2.97Å; S53-F56 PolarHBondContact O-N 2.9Å; S53-S57 WeakPolarHBondContact O-CB 3.33Å; S53-S57 PolarHBondContact O-N 3.08Å; S53-S57 PolarHBondContact O-OG 2.81Å
54	N	67.9	Low	65.4	Low	92 Å²	92	125.1 Å²	125.1	49%	0.492	60%	0.6	S	S	.	*	H	α-helix	trans	-68.6	-32.6	174.8	-69.9	-40.6	0	0	0	112.3	S50 D51 A52 F56 S57 Q58	S50-N54 PolarHBondContact O-ND2 3.31Å; D51-N54 WeakPolarHBondContact O-CB 3.46Å; D51-N54 PolarHBondContact O-N 2.96Å; A52-N54 PolarHBondContact O-N 3.25Å; N54-F56 VanDerWaalsContact C-N 3.32Å; N54-F56 PolarHBondContact O-N 3.43Å; N54-S57 WeakPolarHBondContact CA-OG 3.07Å; N54-S57 PolarHBondContact O-OG 2.94Å; N54-Q58 WeakPolarHBondContact O-CB 3.3Å; N54-Q58 PolarHBondContact O-N 3.13Å
55	F	67.9	Low	65.5	Low	110 Å²	110	121 Å²	121	48%	0.482	59%	0.591	S	S	.	*	H	α-helix	trans	-67.7	-34.4	172.7	-69.5	-95.7	0	0	0	111.7	M47 D51 A52 K59	M47-F55 HydrophobicContact CE-CD2 3.4Å; M47-F55 HydrophobicContact CE-CE2 3.36Å; M47-F55 HydrophobicContact CE-CG 4.25Å; M47-F55 HydrophobicContact CE-CZ 4.16Å; M47-F55 HydrophobicContact SD-CD2 3.93Å; M47-F55 HydrophobicContact SD-CE2 3.29Å; M47-F55 WeakPolarHBondContact SD-CE2 3.34Å; M47-F55 HydrophobicContact SD-CZ 4.05Å; D51-F55 VanDerWaalsContact O-CD2 3.23Å; D51-F55 WeakPolarHBondContact O-CD2 3.49Å; A52-F55 WeakPolarHBondContact O-CB 3.38Å; A52-F55 PolarHBondContact O-N 3.47Å; F55-K59 WeakPolarHBondContact O-CB 3.45Å; F55-K59 WeakPolarHBondContact O-CD 3.38Å; F55-K59 WeakPolarHBondContact O-CG 3.36Å; F55-K59 PolarHBondContact O-N 3.29Å
56	F	64.5	Low	65.6	Low	132 Å²	132	121.8 Å²	121.8	58%	0.579	60%	0.598	S	S	*	*	H	α-helix	trans	-78.4	-36.6	176.8	-63	-69.9	0	0	0	112.8	A52 S53 N54 K59 R60	A52-F56 HydrophobicContact CB-CE2 4.38Å; A52-F56 WeakPolarHBondContact O-CD2 3.44Å; A52-F56 PolarHBondContact O-N 2.8Å; S53-F56 PolarHBondContact O-N 2.9Å; N54-F56 VanDerWaalsContact C-N 3.32Å; N54-F56 PolarHBondContact O-N 3.43Å; F56-K59 HydrophobicContact CD1-CD 4.41Å; F56-K59 CarbonylContact O-C 3.57Å; F56-K59 WeakPolarHBondContact O-CB 3.39Å; F56-K59 PolarHBondContact O-N 2.81Å; F56-R60 PolarHBondContact O-N 2.94Å
57	S	58.8	Low	65.6	Low	63 Å²	63	118.5 Å²	118.5	44%	0.441	58%	0.584	S	S	.	*	H	α-helix	trans	-72	-36	175.9	74.1	0	0	0	0	111.7	S53 N54 R60	S53-S57 WeakPolarHBondContact O-CB 3.33Å; S53-S57 PolarHBondContact O-N 3.08Å; S53-S57 PolarHBondContact O-OG 2.81Å; N54-S57 WeakPolarHBondContact CA-OG 3.07Å; N54-S57 PolarHBondContact O-OG 2.94Å; S57-R60 WeakPolarHBondContact O-CB 3.06Å; S57-R60 PolarHBondContact O-N 3.02Å; S57-R60 VanDerWaalsContact O-N 3.12Å
58	Q	55.3	Low	65.8	Low	125 Å²	125	117 Å²	117	58%	0.584	58%	0.583	S	S	*	*	H	α-helix	trans	-72.5	-31.3	171.1	-153.3	168.4	43.3	0	0	111.1	N54 R60 R61	N54-Q58 WeakPolarHBondContact O-CB 3.3Å; N54-Q58 PolarHBondContact O-N 3.13Å; Q58-R60 VanDerWaalsContact C-N 3.27Å; Q58-R60 PolarHBondContact O-N 3.19Å; Q58-R61 VanDerWaalsContact O-CB 3.26Å; Q58-R61 WeakPolarHBondContact O-CB 3.42Å; Q58-R61 PolarHBondContact O-N 3.32Å
59	K	54.6	Low	66.2	Low	134 Å²	134	123.2 Å²	123.2	58%	0.583	60%	0.596	S	S	*	*	H	α-helix	trans	-67.7	-16.4	165.4	-81.7	173.2	-174.7	-178.9	0	113.9	F55 F56 R61 S62	F55-K59 WeakPolarHBondContact O-CB 3.45Å; F55-K59 WeakPolarHBondContact O-CD 3.38Å; F55-K59 WeakPolarHBondContact O-CG 3.36Å; F55-K59 PolarHBondContact O-N 3.29Å; F56-K59 HydrophobicContact CD1-CD 4.41Å; F56-K59 CarbonylContact O-C 3.57Å; F56-K59 WeakPolarHBondContact O-CB 3.39Å; F56-K59 PolarHBondContact O-N 2.81Å; K59-R61 PolarHBondContact O-N 3.09Å; K59-S62 WeakPolarHBondContact O-CA 3.48Å; K59-S62 WeakPolarHBondContact O-CB 3.4Å; K59-S62 PolarHBondContact O-N 3.23Å; K59-S62 PolarHBondContact O-OG 2.81Å
60	R	54.4	Low	67	Low	225 Å²	225	117.7 Å²	117.7	85%	0.849	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.7	-7.3	166	-69.7	-176.3	178.2	176.9	0.1	112.5	F56 S57 Q58 S62	F56-R60 PolarHBondContact O-N 2.94Å; S57-R60 WeakPolarHBondContact O-CB 3.06Å; S57-R60 PolarHBondContact O-N 3.02Å; S57-R60 VanDerWaalsContact O-N 3.12Å; Q58-R60 VanDerWaalsContact C-N 3.27Å; Q58-R60 PolarHBondContact O-N 3.19Å; R60-S62 PolarHBondContact O-N 3.29Å
61	R	51.8	Low	67.7	Low	199 Å²	199	118.7 Å²	118.7	75%	0.751	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.1	18.9	157.9	-60.9	-174.9	-172.7	179.5	2.5	113.3	Q58 K59 R63	Q58-R61 VanDerWaalsContact O-CB 3.26Å; Q58-R61 WeakPolarHBondContact O-CB 3.42Å; Q58-R61 PolarHBondContact O-N 3.32Å; K59-R61 PolarHBondContact O-N 3.09Å; R61-R63 CarbonylContact O-C 3.57Å; R61-R63 VanDerWaalsContact O-C 3.3Å; R61-R63 PolarHBondContact O-N 3.29Å; R61-R63 VanDerWaalsContact O-O 3.1Å
62	S	52.1	Low	68.4	Low	99 Å²	99	116.9 Å²	116.9	69%	0.692	57%	0.569	S	S	*	*			trans	-70.6	11.5	173.3	71.5	0	0	0	0	114.5	K59 R60 R64	K59-S62 WeakPolarHBondContact O-CA 3.48Å; K59-S62 WeakPolarHBondContact O-CB 3.4Å; K59-S62 PolarHBondContact O-N 3.23Å; K59-S62 PolarHBondContact O-OG 2.81Å; R60-S62 PolarHBondContact O-N 3.29Å; S62-R64 PolarHBondContact O-N 3.16Å; S62-R64 VanDerWaalsContact O-N 3.1Å
63	R	58.3	Low	69.2	Low	232 Å²	232	119.5 Å²	119.5	88%	0.875	58%	0.577	S	S	*	*	S	Bend	trans	-75.3	87.9	144	-68.5	179.6	104.9	110.9	-3	105.2	R61 S65	R61-R63 CarbonylContact O-C 3.57Å; R61-R63 VanDerWaalsContact O-C 3.3Å; R61-R63 PolarHBondContact O-N 3.29Å; R61-R63 VanDerWaalsContact O-O 3.1Å; R63-S65 PolarHBondContact O-N 3.4Å; R63-S65 VanDerWaalsContact O-N 3.11Å
64	R	61.3	Low	70.3	Confident	204 Å²	204	119.5 Å²	119.5	77%	0.77	58%	0.581	S	S	*	*			trans	-34.9	125.9	160.6	-68.6	175.2	176.3	154	-1.5	106	S62	S62-R64 PolarHBondContact O-N 3.16Å; S62-R64 VanDerWaalsContact O-N 3.1Å
65	S	64.1	Low	71.5	Confident	89 Å²	89	118.8 Å²	118.8	62%	0.622	58%	0.575	S	S	*	*			trans	-44.8	138.6	168.4	51.4	0	0	0	0	107.1	R63 K67	R63-S65 PolarHBondContact O-N 3.4Å; R63-S65 VanDerWaalsContact O-N 3.11Å; S65-K67 PolarHBondContact O-N 3.14Å
66	P	68.8	Low	72.8	Confident	129 Å²	129	118.2 Å²	118.2	84%	0.838	57%	0.573	S	S	*	*			trans	-45.7	117.5	178.2	-5.4	2.5	0	0	0	107.2	S68	P66-S68 PolarHBondContact O-N 3.35Å; P66-S68 VanDerWaalsContact O-N 3.16Å
67	K	70.7	Confident	74.3	Confident	85 Å²	85	119.5 Å²	119.5	37%	0.37	57%	0.574	S	S	.	*			trans	-51.5	129.2	-173.4	-90.7	-175	165.9	176	0	107.5	S65 Y69 V72 E75	S65-K67 PolarHBondContact O-N 3.14Å; K67-Y69 PolarHBondContact O-N 2.72Å; K67-V72 HydrophobicContact CB-CG2 3.73Å; K67-V72 HydrophobicContact CD-CG2 4.23Å; K67-E75 WeakPolarHBondContact CE-OE1 3.45Å; K67-E75 IonicContact NZ-OE1 2.6Å; K67-E75 PolarHBondContact NZ-OE1 3.35Å; K67-E75 IonicContact NZ-OE2 2.66Å; K67-E75 PolarHBondContact NZ-OE2 3.18Å
68	S	82.5	Confident	76.1	Confident	64 Å²	64	123.4 Å²	123.4	45%	0.448	59%	0.587	S	S	.	*			trans	-60	142.5	177.1	177.3	0	0	0	0	108.3	P66 A70 E71 V72	P66-S68 PolarHBondContact O-N 3.35Å; P66-S68 VanDerWaalsContact O-N 3.16Å; S68-A70 PolarHBondContact O-N 3.3Å; S68-A70 VanDerWaalsContact O-N 3.1Å; S68-E71 PolarHBondContact N-OE2 2.81Å; S68-E71 WeakPolarHBondContact O-CB 3.36Å; S68-E71 PolarHBondContact O-N 3.08Å; S68-V72 PolarHBondContact O-N 3.09Å; S68-V72 VanDerWaalsContact O-N 3.16Å
69	Y	87.8	Confident	78	Confident	186 Å²	186	124.6 Å²	124.6	73%	0.729	59%	0.591	S	S	*	*	H	α-helix	trans	-52.3	-36.8	179.3	-179.8	-98.6	0	0	0	111.9	K67 E71 V72 Q73	K67-Y69 PolarHBondContact O-N 2.72Å; Y69-E71 PolarHBondContact O-N 3.36Å; Y69-V72 PolarHBondContact O-N 3.41Å; Y69-Q73 PolarHBondContact O-N 3.18Å
70	A	89.8	Confident	80	Confident	60 Å²	60	125.7 Å²	125.7	50%	0.496	59%	0.591	S	S	.	*	H	α-helix	trans	-62.7	-39.7	176	0	0	0	0	0	113.1	S68 Q73 A74	S68-A70 PolarHBondContact O-N 3.3Å; S68-A70 VanDerWaalsContact O-N 3.1Å; A70-Q73 PolarHBondContact O-N 2.83Å; A70-A74 WeakPolarHBondContact O-CB 3.42Å; A70-A74 PolarHBondContact O-N 3.41Å
71	E	88.1	Confident	82	Confident	97 Å²	97	117 Å²	117	45%	0.453	57%	0.567	S	S	.	*	H	α-helix	trans	-66.7	-42.9	177.6	-64.9	170.5	175.9	0	0	110.9	S68 Y69 Q73 A74 E75	S68-E71 PolarHBondContact N-OE2 2.81Å; S68-E71 WeakPolarHBondContact O-CB 3.36Å; S68-E71 PolarHBondContact O-N 3.08Å; Y69-E71 PolarHBondContact O-N 3.36Å; E71-Q73 VanDerWaalsContact C-N 3.3Å; E71-Q73 PolarHBondContact O-N 3.24Å; E71-A74 PolarHBondContact O-N 3.46Å; E71-E75 WeakPolarHBondContact O-CG 3.38Å; E71-E75 PolarHBondContact O-N 2.85Å
72	V	90.6	Very high	84.2	Confident	51 Å²	51	109.1 Å²	109.1	31%	0.309	54%	0.544	S	S	.	.	H	α-helix	trans	-61.7	-42.3	176.6	179.7	0	0	0	0	110.5	K67 S68 Y69 E75 Q76	K67-V72 HydrophobicContact CB-CG2 3.73Å; K67-V72 HydrophobicContact CD-CG2 4.23Å; S68-V72 PolarHBondContact O-N 3.09Å; S68-V72 VanDerWaalsContact O-N 3.16Å; Y69-V72 PolarHBondContact O-N 3.41Å; V72-E75 PolarHBondContact O-N 3.44Å; V72-Q76 WeakPolarHBondContact O-CB 3.41Å; V72-Q76 WeakPolarHBondContact O-CG 3.41Å; V72-Q76 PolarHBondContact O-N 3.05Å
73	Q	94	Very high	86.3	Confident	75 Å²	75	107.9 Å²	107.9	35%	0.35	54%	0.536	S	S	.	.	H	α-helix	trans	-66	-42.5	177.9	-167.2	177.6	37.5	0	0	111.9	Y69 A70 E71 Q76 R77	Y69-Q73 PolarHBondContact O-N 3.18Å; A70-Q73 PolarHBondContact O-N 2.83Å; E71-Q73 VanDerWaalsContact C-N 3.3Å; E71-Q73 PolarHBondContact O-N 3.24Å; Q73-Q76 PolarHBondContact O-N 2.86Å; Q73-R77 WeakPolarHBondContact O-CG 3.19Å; Q73-R77 PolarHBondContact O-N 3.03Å
74	A	92.8	Very high	88.2	Confident	58 Å²	58	101.9 Å²	101.9	48%	0.479	52%	0.518	S	S	.	.	H	α-helix	trans	-61.7	-43.8	175.8	0	0	0	0	0	111.8	A70 E71 Q76 R77 M78	A70-A74 WeakPolarHBondContact O-CB 3.42Å; A70-A74 PolarHBondContact O-N 3.41Å; E71-A74 PolarHBondContact O-N 3.46Å; A74-Q76 PolarHBondContact O-N 2.98Å; A74-R77 PolarHBondContact O-N 3.32Å; A74-M78 PolarHBondContact O-N 2.88Å
75	E	92.4	Very high	89.9	Confident	78 Å²	78	99.9 Å²	99.9	36%	0.364	51%	0.51	S	S	.	.	H	α-helix	trans	-63.5	-40.6	175.3	-75.1	-176.7	171	0	0	112.6	K67 E71 V72 R77 M78 K79	K67-E75 WeakPolarHBondContact CE-OE1 3.45Å; K67-E75 IonicContact NZ-OE1 2.6Å; K67-E75 PolarHBondContact NZ-OE1 3.35Å; K67-E75 IonicContact NZ-OE2 2.66Å; K67-E75 PolarHBondContact NZ-OE2 3.18Å; E71-E75 WeakPolarHBondContact O-CG 3.38Å; E71-E75 PolarHBondContact O-N 2.85Å; V72-E75 PolarHBondContact O-N 3.44Å; E75-R77 VanDerWaalsContact C-N 3.35Å; E75-M78 PolarHBondContact O-N 3.33Å; E75-K79 WeakPolarHBondContact O-CG 3.42Å; E75-K79 PolarHBondContact O-N 2.85Å
76	Q	95.8	Very high	91.4	Very high	97 Å²	97	104.7 Å²	104.7	45%	0.453	52%	0.515	S	S	.	.	H	α-helix	trans	-63.7	-41.5	176	-77.3	-176.6	3.5	0	0	111.7	V72 Q73 A74 M78 K79 R80	V72-Q76 WeakPolarHBondContact O-CB 3.41Å; V72-Q76 WeakPolarHBondContact O-CG 3.41Å; V72-Q76 PolarHBondContact O-N 3.05Å; Q73-Q76 PolarHBondContact O-N 2.86Å; A74-Q76 PolarHBondContact O-N 2.98Å; Q76-M78 VanDerWaalsContact C-N 3.34Å; Q76-K79 PolarHBondContact O-N 2.84Å; Q76-R80 WeakPolarHBondContact O-CG 3.49Å; Q76-R80 PolarHBondContact O-N 2.93Å
77	R	96.1	Very high	92.7	Very high	159 Å²	159	106 Å²	106	60%	0.6	50%	0.503	S	S	*	.	H	α-helix	trans	-60.8	-44.6	174.4	-71.9	175	-175.4	174.6	4.3	111.2	Q73 A74 E75 K79 R80 A81	Q73-R77 WeakPolarHBondContact O-CG 3.19Å; Q73-R77 PolarHBondContact O-N 3.03Å; A74-R77 PolarHBondContact O-N 3.32Å; E75-R77 VanDerWaalsContact C-N 3.35Å; R77-K79 VanDerWaalsContact C-N 3.34Å; R77-K79 PolarHBondContact O-N 3.12Å; R77-R80 PolarHBondContact O-N 3.15Å; R77-A81 WeakPolarHBondContact O-CB 3.18Å; R77-A81 PolarHBondContact O-N 3.22Å
78	M	95.9	Very high	93.9	Very high	146 Å²	146	106.6 Å²	106.6	72%	0.719	51%	0.507	S	S	*	.	H	α-helix	trans	-60.2	-43.6	176.5	-169.9	-163.9	-157.9	0	0	112	A74 E75 Q76 A81 A82	A74-M78 PolarHBondContact O-N 2.88Å; E75-M78 PolarHBondContact O-N 3.33Å; Q76-M78 VanDerWaalsContact C-N 3.34Å; M78-A81 PolarHBondContact O-N 3.41Å; M78-A82 WeakPolarHBondContact O-CB 3.3Å; M78-A82 PolarHBondContact O-N 2.86Å
79	K	96.3	Very high	94.6	Very high	150 Å²	150	110 Å²	110	65%	0.652	51%	0.511	S	S	*	.	H	α-helix	trans	-63.5	-42	177.1	-74.7	179.3	-179.4	-177.5	0	112.2	E75 Q76 R77 A82 S83	E75-K79 WeakPolarHBondContact O-CG 3.42Å; E75-K79 PolarHBondContact O-N 2.85Å; Q76-K79 PolarHBondContact O-N 2.84Å; R77-K79 VanDerWaalsContact C-N 3.34Å; R77-K79 PolarHBondContact O-N 3.12Å; K79-A82 PolarHBondContact O-N 3.46Å; K79-S83 WeakPolarHBondContact O-CB 3.37Å; K79-S83 PolarHBondContact O-N 3.06Å
80	R	96.6	Very high	95	Very high	157 Å²	157	106.1 Å²	106.1	59%	0.592	50%	0.503	S	S	*	.	H	α-helix	trans	-63.6	-49.5	175.7	-69.7	-179.2	-159.7	-166.7	5	111.2	Q76 R77 A82 S83 E84	Q76-R80 WeakPolarHBondContact O-CG 3.49Å; Q76-R80 PolarHBondContact O-N 2.93Å; R77-R80 PolarHBondContact O-N 3.15Å; R80-A82 VanDerWaalsContact C-N 3.26Å; R80-A82 PolarHBondContact O-N 2.83Å; R80-S83 CarbonylContact O-C 3.3Å; R80-S83 WeakPolarHBondContact O-CA 3.24Å; R80-S83 VanDerWaalsContact O-CB 3.3Å; R80-S83 WeakPolarHBondContact O-CB 3.35Å; R80-S83 PolarHBondContact O-N 3.12Å; R80-E84 WeakPolarHBondContact O-CB 3.48Å; R80-E84 WeakPolarHBondContact O-CG 3.43Å; R80-E84 PolarHBondContact O-N 2.98Å
81	A	97	Very high	95.3	Very high	42 Å²	42	106.4 Å²	106.4	35%	0.347	49%	0.494	S	S	.	.	H	α-helix	trans	-61.3	-33	177.5	0	0	0	0	0	113.2	R77 M78 R85	R77-A81 WeakPolarHBondContact O-CB 3.18Å; R77-A81 PolarHBondContact O-N 3.22Å; M78-A81 PolarHBondContact O-N 3.41Å; A81-R85 WeakPolarHBondContact O-CG 3.39Å; A81-R85 PolarHBondContact O-N 3.43Å; A81-R85 VanDerWaalsContact O-N 3.15Å; A81-R85 PolarHBondContact O-NE 3.02Å
82	A	97.2	Very high	95.7	Very high	33 Å²	33	107.1 Å²	107.1	27%	0.273	50%	0.498	S	S	.	.	H	α-helix	trans	-72.8	-36.3	173.8	0	0	0	0	0	112.5	M78 K79 R80 R86	M78-A82 WeakPolarHBondContact O-CB 3.3Å; M78-A82 PolarHBondContact O-N 2.86Å; K79-A82 PolarHBondContact O-N 3.46Å; R80-A82 VanDerWaalsContact C-N 3.26Å; R80-A82 PolarHBondContact O-N 2.83Å; A82-R86 WeakPolarHBondContact O-CG 3.48Å; A82-R86 PolarHBondContact O-N 2.99Å
83	S	97.4	Very high	95.8	Very high	74 Å²	74	108.8 Å²	108.8	52%	0.517	50%	0.502	S	S	.	.	H	α-helix	trans	-65.9	-45.5	173.5	172.7	0	0	0	0	111.5	K79 R80 R86 R87	K79-S83 WeakPolarHBondContact O-CB 3.37Å; K79-S83 PolarHBondContact O-N 3.06Å; R80-S83 CarbonylContact O-C 3.3Å; R80-S83 WeakPolarHBondContact O-CA 3.24Å; R80-S83 VanDerWaalsContact O-CB 3.3Å; R80-S83 WeakPolarHBondContact O-CB 3.35Å; R80-S83 PolarHBondContact O-N 3.12Å; S83-R86 PolarHBondContact O-N 3.31Å; S83-R87 PolarHBondContact O-N 3.19Å
84	E	96.9	Very high	95.8	Very high	106 Å²	106	111.9 Å²	111.9	50%	0.495	51%	0.511	S	S	.	.	H	α-helix	trans	-60.1	-51.3	178.4	-74.6	161.9	-176.9	0	0	110.5	R80 R86 R87 E88	R80-E84 WeakPolarHBondContact O-CB 3.48Å; R80-E84 WeakPolarHBondContact O-CG 3.43Å; R80-E84 PolarHBondContact O-N 2.98Å; E84-R86 VanDerWaalsContact C-N 3.27Å; E84-R86 PolarHBondContact O-N 3.16Å; E84-R87 CarbonylContact O-C 3.5Å; E84-R87 WeakPolarHBondContact O-CA 3.25Å; E84-R87 WeakPolarHBondContact O-CB 3.3Å; E84-R87 PolarHBondContact O-N 3.39Å; E84-E88 WeakPolarHBondContact O-CG 3.35Å; E84-E88 PolarHBondContact O-N 3.41Å
85	R	96.8	Very high	96	Very high	162 Å²	162	113 Å²	113	61%	0.611	51%	0.509	S	S	*	.	H	α-helix	trans	-57	-36.9	176.6	-75.7	-174.9	-67.5	139.6	-7.3	114.2	A81 R87 Y89	A81-R85 WeakPolarHBondContact O-CG 3.39Å; A81-R85 PolarHBondContact O-N 3.43Å; A81-R85 VanDerWaalsContact O-N 3.15Å; A81-R85 PolarHBondContact O-NE 3.02Å; R85-R87 VanDerWaalsContact C-N 3.35Å; R85-Y89 WeakPolarHBondContact O-CB 3.42Å; R85-Y89 PolarHBondContact O-N 2.99Å; R85-Y89 VanDerWaalsContact O-N 3.09Å
86	R	95.2	Very high	96	Very high	190 Å²	190	114.3 Å²	114.3	72%	0.717	52%	0.515	S	S	*	.	H	α-helix	trans	-69.4	-36.6	175.8	-77	178.4	177.3	-175.3	-1.7	111.9	A82 S83 E84 N90	A82-R86 WeakPolarHBondContact O-CG 3.48Å; A82-R86 PolarHBondContact O-N 2.99Å; S83-R86 PolarHBondContact O-N 3.31Å; E84-R86 VanDerWaalsContact C-N 3.27Å; E84-R86 PolarHBondContact O-N 3.16Å; R86-N90 PolarHBondContact O-N 3.45Å; R86-N90 PolarHBondContact O-ND2 2.91Å
87	R	97.4	Very high	95.9	Very high	155 Å²	155	117 Å²	117	59%	0.585	52%	0.521	S	S	*	.	H	α-helix	trans	-68.8	-49.5	177.2	-179.7	-178.3	170.6	-161.1	-11.5	110.6	S83 E84 R85 Y89 N90 E91	S83-R87 PolarHBondContact O-N 3.19Å; E84-R87 CarbonylContact O-C 3.5Å; E84-R87 WeakPolarHBondContact O-CA 3.25Å; E84-R87 WeakPolarHBondContact O-CB 3.3Å; E84-R87 PolarHBondContact O-N 3.39Å; R85-R87 VanDerWaalsContact C-N 3.35Å; R87-Y89 VanDerWaalsContact C-N 3.34Å; R87-Y89 PolarHBondContact O-N 2.69Å; R87-N90 PolarHBondContact O-N 3.5Å; R87-N90 VanDerWaalsContact O-N 3.09Å; R87-E91 HydrophobicContact CG-CG 4.35Å; R87-E91 IonicContact CZ-OE1 3.2Å; R87-E91 IonicContact NE-OE1 2.72Å; R87-E91 PolarHBondContact NE-OE1 3.23Å; R87-E91 IonicContact NE-OE2 3.82Å; R87-E91 IonicContact NH2-OE1 2.81Å; R87-E91 PolarHBondContact NH2-OE1 3.44Å; R87-E91 WeakPolarHBondContact O-CG 3.43Å; R87-E91 PolarHBondContact O-N 2.97Å
88	E	96	Very high	95.7	Very high	99 Å²	99	114.3 Å²	114.3	46%	0.463	52%	0.516	S	S	.	.	H	α-helix	trans	-54.3	-50.1	176.5	-71.9	167.4	178.8	0	0	110.7	E84 N90 E91 E92	E84-E88 WeakPolarHBondContact O-CG 3.35Å; E84-E88 PolarHBondContact O-N 3.41Å; E88-N90 VanDerWaalsContact C-N 3.3Å; E88-N90 PolarHBondContact O-N 2.95Å; E88-E91 PolarHBondContact O-N 3.37Å; E88-E91 VanDerWaalsContact O-N 3.13Å; E88-E92 WeakPolarHBondContact O-CB 3.34Å; E88-E92 WeakPolarHBondContact O-CG 3.25Å; E88-E92 PolarHBondContact O-N 2.9Å
89	Y	96.5	Very high	95.6	Very high	135 Å²	135	111.5 Å²	111.5	53%	0.529	50%	0.504	S	S	.	.	H	α-helix	trans	-56.4	-42.8	176	176.6	-96.8	0	0	0	113	R85 R87 Q93	R85-Y89 WeakPolarHBondContact O-CB 3.42Å; R85-Y89 PolarHBondContact O-N 2.99Å; R85-Y89 VanDerWaalsContact O-N 3.09Å; R87-Y89 VanDerWaalsContact C-N 3.34Å; R87-Y89 PolarHBondContact O-N 2.69Å; Y89-Q93 HydrophobicContact CD1-CG 4.44Å; Y89-Q93 HydrophobicContact CE1-CG 4.02Å; Y89-Q93 HydrophobicContact CE2-CG 4.28Å; Y89-Q93 VanDerWaalsContact O-CG 3.24Å; Y89-Q93 WeakPolarHBondContact O-CG 3.29Å; Y89-Q93 PolarHBondContact O-N 3.44Å
90	N	96.1	Very high	95.3	Very high	104 Å²	104	112.6 Å²	112.6	56%	0.556	51%	0.505	S	S	*	.	H	α-helix	trans	-71.7	-34	179.1	-69.8	-17.8	0	0	0	112.5	R86 R87 E88 R94	R86-N90 PolarHBondContact O-N 3.45Å; R86-N90 PolarHBondContact O-ND2 2.91Å; R87-N90 PolarHBondContact O-N 3.5Å; R87-N90 VanDerWaalsContact O-N 3.09Å; E88-N90 VanDerWaalsContact C-N 3.3Å; E88-N90 PolarHBondContact O-N 2.95Å; N90-R94 PolarHBondContact O-N 2.84Å
91	E	96.4	Very high	95.1	Very high	66 Å²	66	109.1 Å²	109.1	31%	0.308	50%	0.498	S	S	.	.	H	α-helix	trans	-67.6	-47.7	175	-74.8	175.1	170.7	0	0	109.9	R87 E88 Q93 R94 D95	R87-E91 HydrophobicContact CG-CG 4.35Å; R87-E91 IonicContact CZ-OE1 3.2Å; R87-E91 IonicContact NE-OE1 2.72Å; R87-E91 PolarHBondContact NE-OE1 3.23Å; R87-E91 IonicContact NE-OE2 3.82Å; R87-E91 IonicContact NH2-OE1 2.81Å; R87-E91 PolarHBondContact NH2-OE1 3.44Å; R87-E91 WeakPolarHBondContact O-CG 3.43Å; R87-E91 PolarHBondContact O-N 2.97Å; E88-E91 PolarHBondContact O-N 3.37Å; E88-E91 VanDerWaalsContact O-N 3.13Å; E91-Q93 VanDerWaalsContact C-N 3.34Å; E91-Q93 PolarHBondContact O-N 3.34Å; E91-R94 PolarHBondContact O-N 2.95Å; E91-R94 VanDerWaalsContact O-N 3.08Å; E91-D95 WeakPolarHBondContact O-CB 3.16Å; E91-D95 VanDerWaalsContact O-CG 3.22Å; E91-D95 PolarHBondContact O-N 3.05Å
92	E	95.6	Very high	94.8	Very high	113 Å²	113	111.9 Å²	111.9	53%	0.528	50%	0.504	S	S	.	.	H	α-helix	trans	-55.3	-46.8	174.2	-74.4	174.7	177	0	0	111.8	E88 R94 D95 E96	E88-E92 WeakPolarHBondContact O-CB 3.34Å; E88-E92 WeakPolarHBondContact O-CG 3.25Å; E88-E92 PolarHBondContact O-N 2.9Å; E92-R94 VanDerWaalsContact C-N 3.29Å; E92-R94 PolarHBondContact O-N 2.77Å; E92-D95 PolarHBondContact O-N 3.23Å; E92-E96 WeakPolarHBondContact O-CB 3.35Å; E92-E96 VanDerWaalsContact O-CG 3.3Å; E92-E96 WeakPolarHBondContact O-CG 3.42Å; E92-E96 PolarHBondContact O-N 3.5Å
93	Q	93.6	Very high	94.4	Very high	86 Å²	86	115.9 Å²	115.9	40%	0.402	52%	0.516	S	S	.	.	H	α-helix	trans	-63.2	-34.1	178	-72.3	-62.2	-76.8	0	0	113.3	Y89 E91 E96 Y97	Y89-Q93 HydrophobicContact CD1-CG 4.44Å; Y89-Q93 HydrophobicContact CE1-CG 4.02Å; Y89-Q93 HydrophobicContact CE2-CG 4.28Å; Y89-Q93 VanDerWaalsContact O-CG 3.24Å; Y89-Q93 WeakPolarHBondContact O-CG 3.29Å; Y89-Q93 PolarHBondContact O-N 3.44Å; E91-Q93 VanDerWaalsContact C-N 3.34Å; E91-Q93 PolarHBondContact O-N 3.34Å; Q93-E96 PolarHBondContact NE2-OE2 2.91Å; Q93-Y97 PolarHBondContact O-N 3.4Å
94	R	94.3	Very high	94.1	Very high	140 Å²	140	118.1 Å²	118.1	53%	0.528	52%	0.523	S	S	.	.	H	α-helix	trans	-73.8	-44.4	176.1	-167.2	-172.1	71.1	-158.8	-5.4	110.8	N90 E91 E92 Y97 E98	N90-R94 PolarHBondContact O-N 2.84Å; E91-R94 PolarHBondContact O-N 2.95Å; E91-R94 VanDerWaalsContact O-N 3.08Å; E92-R94 VanDerWaalsContact C-N 3.29Å; E92-R94 PolarHBondContact O-N 2.77Å; R94-Y97 WeakPolarHBondContact O-CB 3.32Å; R94-Y97 PolarHBondContact O-N 3.36Å; R94-E98 IonicContact NE-OE1 3.41Å; R94-E98 PolarHBondContact NE-OE1 3.28Å; R94-E98 WeakPolarHBondContact O-CG 3.3Å; R94-E98 PolarHBondContact O-N 2.95Å
95	D	96	Very high	93.8	Very high	82 Å²	82	120.4 Å²	120.4	44%	0.439	53%	0.527	S	S	.	.	H	α-helix	trans	-66.9	-38.9	-177.7	-67.6	-4.7	0	0	0	111	E91 E92 Y97 E98 N99	E91-D95 WeakPolarHBondContact O-CB 3.16Å; E91-D95 VanDerWaalsContact O-CG 3.22Å; E91-D95 PolarHBondContact O-N 3.05Å; E92-D95 PolarHBondContact O-N 3.23Å; D95-Y97 VanDerWaalsContact C-N 3.33Å; D95-Y97 PolarHBondContact O-N 2.85Å; D95-E98 PolarHBondContact O-N 3.44Å; D95-N99 WeakPolarHBondContact O-CB 3.43Å; D95-N99 PolarHBondContact O-N 3.23Å
96	E	93.7	Very high	93.7	Very high	105 Å²	105	117.1 Å²	117.1	49%	0.491	52%	0.521	S	S	.	.	H	α-helix	trans	-58	-44.7	170.9	-77.8	176.8	179.3	0	0	111.5	E92 Q93 N99 Y100	E92-E96 WeakPolarHBondContact O-CB 3.35Å; E92-E96 VanDerWaalsContact O-CG 3.3Å; E92-E96 WeakPolarHBondContact O-CG 3.42Å; E92-E96 PolarHBondContact O-N 3.5Å; Q93-E96 PolarHBondContact NE2-OE2 2.91Å; E96-N99 PolarHBondContact O-N 3.14Å; E96-Y100 WeakPolarHBondContact O-CD2 3.45Å; E96-Y100 PolarHBondContact O-N 2.99Å
97	Y	92.3	Very high	93.5	Very high	152 Å²	152	110.1 Å²	110.1	60%	0.596	50%	0.504	S	S	*	.	H	α-helix	trans	-66.4	-44.6	178.9	178.7	-102.1	0	0	0	112.5	Q93 R94 D95 N99 Y100 L101	Q93-Y97 PolarHBondContact O-N 3.4Å; R94-Y97 WeakPolarHBondContact O-CB 3.32Å; R94-Y97 PolarHBondContact O-N 3.36Å; D95-Y97 VanDerWaalsContact C-N 3.33Å; D95-Y97 PolarHBondContact O-N 2.85Å; Y97-N99 VanDerWaalsContact C-N 3.32Å; Y97-Y100 PolarHBondContact O-N 3.32Å; Y97-L101 HydrophobicContact CD1-CD1 4.02Å; Y97-L101 HydrophobicContact CE1-CD1 3.39Å; Y97-L101 HydrophobicContact CE1-CG 4.25Å; Y97-L101 HydrophobicContact CE2-CD1 4.42Å; Y97-L101 WeakPolarHBondContact O-CG 3.23Å; Y97-L101 PolarHBondContact O-N 2.93Å; Y97-L101 VanDerWaalsContact O-N 3.16Å
98	E	92.6	Very high	93.1	Very high	104 Å²	104	107.8 Å²	107.8	49%	0.486	50%	0.5	S	S	.	.	H	α-helix	trans	-62.9	-40.7	176.1	-73.1	179.4	-166.7	0	0	111.3	R94 D95 L101 E102	R94-E98 IonicContact NE-OE1 3.41Å; R94-E98 PolarHBondContact NE-OE1 3.28Å; R94-E98 WeakPolarHBondContact O-CG 3.3Å; R94-E98 PolarHBondContact O-N 2.95Å; D95-E98 PolarHBondContact O-N 3.44Å; E98-L101 PolarHBondContact O-N 2.82Å; E98-E102 PolarHBondContact O-N 2.93Å
99	N	94.4	Very high	93	Very high	87 Å²	87	106.2 Å²	106.2	47%	0.465	50%	0.497	S	S	.	.	H	α-helix	trans	-62.3	-47.4	176.6	-170.7	-44.6	0	0	0	111.6	D95 E96 Y97 L101 E102 E103	D95-N99 WeakPolarHBondContact O-CB 3.43Å; D95-N99 PolarHBondContact O-N 3.23Å; E96-N99 PolarHBondContact O-N 3.14Å; Y97-N99 VanDerWaalsContact C-N 3.32Å; N99-L101 VanDerWaalsContact C-N 3.29Å; N99-L101 PolarHBondContact O-N 3.44Å; N99-E102 PolarHBondContact O-N 3.37Å; N99-E102 VanDerWaalsContact O-N 3.12Å; N99-E103 PolarHBondContact O-N 2.98Å; N99-E103 WeakPolarHBondContact OD1-CG 3.41Å; N99-E103 PolarHBondContact OD1-OE1 3.09Å
100	Y	90.3	Very high	92.8	Very high	172 Å²	172	103.5 Å²	103.5	68%	0.675	49%	0.491	S	S	*	.	H	α-helix	trans	-56.3	-42.4	175.5	-102.4	-81.2	0	0	0	113	E96 Y97 D104	E96-Y100 WeakPolarHBondContact O-CD2 3.45Å; E96-Y100 PolarHBondContact O-N 2.99Å; Y97-Y100 PolarHBondContact O-N 3.32Å; Y100-D104 WeakPolarHBondContact O-CB 3.38Å; Y100-D104 PolarHBondContact O-N 3.22Å
101	L	91.2	Very high	92.5	Very high	84 Å²	84	104.2 Å²	104.2	44%	0.44	49%	0.491	S	S	.	.	H	α-helix	trans	-68.9	-35.7	178.3	-71.8	178.8	0	0	0	112.7	Y97 E98 N99 R105	Y97-L101 HydrophobicContact CD1-CD1 4.02Å; Y97-L101 HydrophobicContact CE1-CD1 3.39Å; Y97-L101 HydrophobicContact CE1-CG 4.25Å; Y97-L101 HydrophobicContact CE2-CD1 4.42Å; Y97-L101 WeakPolarHBondContact O-CG 3.23Å; Y97-L101 PolarHBondContact O-N 2.93Å; Y97-L101 VanDerWaalsContact O-N 3.16Å; E98-L101 PolarHBondContact O-N 2.82Å; N99-L101 VanDerWaalsContact C-N 3.29Å; N99-L101 PolarHBondContact O-N 3.44Å; L101-R105 WeakPolarHBondContact O-CB 3.26Å; L101-R105 PolarHBondContact O-N 3.17Å; L101-R105 VanDerWaalsContact O-N 3.14Å
102	E	90.7	Very high	92.4	Very high	101 Å²	101	107.3 Å²	107.3	47%	0.472	50%	0.5	S	S	.	.	H	α-helix	trans	-71.1	-44.3	177	-163.2	72.2	177.4	0	0	110.7	E98 N99 D104 R105 D106	E98-E102 PolarHBondContact O-N 2.93Å; N99-E102 PolarHBondContact O-N 3.37Å; N99-E102 VanDerWaalsContact O-N 3.12Å; E102-D104 PolarHBondContact O-N 3.48Å; E102-R105 PolarHBondContact O-N 3.14Å; E102-D106 WeakPolarHBondContact O-CB 3.45Å; E102-D106 PolarHBondContact O-N 3.02Å
103	E	89.6	Confident	92.2	Very high	116 Å²	116	104.3 Å²	104.3	54%	0.542	49%	0.492	S	S	.	.	H	α-helix	trans	-58.7	-44.6	175	-77.5	-173.6	171.6	0	0	111.9	N99 D106 A107	N99-E103 PolarHBondContact O-N 2.98Å; N99-E103 WeakPolarHBondContact OD1-CG 3.41Å; N99-E103 PolarHBondContact OD1-OE1 3.09Å; E103-D106 PolarHBondContact O-N 3.4Å; E103-A107 WeakPolarHBondContact O-CB 3.37Å; E103-A107 PolarHBondContact O-N 2.96Å
104	D	90.1	Very high	92.2	Very high	122 Å²	122	107.2 Å²	107.2	65%	0.652	50%	0.499	S	S	*	.	H	α-helix	trans	-64.1	-42.7	178.6	-164.2	48.5	0	0	0	111.3	Y100 E102 E108	Y100-D104 WeakPolarHBondContact O-CB 3.38Å; Y100-D104 PolarHBondContact O-N 3.22Å; E102-D104 PolarHBondContact O-N 3.48Å; D104-E108 WeakPolarHBondContact O-CB 3.26Å; D104-E108 PolarHBondContact O-N 2.73Å
105	R	92.1	Very high	92.1	Very high	154 Å²	154	105.7 Å²	105.7	58%	0.581	50%	0.498	S	S	*	.	H	α-helix	trans	-65	-46.8	176.4	-176.5	-173.4	-61.4	-154.4	2	112.1	L101 E102 A107 E108 V109	L101-R105 WeakPolarHBondContact O-CB 3.26Å; L101-R105 PolarHBondContact O-N 3.17Å; L101-R105 VanDerWaalsContact O-N 3.14Å; E102-R105 PolarHBondContact O-N 3.14Å; R105-A107 VanDerWaalsContact C-N 3.33Å; R105-E108 PolarHBondContact O-N 2.94Å; R105-V109 WeakPolarHBondContact O-CB 3.42Å; R105-V109 VanDerWaalsContact O-CG2 3.26Å; R105-V109 WeakPolarHBondContact O-CG2 3.31Å; R105-V109 PolarHBondContact O-N 3.02Å
106	D	92.8	Very high	91.9	Very high	92 Å²	92	105 Å²	105	49%	0.492	50%	0.497	S	S	.	.	H	α-helix	trans	-66.4	-38.2	-179.9	-82.5	-10.5	0	0	0	111.2	E102 E103 N110	E102-D106 WeakPolarHBondContact O-CB 3.45Å; E102-D106 PolarHBondContact O-N 3.02Å; E103-D106 PolarHBondContact O-N 3.4Å; D106-N110 WeakPolarHBondContact O-CB 3.3Å; D106-N110 PolarHBondContact O-N 3.09Å
107	A	90.9	Very high	91.7	Very high	43 Å²	43	105 Å²	105	36%	0.355	50%	0.5	S	S	.	.	H	α-helix	trans	-60.8	-50.6	172.5	0	0	0	0	0	111	E103 R105 V109 N110 E111	E103-A107 WeakPolarHBondContact O-CB 3.37Å; E103-A107 PolarHBondContact O-N 2.96Å; R105-A107 VanDerWaalsContact C-N 3.33Å; A107-V109 PolarHBondContact O-N 2.82Å; A107-N110 PolarHBondContact O-N 2.86Å; A107-E111 WeakPolarHBondContact O-CB 3.37Å; A107-E111 WeakPolarHBondContact O-CG 3.22Å; A107-E111 PolarHBondContact O-N 3.46Å
108	E	90.9	Very high	91.6	Very high	107 Å²	107	103.9 Å²	103.9	50%	0.5	50%	0.501	S	S	.	.	H	α-helix	trans	-59	-45.7	178.7	-166.6	-154	167.3	0	0	111.7	D104 R105 N110 E111 R112	D104-E108 WeakPolarHBondContact O-CB 3.26Å; D104-E108 PolarHBondContact O-N 2.73Å; R105-E108 PolarHBondContact O-N 2.94Å; E108-N110 PolarHBondContact O-N 3.32Å; E108-E111 PolarHBondContact O-N 2.95Å; E108-R112 VanDerWaalsContact CD-NH2 3.29Å; E108-R112 WeakPolarHBondContact O-CB 3.35Å; E108-R112 PolarHBondContact O-N 3.5Å; E108-R112 IonicContact OE1-CZ 3.79Å; E108-R112 IonicContact OE1-NH2 2.65Å; E108-R112 PolarHBondContact OE1-NH2 3.17Å; E108-R112 IonicContact OE2-NH2 3.7Å
109	V	92.1	Very high	91.4	Very high	65 Å²	65	104.7 Å²	104.7	39%	0.394	50%	0.504	S	S	.	.	H	α-helix	trans	-65.3	-40.5	179.5	170.6	0	0	0	0	111.1	R105 A107 S113	R105-V109 WeakPolarHBondContact O-CB 3.42Å; R105-V109 VanDerWaalsContact O-CG2 3.26Å; R105-V109 WeakPolarHBondContact O-CG2 3.31Å; R105-V109 PolarHBondContact O-N 3.02Å; A107-V109 PolarHBondContact O-N 2.82Å; V109-S113 VanDerWaalsContact O-CB 3.26Å; V109-S113 WeakPolarHBondContact O-CB 3.33Å; V109-S113 PolarHBondContact O-N 3.42Å; V109-S113 PolarHBondContact O-OG 3.29Å
110	N	92.5	Very high	91.2	Very high	78 Å²	78	105.2 Å²	105.2	42%	0.417	51%	0.507	S	S	.	.	H	α-helix	trans	-66.7	-45	177.6	-169.3	-6.7	0	0	0	111.1	D106 A107 E108 S113 R114	D106-N110 WeakPolarHBondContact O-CB 3.3Å; D106-N110 PolarHBondContact O-N 3.09Å; A107-N110 PolarHBondContact O-N 2.86Å; E108-N110 PolarHBondContact O-N 3.32Å; N110-S113 PolarHBondContact O-N 3.17Å; N110-R114 VanDerWaalsContact O-CG 3.29Å; N110-R114 WeakPolarHBondContact O-CG 3.26Å; N110-R114 PolarHBondContact O-N 2.87Å; N110-R114 PolarHBondContact OD1-NE 3.06Å
111	E	91.2	Very high	91	Very high	119 Å²	119	104.5 Å²	104.5	56%	0.556	50%	0.503	S	S	*	.	H	α-helix	trans	-59.9	-49.9	175.8	-73.9	-177.8	177.7	0	0	111.4	A107 E108 S113 R114 E115	A107-E111 WeakPolarHBondContact O-CB 3.37Å; A107-E111 WeakPolarHBondContact O-CG 3.22Å; A107-E111 PolarHBondContact O-N 3.46Å; E108-E111 PolarHBondContact O-N 2.95Å; E111-S113 VanDerWaalsContact C-N 3.26Å; E111-S113 PolarHBondContact O-N 2.89Å; E111-R114 WeakPolarHBondContact O-CB 3.38Å; E111-R114 PolarHBondContact O-N 3.5Å; E111-E115 WeakPolarHBondContact O-CG 3.49Å; E111-E115 PolarHBondContact O-N 2.92Å
112	R	92.7	Very high	90.6	Very high	131 Å²	131	107.8 Å²	107.8	49%	0.494	52%	0.516	S	S	.	.	H	α-helix	trans	-58.3	-39.7	175.7	-168.1	-169.7	-58	155.2	0.9	112.2	E108 T116	E108-R112 VanDerWaalsContact CD-NH2 3.29Å; E108-R112 WeakPolarHBondContact O-CB 3.35Å; E108-R112 PolarHBondContact O-N 3.5Å; E108-R112 IonicContact OE1-CZ 3.79Å; E108-R112 IonicContact OE1-NH2 2.65Å; E108-R112 PolarHBondContact OE1-NH2 3.17Å; E108-R112 IonicContact OE2-NH2 3.7Å; R112-T116 WeakPolarHBondContact O-CB 3.43Å; R112-T116 WeakPolarHBondContact O-CG2 3.44Å; R112-T116 PolarHBondContact O-N 3.27Å; R112-T116 PolarHBondContact O-OG1 2.65Å
113	S	93	Very high	90.3	Very high	51 Å²	51	112 Å²	112	36%	0.357	53%	0.529	S	S	.	.	H	α-helix	trans	-68.9	-35.5	177.5	-61.3	0	0	0	0	111.9	V109 N110 E111 T116 N117	V109-S113 VanDerWaalsContact O-CB 3.26Å; V109-S113 WeakPolarHBondContact O-CB 3.33Å; V109-S113 PolarHBondContact O-N 3.42Å; V109-S113 PolarHBondContact O-OG 3.29Å; N110-S113 PolarHBondContact O-N 3.17Å; E111-S113 VanDerWaalsContact C-N 3.26Å; E111-S113 PolarHBondContact O-N 2.89Å; S113-T116 WeakPolarHBondContact CA-OG1 3.36Å; S113-T116 PolarHBondContact O-OG1 3.49Å; S113-N117 WeakPolarHBondContact O-CB 3.36Å; S113-N117 PolarHBondContact O-N 2.91Å; S113-N117 VanDerWaalsContact O-N 3.14Å; S113-N117 PolarHBondContact O-ND2 3.03Å
114	R	92.9	Very high	89.8	Confident	147 Å²	147	112.8 Å²	112.8	56%	0.555	53%	0.532	S	S	*	.	H	α-helix	trans	-66.6	-50.6	174.8	-74.2	172.1	-177.5	-170.4	-4	111	N110 E111 T116 N117 E118	N110-R114 VanDerWaalsContact O-CG 3.29Å; N110-R114 WeakPolarHBondContact O-CG 3.26Å; N110-R114 PolarHBondContact O-N 2.87Å; N110-R114 PolarHBondContact OD1-NE 3.06Å; E111-R114 WeakPolarHBondContact O-CB 3.38Å; E111-R114 PolarHBondContact O-N 3.5Å; R114-T116 VanDerWaalsContact C-N 3.33Å; R114-T116 PolarHBondContact O-N 3.37Å; R114-N117 PolarHBondContact O-N 3.26Å; R114-N117 VanDerWaalsContact O-N 3.17Å; R114-E118 WeakPolarHBondContact O-CG 3.36Å; R114-E118 PolarHBondContact O-N 3.38Å
115	E	91.9	Very high	89.2	Confident	107 Å²	107	112.8 Å²	112.8	50%	0.5	52%	0.524	S	S	.	.	H	α-helix	trans	-57.5	-45.3	178.9	-70.4	178.8	174.5	0	0	112	E111 N117 E118 Q119	E111-E115 WeakPolarHBondContact O-CG 3.49Å; E111-E115 PolarHBondContact O-N 2.92Å; E115-N117 PolarHBondContact O-N 3.26Å; E115-E118 PolarHBondContact O-N 3.02Å; E115-Q119 WeakPolarHBondContact O-CB 3.44Å; E115-Q119 VanDerWaalsContact O-CG 3.3Å; E115-Q119 WeakPolarHBondContact O-CG 3.32Å; E115-Q119 PolarHBondContact O-N 3.09Å
116	T	92.3	Very high	88.6	Confident	67 Å²	67	109.8 Å²	109.8	41%	0.411	52%	0.519	S	S	.	.	H	α-helix	trans	-64.5	-39.7	178.3	46.6	0	0	0	0	112.3	R112 S113 R114 L120	R112-T116 WeakPolarHBondContact O-CB 3.43Å; R112-T116 WeakPolarHBondContact O-CG2 3.44Å; R112-T116 PolarHBondContact O-N 3.27Å; R112-T116 PolarHBondContact O-OG1 2.65Å; S113-T116 WeakPolarHBondContact CA-OG1 3.36Å; S113-T116 PolarHBondContact O-OG1 3.49Å; R114-T116 VanDerWaalsContact C-N 3.33Å; R114-T116 PolarHBondContact O-N 3.37Å; T116-L120 WeakPolarHBondContact O-CG 3.48Å; T116-L120 PolarHBondContact O-N 2.92Å
117	N	89.9	Confident	87.6	Confident	105 Å²	105	107.9 Å²	107.9	56%	0.561	52%	0.521	S	S	*	.	H	α-helix	trans	-66.2	-39.3	174.3	-81	-55.9	0	0	0	112.4	S113 R114 E115 L120 R121	S113-N117 WeakPolarHBondContact O-CB 3.36Å; S113-N117 PolarHBondContact O-N 2.91Å; S113-N117 VanDerWaalsContact O-N 3.14Å; S113-N117 PolarHBondContact O-ND2 3.03Å; R114-N117 PolarHBondContact O-N 3.26Å; R114-N117 VanDerWaalsContact O-N 3.17Å; E115-N117 PolarHBondContact O-N 3.26Å; N117-L120 PolarHBondContact O-N 3.42Å; N117-R121 VanDerWaalsContact O-CB 3.31Å; N117-R121 WeakPolarHBondContact O-CB 3.45Å; N117-R121 PolarHBondContact O-N 3.02Å
118	E	88.5	Confident	86.7	Confident	130 Å²	130	111.2 Å²	111.2	61%	0.607	53%	0.533	S	S	*	.	H	α-helix	trans	-65.6	-43.7	176	-74	177.6	-178.2	0	0	111.7	R114 E115 L120 R121 E122	R114-E118 WeakPolarHBondContact O-CG 3.36Å; R114-E118 PolarHBondContact O-N 3.38Å; E115-E118 PolarHBondContact O-N 3.02Å; E118-L120 PolarHBondContact O-N 3Å; E118-R121 WeakPolarHBondContact O-CB 3.28Å; E118-R121 PolarHBondContact O-N 3.03Å; E118-E122 PolarHBondContact O-N 2.95Å
119	Q	90.2	Very high	85.5	Confident	121 Å²	121	113.2 Å²	113.2	57%	0.565	54%	0.537	S	S	*	.	H	α-helix	trans	-61.5	-44	175.2	-73.2	176.9	37.5	0	0	112.2	E115 R121 E122 Y123	E115-Q119 WeakPolarHBondContact O-CB 3.44Å; E115-Q119 VanDerWaalsContact O-CG 3.3Å; E115-Q119 WeakPolarHBondContact O-CG 3.32Å; E115-Q119 PolarHBondContact O-N 3.09Å; Q119-R121 VanDerWaalsContact C-N 3.3Å; Q119-R121 PolarHBondContact O-N 3.32Å; Q119-E122 PolarHBondContact O-N 3.5Å; Q119-Y123 WeakPolarHBondContact O-CB 3.2Å; Q119-Y123 PolarHBondContact O-N 3.34Å
120	L	89.1	Confident	84.2	Confident	98 Å²	98	113.7 Å²	113.7	51%	0.513	54%	0.541	S	S	.	.	H	α-helix	trans	-61.1	-42.1	174.3	-78	170.4	0	0	0	111.2	T116 N117 E118 E122 Y123 H124	T116-L120 WeakPolarHBondContact O-CG 3.48Å; T116-L120 PolarHBondContact O-N 2.92Å; N117-L120 PolarHBondContact O-N 3.42Å; E118-L120 PolarHBondContact O-N 3Å; L120-E122 VanDerWaalsContact C-N 3.34Å; L120-E122 PolarHBondContact O-N 3.14Å; L120-Y123 PolarHBondContact O-N 3.46Å; L120-H124 WeakPolarHBondContact O-CB 3.49Å; L120-H124 PolarHBondContact O-CD2 2.9Å; L120-H124 PolarHBondContact O-N 3.49Å
121	R	85.6	Confident	82.8	Confident	157 Å²	157	117.2 Å²	117.2	59%	0.592	55%	0.548	S	S	*	.	H	α-helix	trans	-63.7	-39.9	178.1	-171.4	178.6	-178.1	-82.6	-2.5	111.8	N117 E118 Q119 Y125	N117-R121 VanDerWaalsContact O-CB 3.31Å; N117-R121 WeakPolarHBondContact O-CB 3.45Å; N117-R121 PolarHBondContact O-N 3.02Å; E118-R121 WeakPolarHBondContact O-CB 3.28Å; E118-R121 PolarHBondContact O-N 3.03Å; Q119-R121 VanDerWaalsContact C-N 3.3Å; Q119-R121 PolarHBondContact O-N 3.32Å; R121-Y125 WeakPolarHBondContact O-CB 3.13Å; R121-Y125 PolarHBondContact O-N 2.86Å; R121-Y125 VanDerWaalsContact O-N 3.09Å
122	E	84.5	Confident	81.5	Confident	153 Å²	153	118.8 Å²	118.8	72%	0.715	55%	0.554	S	S	*	*	H	α-helix	trans	-69.5	-45.4	176.5	-172.1	175.1	-165.5	0	0	111.8	E118 Q119 L120 H124 Y125	E118-E122 PolarHBondContact O-N 2.95Å; Q119-E122 PolarHBondContact O-N 3.5Å; L120-E122 VanDerWaalsContact C-N 3.34Å; L120-E122 PolarHBondContact O-N 3.14Å; E122-H124 VanDerWaalsContact C-N 3.26Å; E122-H124 PolarHBondContact O-N 3.3Å; E122-Y125 VanDerWaalsContact O-CB 3.22Å; E122-Y125 WeakPolarHBondContact O-CB 3.48Å; E122-Y125 PolarHBondContact O-N 3.43Å
123	Y	83.5	Confident	80.1	Confident	189 Å²	189	120.4 Å²	120.4	74%	0.741	56%	0.561	S	S	*	*	H	α-helix	trans	-59.7	-37.8	177.4	-178.5	-99.8	0	0	0	112.5	Q119 L120	Q119-Y123 WeakPolarHBondContact O-CB 3.2Å; Q119-Y123 PolarHBondContact O-N 3.34Å; L120-Y123 PolarHBondContact O-N 3.46Å
124	H	79.8	Confident	78.5	Confident	132 Å²	132	127.9 Å²	127.9	61%	0.611	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.4	8.7	177.1	-65.9	-62.5	0	0	0	113.8	L120 E122 D126	L120-H124 WeakPolarHBondContact O-CB 3.49Å; L120-H124 PolarHBondContact O-CD2 2.9Å; L120-H124 PolarHBondContact O-N 3.49Å; E122-H124 VanDerWaalsContact C-N 3.26Å; E122-H124 PolarHBondContact O-N 3.3Å; H124-D126 PolarHBondContact O-N 3.02Å; H124-D126 VanDerWaalsContact O-N 3.09Å
125	Y	76.7	Confident	76.8	Confident	123 Å²	123	129.7 Å²	129.7	48%	0.482	59%	0.594	S	S	.	*			trans	-74.7	102.7	180	-164.8	-108.9	0	0	0	110.4	R121 E122 G127 Y129	R121-Y125 WeakPolarHBondContact O-CB 3.13Å; R121-Y125 PolarHBondContact O-N 2.86Å; R121-Y125 VanDerWaalsContact O-N 3.09Å; E122-Y125 VanDerWaalsContact O-CB 3.22Å; E122-Y125 WeakPolarHBondContact O-CB 3.48Å; E122-Y125 PolarHBondContact O-N 3.43Å; Y125-G127 PolarHBondContact O-N 3.41Å; Y125-Y129 PolarHBondContact OH-O 3.04Å
126	D	78.7	Confident	75	Confident	91 Å²	91	136.1 Å²	136.1	49%	0.487	62%	0.623	S	S	.	*			trans	-82.9	3.7	178.1	62.6	-1.3	0	0	0	113.5	H124 L128	H124-D126 PolarHBondContact O-N 3.02Å; H124-D126 VanDerWaalsContact O-N 3.09Å; D126-L128 PolarHBondContact O-N 3.02Å; D126-L128 VanDerWaalsContact O-N 3.17Å; D126-L128 PolarHBondContact OD1-N 2.97Å; D126-L128 VanDerWaalsContact OD1-N 3.09Å
127	G	73.5	Confident	74.1	Confident	52 Å²	52	139.6 Å²	139.6	54%	0.536	63%	0.634	S	S	.	*	S	Bend	trans	70.2	1.7	-177.3	0	0	0	0	0	114.7	Y125	Y125-G127 PolarHBondContact O-N 3.41Å
128	L	70.8	Confident	73.3	Confident	113 Å²	113	141.4 Å²	141.4	59%	0.592	64%	0.638	S	S	*	*			trans	-102.6	6	-174.1	-70.7	160.6	0	0	0	112.9	D126 P130 R131	D126-L128 PolarHBondContact O-N 3.02Å; D126-L128 VanDerWaalsContact O-N 3.17Å; D126-L128 PolarHBondContact OD1-N 2.97Å; D126-L128 VanDerWaalsContact OD1-N 3.09Å; L128-P130 CarbonylContact O-C 3.49Å; L128-R131 VanDerWaalsContact O-CG 3.25Å; L128-R131 WeakPolarHBondContact O-CG 3.38Å; L128-R131 PolarHBondContact O-N 3.4Å
129	Y	66.5	Low	72.4	Confident	148 Å²	148	142 Å²	142	58%	0.58	64%	0.639	S	S	*	*			trans	-106.3	130.6	-177.3	-149	-89.6	0	0	0	112	Y125	Y125-Y129 PolarHBondContact OH-O 3.04Å
130	P	63.5	Low	71.4	Confident	75 Å²	75	143.2 Å²	143.2	49%	0.487	64%	0.644	S	S	.	*	S	Bend	cis	-85.4	134.3	8.2	-4.8	24.7	0	0	0	111.9	L128 F132	L128-P130 CarbonylContact O-C 3.49Å; P130-F132 VanDerWaalsContact C-N 3.26Å; P130-F132 HydrophobicContact CB-CD2 3.91Å; P130-F132 HydrophobicContact CB-CE2 3.53Å; P130-F132 HydrophobicContact CB-CZ 3.88Å; P130-F132 HydrophobicContact CG-CD2 4.26Å; P130-F132 HydrophobicContact CG-CE2 3.56Å; P130-F132 HydrophobicContact CG-CZ 4.06Å; P130-F132 PolarHBondContact O-N 3.44Å
131	R	63.2	Low	70.2	Confident	152 Å²	152	146.1 Å²	146.1	57%	0.574	65%	0.652	S	S	*	*			trans	-71.3	82.1	169.4	-79.9	-166.7	-90.4	-139.3	-11.4	109.9	L128 Y133	L128-R131 VanDerWaalsContact O-CG 3.25Å; L128-R131 WeakPolarHBondContact O-CG 3.38Å; L128-R131 PolarHBondContact O-N 3.4Å; R131-Y133 HydrophobicContact CB-CD2 4.32Å; R131-Y133 HydrophobicContact CB-CE2 4.02Å; R131-Y133 HydrophobicContact CG-CE2 4.41Å; R131-Y133 PolarHBondContact O-N 3.22Å
132	F	64.9	Low	69.2	Low	153 Å²	153	145.3 Å²	145.3	67%	0.671	66%	0.656	S	S	*	*			trans	-79.8	94.3	165.7	-66.1	-68.2	0	0	0	108.9	P130 W134	P130-F132 VanDerWaalsContact C-N 3.26Å; P130-F132 HydrophobicContact CB-CD2 3.91Å; P130-F132 HydrophobicContact CB-CE2 3.53Å; P130-F132 HydrophobicContact CB-CZ 3.88Å; P130-F132 HydrophobicContact CG-CD2 4.26Å; P130-F132 HydrophobicContact CG-CE2 3.56Å; P130-F132 HydrophobicContact CG-CZ 4.06Å; P130-F132 PolarHBondContact O-N 3.44Å; F132-W134 PolarHBondContact O-N 3.42Å; F132-W134 VanDerWaalsContact O-N 3.15Å
133	Y	63.5	Low	68.1	Low	165 Å²	165	144.8 Å²	144.8	65%	0.647	65%	0.652	S	S	*	*			trans	-76.3	93.6	161.6	-69.7	-77.9	0	0	0	108	R131 F135	R131-Y133 HydrophobicContact CB-CD2 4.32Å; R131-Y133 HydrophobicContact CB-CE2 4.02Å; R131-Y133 HydrophobicContact CG-CE2 4.41Å; R131-Y133 PolarHBondContact O-N 3.22Å; Y133-F135 PolarHBondContact O-N 3.13Å
134	W	59.8	Low	66.9	Low	207 Å²	207	141.4 Å²	141.4	78%	0.784	65%	0.645	S	S	*	*			trans	-74	99.3	161.2	-75	91.8	0	0	0	107.1	F132 H136	F132-W134 PolarHBondContact O-N 3.42Å; F132-W134 VanDerWaalsContact O-N 3.15Å; W134-H136 PolarHBondContact O-N 3.24Å
135	F	56.9	Low	65.9	Low	185 Å²	185	142.2 Å²	142.2	81%	0.811	65%	0.648	S	S	*	*			trans	-66.8	124	167	-71.2	-86.7	0	0	0	108	Y133	Y133-F135 PolarHBondContact O-N 3.13Å
136	H	52.5	Low	64.9	Low	242 Å²	242	143.9 Å²	143.9	100%	1.12	66%	0.663	S	S	*	*			trans	-115.4	0	167.3	-72.6	-14.9	0	0	0	108.5	W134	W134-H136 PolarHBondContact O-N 3.24Å

Retrieved 136 of 136 residues in 348.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).