A0A087Y879_POEFO Loading...

Glycoprotein hormones alpha chain

Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. Involved in gametogenesis and steroidogenesis.

AlphaFold DB , UniProt , Accession A0A087Y879, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 126 aa.

						>A0A087Y879_POEFO|A0A087Y879
MVSAVTTMGCMKSAAVTLLLLSFLLNVADSYPKFDSSRMGCGKCSLVLNDFLSKDHAQIYQCKGCCFSRAYPTPQMKMQTMSVPKNITSEASCCVAKHSYEMMQGTIPVRNHTECHCSTCYYHKLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	30.4	Very low	44.1	Very low	240 Å²	240	130.8 Å²	130.8	100%	1.182	80%	0.796	S	S	*	*				0	96	0	-87.1	172.9	161.1	0	0	107.3
2	V	33.1	Very low	45	Very low	130 Å²	130	132.4 Å²	132.4	79%	0.788	78%	0.784	S	S	*	*				115.1	104.6	91.5	173.4	0	0	0	0	107.1
3	S	44.2	Very low	46.4	Very low	116 Å²	116	127.9 Å²	127.9	81%	0.811	76%	0.764	S	S	*	*			trans	29.4	119.6	144.7	-53.7	0	0	0	0	120.7
4	A	41.3	Very low	48.5	Very low	102 Å²	102	122.5 Å²	122.5	84%	0.843	74%	0.74	S	S	*	*			trans	-158.1	54.9	142.2	0	0	0	0	0	111.5
5	V	49.5	Very low	50.5	Low	131 Å²	131	117.6 Å²	117.6	79%	0.794	72%	0.718	S	S	*	*			trans	-122.8	99.5	162.8	177.6	0	0	0	0	105.5
6	T	47.4	Very low	52.5	Low	131 Å²	131	115.4 Å²	115.4	80%	0.804	70%	0.704	S	S	*	*			trans	158	65.8	159	41.3	0	0	0	0	112.1
7	T	50.2	Low	54.4	Low	126 Å²	126	113.1 Å²	113.1	77%	0.773	69%	0.69	S	S	*	*	S	Bend	trans	-135.3	14.5	169.6	47.2	0	0	0	0	114.5
8	M	45	Very low	56.1	Low	157 Å²	157	113.1 Å²	113.1	77%	0.773	68%	0.684	S	S	*	*	S	Bend	trans	-117.9	1.5	178.2	-142.1	-177.7	-67.2	0	0	114.6
9	G	43.7	Very low	57.7	Low	56 Å²	56	112.8 Å²	112.8	58%	0.577	68%	0.678	S	S	*	*	S	Bend	trans	-96.5	-32.4	175.2	0	0	0	0	0	114.2
10	C	49.4	Very low	59.2	Low	100 Å²	100	112.4 Å²	112.4	68%	0.676	67%	0.671	S	S	*	*	H	α-helix	trans	-76.9	-35.5	-175	-74.6	0	0	0	0	114	K12 S13 A14	C10-K12 PolarHBondContact O-N 3.48Å; C10-S13 PolarHBondContact O-N 2.9Å; C10-A14 PolarHBondContact O-N 3.12Å
11	M	51.3	Low	60.6	Low	150 Å²	150	111.7 Å²	111.7	74%	0.739	66%	0.664	S	S	*	*	H	α-helix	trans	-67.5	-36.3	-179.3	-67.8	178.5	74.6	0	0	112.4	A15	M11-A15 WeakPolarHBondContact O-CB 3.48Å; M11-A15 PolarHBondContact O-N 3.26Å
12	K	54.6	Low	63.3	Low	150 Å²	150	102.8 Å²	102.8	65%	0.652	63%	0.626	S	S	*	*	H	α-helix	trans	-66.3	-41.9	175.9	-70.8	-178.9	172.3	178	0	111.2	C10 V16	C10-K12 PolarHBondContact O-N 3.48Å; K12-V16 WeakPolarHBondContact O-CB 3.47Å; K12-V16 WeakPolarHBondContact O-CG2 3.39Å; K12-V16 PolarHBondContact O-N 2.86Å
13	S	63.6	Low	65.9	Low	74 Å²	74	103.7 Å²	103.7	52%	0.517	62%	0.619	S	S	.	*	H	α-helix	trans	-64.9	-45	176.5	-175.5	0	0	0	0	112.2	C10 V16 T17	C10-S13 PolarHBondContact O-N 2.9Å; S13-V16 PolarHBondContact O-N 3.32Å; S13-T17 WeakPolarHBondContact O-CB 3.45Å; S13-T17 PolarHBondContact O-N 3.14Å; S13-T17 PolarHBondContact O-OG1 3.1Å
14	A	75.7	Confident	67.9	Low	52 Å²	52	103.7 Å²	103.7	43%	0.43	61%	0.609	S	S	.	*	H	α-helix	trans	-64.4	-42.5	178.5	0	0	0	0	0	112.3	C10 T17 L18	C10-A14 PolarHBondContact O-N 3.12Å; A14-T17 PolarHBondContact O-N 3.16Å; A14-L18 WeakPolarHBondContact O-CB 3.4Å; A14-L18 PolarHBondContact O-N 3.49Å
15	A	77.7	Confident	69.9	Low	49 Å²	49	104.1 Å²	104.1	41%	0.405	60%	0.597	S	S	.	*	H	α-helix	trans	-64.2	-43.5	176.3	0	0	0	0	0	112	M11 T17 L18 L19	M11-A15 WeakPolarHBondContact O-CB 3.48Å; M11-A15 PolarHBondContact O-N 3.26Å; A15-T17 VanDerWaalsContact C-N 3.32Å; A15-T17 PolarHBondContact O-N 3.37Å; A15-L18 PolarHBondContact O-N 3.49Å; A15-L19 WeakPolarHBondContact O-CB 3.44Å; A15-L19 VanDerWaalsContact O-CG 3.27Å; A15-L19 WeakPolarHBondContact O-CG 3.13Å; A15-L19 PolarHBondContact O-N 3.15Å
16	V	82.8	Confident	71.4	Confident	82 Å²	82	102.5 Å²	102.5	50%	0.497	58%	0.584	S	S	.	*	H	α-helix	trans	-62.7	-40.5	174.6	169.5	0	0	0	0	111.1	K12 S13 L19 L20	K12-V16 WeakPolarHBondContact O-CB 3.47Å; K12-V16 WeakPolarHBondContact O-CG2 3.39Å; K12-V16 PolarHBondContact O-N 2.86Å; S13-V16 PolarHBondContact O-N 3.32Å; V16-L19 PolarHBondContact O-N 2.78Å; V16-L20 HydrophobicContact CG1-CD1 3.84Å; V16-L20 WeakPolarHBondContact O-CB 3.47Å; V16-L20 WeakPolarHBondContact O-CG 3.4Å; V16-L20 PolarHBondContact O-N 2.89Å
17	T	84.2	Confident	72.9	Confident	76 Å²	76	100.5 Å²	100.5	47%	0.466	57%	0.571	S	S	.	*	H	α-helix	trans	-64.5	-43.3	177	-53.2	0	0	0	0	111.3	S13 A14 A15 L20 L21	S13-T17 WeakPolarHBondContact O-CB 3.45Å; S13-T17 PolarHBondContact O-N 3.14Å; S13-T17 PolarHBondContact O-OG1 3.1Å; A14-T17 PolarHBondContact O-N 3.16Å; A15-T17 VanDerWaalsContact C-N 3.32Å; A15-T17 PolarHBondContact O-N 3.37Å; T17-L20 PolarHBondContact O-N 3.37Å; T17-L21 WeakPolarHBondContact O-CB 2.97Å; T17-L21 PolarHBondContact O-N 3.43Å
18	L	85.6	Confident	74.1	Confident	113 Å²	113	97.7 Å²	97.7	59%	0.592	56%	0.561	S	S	*	*	H	α-helix	trans	-64.2	-40.3	175.6	-87.3	154.5	0	0	0	112.4	A14 A15 L21 S22	A14-L18 WeakPolarHBondContact O-CB 3.4Å; A14-L18 PolarHBondContact O-N 3.49Å; A15-L18 PolarHBondContact O-N 3.49Å; L18-L21 PolarHBondContact O-N 3.39Å; L18-S22 VanDerWaalsContact O-CB 3.31Å; L18-S22 WeakPolarHBondContact O-CB 3.06Å; L18-S22 PolarHBondContact O-N 2.68Å; L18-S22 PolarHBondContact O-OG 2.7Å
19	L	86.7	Confident	75.3	Confident	108 Å²	108	96.6 Å²	96.6	57%	0.565	56%	0.558	S	S	*	*	H	α-helix	trans	-65.3	-44.5	175.7	-73.9	170.3	0	0	0	111.4	A15 V16 S22 F23	A15-L19 WeakPolarHBondContact O-CB 3.44Å; A15-L19 VanDerWaalsContact O-CG 3.27Å; A15-L19 WeakPolarHBondContact O-CG 3.13Å; A15-L19 PolarHBondContact O-N 3.15Å; V16-L19 PolarHBondContact O-N 2.78Å; L19-S22 PolarHBondContact O-N 3.15Å; L19-F23 WeakPolarHBondContact O-CB 3.24Å; L19-F23 PolarHBondContact O-N 2.75Å
20	L	88.4	Confident	76.3	Confident	104 Å²	104	98.4 Å²	98.4	55%	0.545	56%	0.562	S	S	.	*	H	α-helix	trans	-60.3	-46.5	173.8	-80.4	160	0	0	0	111.4	V16 T17 S22 F23 L24	V16-L20 HydrophobicContact CG1-CD1 3.84Å; V16-L20 WeakPolarHBondContact O-CB 3.47Å; V16-L20 WeakPolarHBondContact O-CG 3.4Å; V16-L20 PolarHBondContact O-N 2.89Å; T17-L20 PolarHBondContact O-N 3.37Å; L20-S22 VanDerWaalsContact C-N 3.32Å; L20-S22 PolarHBondContact O-N 3.34Å; L20-F23 PolarHBondContact O-N 2.54Å; L20-L24 VanDerWaalsContact O-CG 3.26Å; L20-L24 WeakPolarHBondContact O-CG 3.45Å; L20-L24 PolarHBondContact O-N 2.9Å
21	L	88.8	Confident	76.9	Confident	99 Å²	99	100.5 Å²	100.5	52%	0.518	56%	0.557	S	S	.	*	H	α-helix	trans	-61.6	-42.8	177.9	-144.1	87.5	0	0	0	111.3	T17 L18 L24 L25	T17-L21 WeakPolarHBondContact O-CB 2.97Å; T17-L21 PolarHBondContact O-N 3.43Å; L18-L21 PolarHBondContact O-N 3.39Å; L21-L24 PolarHBondContact O-N 3.4Å; L21-L25 WeakPolarHBondContact O-CB 3.4Å; L21-L25 VanDerWaalsContact O-CG 3.25Å; L21-L25 WeakPolarHBondContact O-CG 3.16Å; L21-L25 PolarHBondContact O-N 3.21Å
22	S	86.6	Confident	77.1	Confident	53 Å²	53	97.2 Å²	97.2	37%	0.371	55%	0.546	S	S	.	.	H	α-helix	trans	-63.5	-43.1	177	-58.2	0	0	0	0	111	L18 L19 L20 L25 N26	L18-S22 VanDerWaalsContact O-CB 3.31Å; L18-S22 WeakPolarHBondContact O-CB 3.06Å; L18-S22 PolarHBondContact O-N 2.68Å; L18-S22 PolarHBondContact O-OG 2.7Å; L19-S22 PolarHBondContact O-N 3.15Å; L20-S22 VanDerWaalsContact C-N 3.32Å; L20-S22 PolarHBondContact O-N 3.34Å; S22-L25 PolarHBondContact O-N 2.82Å; S22-N26 WeakPolarHBondContact O-CB 3.48Å; S22-N26 PolarHBondContact O-N 3.07Å; S22-N26 PolarHBondContact O-ND2 2.81Å
23	F	86.9	Confident	77	Confident	148 Å²	148	99.2 Å²	99.2	65%	0.649	56%	0.555	S	S	*	*	H	α-helix	trans	-60.8	-45.2	174.1	-104.2	-83.6	0	0	0	111.8	L19 L20 L25 N26 V27	L19-F23 WeakPolarHBondContact O-CB 3.24Å; L19-F23 PolarHBondContact O-N 2.75Å; L20-F23 PolarHBondContact O-N 2.54Å; F23-L25 PolarHBondContact O-N 3.19Å; F23-N26 PolarHBondContact O-N 3.47Å; F23-V27 WeakPolarHBondContact O-CB 3.46Å; F23-V27 VanDerWaalsContact O-CG2 3.26Å; F23-V27 WeakPolarHBondContact O-CG2 3.31Å; F23-V27 PolarHBondContact O-N 2.9Å
24	L	86.7	Confident	76.3	Confident	116 Å²	116	101 Å²	101	61%	0.607	55%	0.554	S	S	*	*	H	α-helix	trans	-64.3	-40	178.3	-69.1	171.2	0	0	0	112.1	L20 L21 V27 A28	L20-L24 VanDerWaalsContact O-CG 3.26Å; L20-L24 WeakPolarHBondContact O-CG 3.45Å; L20-L24 PolarHBondContact O-N 2.9Å; L21-L24 PolarHBondContact O-N 3.4Å; L24-V27 PolarHBondContact O-N 2.85Å; L24-A28 VanDerWaalsContact O-CB 3.32Å; L24-A28 WeakPolarHBondContact O-CB 3.21Å; L24-A28 PolarHBondContact O-N 2.82Å
25	L	83.6	Confident	75	Confident	111 Å²	111	103.1 Å²	103.1	58%	0.581	56%	0.558	S	S	*	*	H	α-helix	trans	-67	-41.6	175.3	-71.6	170.6	0	0	0	111.6	L21 S22 F23 A28 D29	L21-L25 WeakPolarHBondContact O-CB 3.4Å; L21-L25 VanDerWaalsContact O-CG 3.25Å; L21-L25 WeakPolarHBondContact O-CG 3.16Å; L21-L25 PolarHBondContact O-N 3.21Å; S22-L25 PolarHBondContact O-N 2.82Å; F23-L25 PolarHBondContact O-N 3.19Å; L25-A28 PolarHBondContact O-N 2.93Å; L25-D29 WeakPolarHBondContact O-CB 3.32Å; L25-D29 PolarHBondContact O-N 3.03Å
26	N	79.8	Confident	73.6	Confident	98 Å²	98	105.8 Å²	105.8	52%	0.524	57%	0.573	S	S	.	*	H	α-helix	trans	-63.8	-41.5	174.4	-81.1	-69.4	0	0	0	111.4	S22 F23 A28 D29 S30	S22-N26 WeakPolarHBondContact O-CB 3.48Å; S22-N26 PolarHBondContact O-N 3.07Å; S22-N26 PolarHBondContact O-ND2 2.81Å; F23-N26 PolarHBondContact O-N 3.47Å; N26-A28 VanDerWaalsContact C-N 3.33Å; N26-D29 PolarHBondContact O-N 2.88Å; N26-S30 WeakPolarHBondContact O-CB 3.46Å; N26-S30 PolarHBondContact O-N 2.75Å; N26-S30 PolarHBondContact O-OG 2.95Å
27	V	78.9	Confident	72	Confident	89 Å²	89	104.5 Å²	104.5	54%	0.539	57%	0.568	S	S	.	*	H	α-helix	trans	-64.7	-38.8	174.8	170.2	0	0	0	0	110.8	F23 L24 Y31	F23-V27 WeakPolarHBondContact O-CB 3.46Å; F23-V27 VanDerWaalsContact O-CG2 3.26Å; F23-V27 WeakPolarHBondContact O-CG2 3.31Å; F23-V27 PolarHBondContact O-N 2.9Å; L24-V27 PolarHBondContact O-N 2.85Å; V27-Y31 WeakPolarHBondContact O-CB 3.24Å; V27-Y31 PolarHBondContact O-N 3.2Å
28	A	76.7	Confident	70.2	Confident	67 Å²	67	108.1 Å²	108.1	55%	0.554	57%	0.573	S	S	*	*	H	α-helix	trans	-68.4	-36.9	176.6	0	0	0	0	0	113.1	L24 L25 N26 Y31	L24-A28 VanDerWaalsContact O-CB 3.32Å; L24-A28 WeakPolarHBondContact O-CB 3.21Å; L24-A28 PolarHBondContact O-N 2.82Å; L25-A28 PolarHBondContact O-N 2.93Å; N26-A28 VanDerWaalsContact C-N 3.33Å; A28-Y31 WeakPolarHBondContact O-CB 3.48Å; A28-Y31 PolarHBondContact O-N 3.03Å
29	D	69	Low	68.4	Low	134 Å²	134	111 Å²	111	72%	0.717	59%	0.586	S	S	*	*	H	α-helix	trans	-78.2	-34.4	177.6	-162.2	47.8	0	0	0	112.1	L25 N26 Y31	L25-D29 WeakPolarHBondContact O-CB 3.32Å; L25-D29 PolarHBondContact O-N 3.03Å; N26-D29 PolarHBondContact O-N 2.88Å; D29-Y31 VanDerWaalsContact C-N 3.26Å
30	S	65.8	Low	67.3	Low	93 Å²	93	108.2 Å²	108.2	65%	0.65	58%	0.583	S	S	*	*	H	α-helix	trans	-74.1	-19.4	171.1	-53.5	0	0	0	0	112.3	N26 P32	N26-S30 WeakPolarHBondContact O-CB 3.46Å; N26-S30 PolarHBondContact O-N 2.75Å; N26-S30 PolarHBondContact O-OG 2.95Å; S30-P32 WeakPolarHBondContact O-CD 3.43Å; S30-P32 VanDerWaalsContact O-N 3.16Å
31	Y	61	Low	66.7	Low	145 Å²	145	107 Å²	107	57%	0.569	58%	0.582	S	S	*	*	S	Bend	trans	-64.7	117.4	173	-156.3	-96.8	0	0	0	106.5	V27 A28 D29 K33 F34	V27-Y31 WeakPolarHBondContact O-CB 3.24Å; V27-Y31 PolarHBondContact O-N 3.2Å; A28-Y31 WeakPolarHBondContact O-CB 3.48Å; A28-Y31 PolarHBondContact O-N 3.03Å; D29-Y31 VanDerWaalsContact C-N 3.26Å; Y31-K33 PolarHBondContact O-N 2.91Å; Y31-F34 HydrophobicContact CE1-CB 4.27Å
32	P	56.3	Low	66.5	Low	81 Å²	81	104 Å²	104	53%	0.526	58%	0.575	S	S	.	*			trans	-56.3	117.3	-178.8	22.5	-31.4	0	0	0	106.8	S30 F34	S30-P32 WeakPolarHBondContact O-CD 3.43Å; S30-P32 VanDerWaalsContact O-N 3.16Å; P32-F34 WeakPolarHBondContact O-CA 3.42Å; P32-F34 PolarHBondContact O-N 2.86Å
33	K	51.8	Low	66.8	Low	191 Å²	191	110.3 Å²	110.3	83%	0.83	60%	0.596	S	S	*	*			trans	-38.7	104	178.8	-77.3	179.9	179.9	173.3	0	107.8	Y31 D35	Y31-K33 PolarHBondContact O-N 2.91Å; K33-D35 PolarHBondContact O-N 3.01Å
34	F	49.5	Very low	67.3	Low	113 Å²	113	104 Å²	104	50%	0.496	57%	0.57	S	S	.	*			trans	-76.2	88.5	-175.3	-169.9	-88.1	0	0	0	105.1	Y31 P32 S36 R38	Y31-F34 HydrophobicContact CE1-CB 4.27Å; P32-F34 WeakPolarHBondContact O-CA 3.42Å; P32-F34 PolarHBondContact O-N 2.86Å; F34-S36 PolarHBondContact O-N 2.03Å; F34-R38 HydrophobicContact CE1-CB 4.14Å; F34-R38 HydrophobicContact CE2-CB 4.37Å; F34-R38 HydrophobicContact CZ-CB 3.95Å
35	D	49.2	Very low	67.7	Low	96 Å²	96	101.2 Å²	101.2	51%	0.513	56%	0.56	S	S	.	*			trans	-56.9	116.7	173.4	-173.4	5.2	0	0	0	106.8	K33 S37 R38	K33-D35 PolarHBondContact O-N 3.01Å; D35-S37 PolarHBondContact O-N 2.92Å; D35-S37 PolarHBondContact OD1-N 3.26Å; D35-S37 PolarHBondContact OD1-OG 3.22Å; D35-S37 PolarHBondContact OD2-OG 2.81Å; D35-R38 WeakPolarHBondContact O-CB 3.32Å; D35-R38 VanDerWaalsContact O-CG 3.3Å; D35-R38 WeakPolarHBondContact O-CG 3.17Å; D35-R38 PolarHBondContact O-N 3.47Å
36	S	46.8	Very low	68.4	Low	104 Å²	104	99.1 Å²	99.1	73%	0.727	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-62.9	-8.9	-177.4	49.1	0	0	0	0	112.4	F34 R38 M39	F34-S36 PolarHBondContact O-N 2.03Å; S36-R38 PolarHBondContact O-N 3.02Å; S36-M39 PolarHBondContact O-N 3.25Å
37	S	49	Very low	69	Low	56 Å²	56	97.2 Å²	97.2	39%	0.392	54%	0.541	S	S	.	.	G	3₁₀ helix	trans	-58.9	-20.4	162.2	75.1	0	0	0	0	114	D35 M39 G40	D35-S37 PolarHBondContact O-N 2.92Å; D35-S37 PolarHBondContact OD1-N 3.26Å; D35-S37 PolarHBondContact OD1-OG 3.22Å; D35-S37 PolarHBondContact OD2-OG 2.81Å; S37-M39 VanDerWaalsContact C-N 3.31Å; S37-M39 PolarHBondContact O-N 3.38Å; S37-G40 CarbonylContact O-C 3.42Å; S37-G40 PolarHBondContact O-N 2.04Å; S37-G40 VanDerWaalsContact O-N 3.09Å
38	R	46.9	Very low	69.7	Low	152 Å²	152	96 Å²	96	57%	0.574	53%	0.531	S	S	*	.	G	3₁₀ helix	trans	-73.6	-8.3	-180	-71.9	-178.1	171.5	-158.3	-1	115.6	F34 D35 S36 G40	F34-R38 HydrophobicContact CE1-CB 4.14Å; F34-R38 HydrophobicContact CE2-CB 4.37Å; F34-R38 HydrophobicContact CZ-CB 3.95Å; D35-R38 WeakPolarHBondContact O-CB 3.32Å; D35-R38 VanDerWaalsContact O-CG 3.3Å; D35-R38 WeakPolarHBondContact O-CG 3.17Å; D35-R38 PolarHBondContact O-N 3.47Å; S36-R38 PolarHBondContact O-N 3.02Å; R38-G40 PolarHBondContact O-N 3.03Å
39	M	48.9	Very low	70.4	Confident	174 Å²	174	94.4 Å²	94.4	86%	0.857	51%	0.513	S	S	*	.	G	3₁₀ helix	trans	-73.2	-8.1	166.2	-148.1	76.7	87.4	0	0	111.5	S36 S37	S36-M39 PolarHBondContact O-N 3.25Å; S37-M39 VanDerWaalsContact C-N 3.31Å; S37-M39 PolarHBondContact O-N 3.38Å
40	G	62.3	Low	71.3	Confident	48 Å²	48	94.3 Å²	94.3	50%	0.495	51%	0.513	S	S	.	.	S	Bend	trans	-131.5	178.2	169.8	0	0	0	0	0	111.8	S37 R38 G42	S37-G40 CarbonylContact O-C 3.42Å; S37-G40 PolarHBondContact O-N 2.04Å; S37-G40 VanDerWaalsContact O-N 3.09Å; R38-G40 PolarHBondContact O-N 3.03Å; G40-G42 PolarHBondContact O-N 2.03Å
41	C	76.6	Confident	72.3	Confident	80 Å²	80	97.5 Å²	97.5	54%	0.541	52%	0.515	S	S	.	.	P	Polyproline II helix	trans	-79.8	120.4	174.4	-175.9	0	0	0	0	110.4	C65	C41-C65 HydrophobicContact CB-CB 3.56Å; C41-C65 WeakPolarHBondContact CB-SG 3.08Å; C41-C65 WeakPolarHBondContact SG-CB 3.02Å; C41-C65 PolarHBondContact SG-N 2.98Å; C41-C65 VanDerWaalsContact SG-N 3.44Å; C41-C65 CovalentContact SG-SG 1.98Å; C41-C65 PolarHBondContact SG-SG 2.84Å
42	G	84.5	Confident	73.4	Confident	36 Å²	36	92.4 Å²	92.4	37%	0.371	50%	0.498	S	S	.	.	P	Polyproline II helix	trans	-59.1	152.2	179.3	0	0	0	0	0	112.9	G40 G64 C65	G40-G42 PolarHBondContact O-N 2.03Å; G42-G64 CarbonylContact O-C 3.47Å; G42-G64 VanDerWaalsContact O-CA 3.24Å; G42-G64 WeakPolarHBondContact O-CA 3.38Å; G42-C65 PolarHBondContact O-N 2.82Å
43	K	93.3	Very high	74.7	Confident	185 Å²	185	89.8 Å²	89.8	80%	0.804	48%	0.481	S	S	*	.	B	Isolated β-bridge	trans	-56.1	143.8	178.7	-175.1	179.7	177.2	-177.7	0	111	S45	K43-S45 PolarHBondContact O-N 3.42Å; K43-S45 VanDerWaalsContact O-N 3.13Å; K43-S45 PolarHBondContact O-OG 3.46Å; K43-S45 VanDerWaalsContact O-OG 3.13Å
44	C	96.7	Very high	76.2	Confident	15 Å²	15	86.4 Å²	86.4	10%	0.101	47%	0.466	C	S	.	.	S	Bend	trans	-48.5	119.5	171.2	179.9	0	0	0	0	111.5	C65 C94	C44-C65 PolarHBondContact N-O 3.42Å; C44-C94 WeakPolarHBondContact CA-SG 3.41Å; C44-C94 HydrophobicContact CB-CB 3.64Å; C44-C94 WeakPolarHBondContact CB-SG 3.41Å; C44-C94 WeakPolarHBondContact SG-CA 3.28Å; C44-C94 WeakPolarHBondContact SG-CB 3.42Å; C44-C94 CovalentContact SG-SG 2.04Å; C44-C94 PolarHBondContact SG-SG 2.87Å
45	S	96.1	Very high	77.1	Confident	57 Å²	57	88.1 Å²	88.1	40%	0.399	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.4	167.2	-174.1	53.7	0	0	0	0	111.2	K43 C62 K63 C115	K43-S45 PolarHBondContact O-N 3.42Å; K43-S45 VanDerWaalsContact O-N 3.13Å; K43-S45 PolarHBondContact O-OG 3.46Å; K43-S45 VanDerWaalsContact O-OG 3.13Å; S45-C62 WeakPolarHBondContact O-CA 3.43Å; S45-K63 PolarHBondContact N-O 2.89Å; S45-K63 PolarHBondContact O-N 2.78Å; S45-K63 VanDerWaalsContact O-O 3.08Å; S45-C115 VanDerWaalsContact C-SG 3.59Å
46	L	96.6	Very high	78.1	Confident	68 Å²	68	93.1 Å²	93.1	36%	0.356	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.4	124.6	175.1	-166.6	69.8	0	0	0	109.2	Y60 H112	L46-Y60 HydrophobicContact CD2-CD1 4.07Å; L46-Y60 HydrophobicContact CD2-CG 4.03Å; L46-Y60 HydrophobicContact CG-CD1 3.98Å; L46-Y60 HydrophobicContact CG-CG 4.09Å; L46-H112 HydrophobicContact CD1-CB 3.6Å; L46-H112 WeakPolarHBondContact CD1-O 3.46Å
47	V	93.8	Very high	79.8	Confident	58 Å²	58	89.3 Å²	89.3	35%	0.352	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	137.6	-174.9	-176.7	0	0	0	0	109.4	N49 Y60 Q61 K63	V47-N49 PolarHBondContact O-N 2.92Å; V47-Y60 CarbonylContact O-C 3.6Å; V47-Y60 WeakPolarHBondContact O-CA 3.39Å; V47-Q61 PolarHBondContact N-O 3.48Å; V47-Q61 PolarHBondContact O-N 2.97Å; V47-K63 HydrophobicContact CB-CB 4.34Å; V47-K63 HydrophobicContact CG2-CB 3.97Å
48	L	93.3	Very high	81.8	Confident	64 Å²	64	92.3 Å²	92.3	34%	0.335	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.3	131.3	173.6	-172.4	69.4	0	0	0	109.7	S53 Q58 Y60	L48-S53 WeakPolarHBondContact CD1-OG 3.36Å; L48-Q58 HydrophobicContact CD1-CB 3.89Å; L48-Q58 HydrophobicContact CD1-CG 4.22Å; L48-Y60 HydrophobicContact CB-CD1 4.38Å; L48-Y60 HydrophobicContact CB-CE1 4.2Å; L48-Y60 HydrophobicContact CD1-CD1 4.32Å; L48-Y60 HydrophobicContact CD1-CE1 4Å; L48-Y60 HydrophobicContact CD1-CE2 4.4Å
49	N	90.8	Very high	84	Confident	33 Å²	33	85.1 Å²	85.1	18%	0.176	46%	0.456	C	S	.	.			trans	-94.2	101.1	172.3	-175.8	-42.1	0	0	0	109.1	V47 F51 L52 S53 I59 Q61	V47-N49 PolarHBondContact O-N 2.92Å; N49-F51 PolarHBondContact O-N 2.86Å; N49-F51 WeakPolarHBondContact OD1-CB 3.03Å; N49-F51 PolarHBondContact OD1-N 3Å; N49-L52 HydrophobicContact CB-CB 4.29Å; N49-L52 HydrophobicContact CB-CD1 4.48Å; N49-L52 PolarHBondContact O-N 3.01Å; N49-L52 PolarHBondContact OD1-N 3.31Å; N49-S53 WeakPolarHBondContact O-CB 3.03Å; N49-S53 PolarHBondContact O-N 2.03Å; N49-S53 PolarHBondContact O-OG 2.96Å; N49-I59 PolarHBondContact N-O 1.98Å; N49-Q61 HydrophobicContact CB-CG 4.21Å; N49-Q61 VanDerWaalsContact ND2-CD 3.27Å; N49-Q61 PolarHBondContact ND2-OE1 3.03Å
50	D	88.3	Confident	86.2	Confident	132 Å²	132	80.4 Å²	80.4	71%	0.706	43%	0.429	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.7	-24.6	-177.7	-58.5	-33.9	0	0	0	113.6
51	F	85.8	Confident	87.8	Confident	160 Å²	160	81.6 Å²	81.6	70%	0.702	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.1	-41.7	-179.8	178.6	-96.7	0	0	0	112.2	N49	N49-F51 PolarHBondContact O-N 2.86Å; N49-F51 WeakPolarHBondContact OD1-CB 3.03Å; N49-F51 PolarHBondContact OD1-N 3Å
52	L	85	Confident	88.8	Confident	38 Å²	38	78.8 Å²	78.8	20%	0.199	40%	0.403	C	S	.	.	T	Hydrogen-bonded Turn	trans	-80	-33.4	178	-65.3	179.4	0	0	0	111.5	N49 K54 I59 Q61 Q104	N49-L52 HydrophobicContact CB-CB 4.29Å; N49-L52 HydrophobicContact CB-CD1 4.48Å; N49-L52 PolarHBondContact O-N 3.01Å; N49-L52 PolarHBondContact OD1-N 3.31Å; L52-K54 PolarHBondContact O-N 2.92Å; L52-K54 VanDerWaalsContact O-N 3.12Å; L52-I59 HydrophobicContact CB-CB 4.03Å; L52-I59 HydrophobicContact CB-CD1 3.72Å; L52-I59 HydrophobicContact CB-CG1 4.48Å; L52-I59 HydrophobicContact CB-CG2 4.05Å; L52-I59 HydrophobicContact CD1-CG2 4.01Å; L52-Q61 VanDerWaalsContact CD1-NE2 3.33Å; L52-Q104 WeakPolarHBondContact O-CG 3.38Å
53	S	84.7	Confident	89.3	Confident	25 Å²	25	84.3 Å²	84.3	18%	0.175	42%	0.417	C	S	.	.			trans	-70.3	107	179.6	-57	0	0	0	0	110.4	L48 N49 A57 I59	L48-S53 WeakPolarHBondContact CD1-OG 3.36Å; N49-S53 WeakPolarHBondContact O-CB 3.03Å; N49-S53 PolarHBondContact O-N 2.03Å; N49-S53 PolarHBondContact O-OG 2.96Å; S53-A57 VanDerWaalsContact CA-O 3.28Å; S53-A57 WeakPolarHBondContact CA-O 3.5Å; S53-I59 PolarHBondContact OG-N 3.13Å; S53-I59 PolarHBondContact OG-O 3.23Å
54	K	81.4	Confident	89.3	Confident	120 Å²	120	76.8 Å²	76.8	52%	0.522	39%	0.392	S	S	.	.	B	Isolated β-bridge	trans	-137.4	155.9	175.4	-64.9	-176.7	-179.9	179.8	0	110.2	L52 H56 A57 Q104	L52-K54 PolarHBondContact O-N 2.92Å; L52-K54 VanDerWaalsContact O-N 3.12Å; K54-H56 PolarHBondContact O-N 3.13Å; K54-A57 PolarHBondContact N-O 3.44Å; K54-A57 PolarHBondContact O-N 3.05Å; K54-Q104 PolarHBondContact O-NE2 2.87Å
55	D	69	Low	89.1	Confident	149 Å²	149	78.8 Å²	78.8	80%	0.797	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	44.8	57.6	163.8	-54.1	-32	0	0	0	113.8	A57	D55-A57 VanDerWaalsContact C-N 3.32Å; D55-A57 PolarHBondContact O-N 2.76Å
56	H	70.3	Confident	89.1	Confident	201 Å²	201	77.3 Å²	77.3	93%	0.931	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	73.8	1	177.1	-49.3	-77.2	0	0	0	117.5	K54	K54-H56 PolarHBondContact O-N 3.13Å
57	A	82	Confident	89	Confident	25 Å²	25	80 Å²	80	21%	0.207	40%	0.404	C	S	.	.	B	Isolated β-bridge	trans	-101.6	117.4	173	0	0	0	0	0	111.2	S53 K54 D55 M102	S53-A57 VanDerWaalsContact CA-O 3.28Å; S53-A57 WeakPolarHBondContact CA-O 3.5Å; K54-A57 PolarHBondContact N-O 3.44Å; K54-A57 PolarHBondContact O-N 3.05Å; D55-A57 VanDerWaalsContact C-N 3.32Å; D55-A57 PolarHBondContact O-N 2.76Å; A57-M102 HydrophobicContact CB-CE 3.96Å
58	Q	90.8	Very high	89	Confident	119 Å²	119	81.3 Å²	81.3	56%	0.556	42%	0.416	S	S	*	.			trans	-91.3	116.6	174.3	-68.9	178.4	-18.2	0	0	109.8	L48 Y60 N111	L48-Q58 HydrophobicContact CD1-CB 3.89Å; L48-Q58 HydrophobicContact CD1-CG 4.22Å; Q58-Y60 HydrophobicContact CB-CE2 3.83Å; Q58-Y60 PolarHBondContact OE1-OH 3.22Å; Q58-N111 PolarHBondContact O-ND2 2.72Å
59	I	93.3	Very high	89	Confident	0 Å²	0	84.3 Å²	84.3	0%	0	42%	0.423	C	S	.	.			trans	-106.7	121.3	178.8	-66.3	167.7	0	0	0	108.9	N49 L52 S53 M102 Q104 V109	N49-I59 PolarHBondContact N-O 1.98Å; L52-I59 HydrophobicContact CB-CB 4.03Å; L52-I59 HydrophobicContact CB-CD1 3.72Å; L52-I59 HydrophobicContact CB-CG1 4.48Å; L52-I59 HydrophobicContact CB-CG2 4.05Å; L52-I59 HydrophobicContact CD1-CG2 4.01Å; S53-I59 PolarHBondContact OG-N 3.13Å; S53-I59 PolarHBondContact OG-O 3.23Å; I59-M102 HydrophobicContact CG1-SD 4.28Å; I59-Q104 HydrophobicContact CD1-CB 3.83Å; I59-Q104 HydrophobicContact CD1-CG 3.76Å; I59-V109 HydrophobicContact CD1-CG2 3.7Å; I59-V109 HydrophobicContact CG1-CG2 4.44Å
60	Y	95.3	Very high	89.3	Confident	75 Å²	75	86.1 Å²	86.1	29%	0.294	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	143.5	178.6	-66.3	-88.2	0	0	0	111.4	L46 V47 L48 Q58 N111 H112	L46-Y60 HydrophobicContact CD2-CD1 4.07Å; L46-Y60 HydrophobicContact CD2-CG 4.03Å; L46-Y60 HydrophobicContact CG-CD1 3.98Å; L46-Y60 HydrophobicContact CG-CG 4.09Å; V47-Y60 CarbonylContact O-C 3.6Å; V47-Y60 WeakPolarHBondContact O-CA 3.39Å; L48-Y60 HydrophobicContact CB-CD1 4.38Å; L48-Y60 HydrophobicContact CB-CE1 4.2Å; L48-Y60 HydrophobicContact CD1-CD1 4.32Å; L48-Y60 HydrophobicContact CD1-CE1 4Å; L48-Y60 HydrophobicContact CD1-CE2 4.4Å; Q58-Y60 HydrophobicContact CB-CE2 3.83Å; Q58-Y60 PolarHBondContact OE1-OH 3.22Å; Y60-N111 PolarHBondContact N-OD1 2.86Å; Y60-H112 WeakPolarHBondContact O-CB 3.32Å; Y60-H112 PolarHBondContact O-N 3.43Å
61	Q	96.6	Very high	89.7	Confident	73 Å²	73	83 Å²	83	34%	0.341	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	150.1	177	-70.6	-171.2	-23.5	0	0	111.2	V47 N49 L52	V47-Q61 PolarHBondContact N-O 3.48Å; V47-Q61 PolarHBondContact O-N 2.97Å; N49-Q61 HydrophobicContact CB-CG 4.21Å; N49-Q61 VanDerWaalsContact ND2-CD 3.27Å; N49-Q61 PolarHBondContact ND2-OE1 3.03Å; L52-Q61 VanDerWaalsContact CD1-NE2 3.33Å
62	C	96.8	Very high	90.3	Very high	22 Å²	22	80.2 Å²	80.2	15%	0.149	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.4	123.5	177.3	-66.9	0	0	0	0	109.2	S45 H112 C115	S45-C62 WeakPolarHBondContact O-CA 3.43Å; C62-H112 PolarHBondContact N-ND1 3.44Å; C62-H112 PolarHBondContact SG-ND1 2.87Å; C62-C115 WeakPolarHBondContact CA-SG 3.31Å; C62-C115 HydrophobicContact CB-CB 3.78Å; C62-C115 WeakPolarHBondContact CB-SG 3.39Å; C62-C115 WeakPolarHBondContact SG-CA 3.25Å; C62-C115 WeakPolarHBondContact SG-CB 3.47Å; C62-C115 CovalentContact SG-SG 2.03Å; C62-C115 PolarHBondContact SG-SG 3.41Å
63	K	94.8	Very high	90.9	Very high	151 Å²	151	79 Å²	79	66%	0.657	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-142.3	150.5	178.6	-174.5	177.5	178.2	-178.9	0	110.1	S45 V47	S45-K63 PolarHBondContact N-O 2.89Å; S45-K63 PolarHBondContact O-N 2.78Å; S45-K63 VanDerWaalsContact O-O 3.08Å; V47-K63 HydrophobicContact CB-CB 4.34Å; V47-K63 HydrophobicContact CG2-CB 3.97Å
64	G	93.5	Very high	91.5	Very high	27 Å²	27	80.9 Å²	80.9	28%	0.278	42%	0.424	S	S	.	.	S	Bend	trans	131.4	-169.7	176.3	0	0	0	0	0	110.9	G42	G42-G64 CarbonylContact O-C 3.47Å; G42-G64 VanDerWaalsContact O-CA 3.24Å; G42-G64 WeakPolarHBondContact O-CA 3.38Å
65	C	93.8	Very high	92.3	Very high	58 Å²	58	81.6 Å²	81.6	39%	0.392	43%	0.43	S	S	.	.	B	Isolated β-bridge	trans	-106.1	153.9	-176.9	-81.6	0	0	0	0	113.5	C41 G42 C44	C41-C65 HydrophobicContact CB-CB 3.56Å; C41-C65 WeakPolarHBondContact CB-SG 3.08Å; C41-C65 WeakPolarHBondContact SG-CB 3.02Å; C41-C65 PolarHBondContact SG-N 2.98Å; C41-C65 VanDerWaalsContact SG-N 3.44Å; C41-C65 CovalentContact SG-SG 1.98Å; C41-C65 PolarHBondContact SG-SG 2.84Å; G42-C65 PolarHBondContact O-N 2.82Å; C44-C65 PolarHBondContact N-O 3.42Å
66	C	95.6	Very high	93.6	Very high	26 Å²	26	81.2 Å²	81.2	18%	0.176	43%	0.425	C	S	.	.			trans	-134.9	168.3	178.9	-74.2	0	0	0	0	108.4	S68 S92 C93 C94 C117	C66-S68 PolarHBondContact O-N 3.19Å; C66-S92 WeakPolarHBondContact CB-O 3.4Å; C66-S92 WeakPolarHBondContact CB-OG 3.4Å; C66-C93 VanDerWaalsContact SG-C 3.56Å; C66-C94 VanDerWaalsContact SG-CA 3.59Å; C66-C94 PolarHBondContact SG-N 2.85Å; C66-C94 VanDerWaalsContact SG-N 3.38Å; C66-C117 VanDerWaalsContact CA-SG 3.52Å; C66-C117 HydrophobicContact CB-CB 3.69Å; C66-C117 WeakPolarHBondContact CB-SG 3.41Å; C66-C117 WeakPolarHBondContact SG-CA 3.45Å; C66-C117 WeakPolarHBondContact SG-CB 3.44Å; C66-C117 CovalentContact SG-SG 2.03Å; C66-C117 PolarHBondContact SG-SG 3.3Å
67	F	93.6	Very high	94.9	Very high	124 Å²	124	77.9 Å²	77.9	54%	0.544	41%	0.408	S	S	.	.			trans	-65.4	133.6	-177.7	175.8	-96.5	0	0	0	111.4	R69 S92	F67-R69 HydrophobicContact CE1-CG 3.84Å; F67-R69 HydrophobicContact CZ-CB 4.18Å; F67-R69 HydrophobicContact CZ-CG 3.71Å; F67-S92 PolarHBondContact N-OG 2.65Å; F67-S92 PolarHBondContact O-N 2.91Å; F67-S92 PolarHBondContact O-OG 3.48Å
68	S	93.9	Very high	95.6	Very high	86 Å²	86	79.1 Å²	79.1	60%	0.601	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-146.4	139.4	169.3	64.4	0	0	0	0	111	C66 E90	C66-S68 PolarHBondContact O-N 3.19Å; S68-E90 CarbonylContact C-O 3.52Å; S68-E90 VanDerWaalsContact CA-O 3.31Å; S68-E90 WeakPolarHBondContact CA-O 2.94Å
69	R	94.8	Very high	95.9	Very high	127 Å²	127	80 Å²	80	48%	0.479	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.6	157.1	170.9	64.1	172.3	174.6	178.9	6.8	111.6	F67 Y71 S89 E90	F67-R69 HydrophobicContact CE1-CG 3.84Å; F67-R69 HydrophobicContact CZ-CB 4.18Å; F67-R69 HydrophobicContact CZ-CG 3.71Å; R69-Y71 HydrophobicContact CG-CD1 4.12Å; R69-Y71 HydrophobicContact CG-CE1 4.31Å; R69-S89 WeakPolarHBondContact O-CA 2.79Å; R69-E90 HydrophobicContact CG-CB 4.07Å; R69-E90 IonicContact CZ-OE2 3.81Å; R69-E90 PolarHBondContact N-O 3.5Å; R69-E90 IonicContact NE-OE2 3.54Å; R69-E90 PolarHBondContact NE-OE2 2.82Å; R69-E90 IonicContact NH2-OE1 3.21Å; R69-E90 IonicContact NH2-OE2 3.14Å; R69-E90 PolarHBondContact NH2-OE2 2.74Å; R69-E90 PolarHBondContact O-N 3.37Å
70	A	96.3	Very high	96.1	Very high	70 Å²	70	85.4 Å²	85.4	58%	0.579	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.3	141.8	168.2	0	0	0	0	0	109.1	I87 T88	A70-I87 HydrophobicContact CB-CG2 4.04Å; A70-T88 WeakPolarHBondContact CA-O 3.43Å
71	Y	96.7	Very high	96.1	Very high	68 Å²	68	85 Å²	85	27%	0.267	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.3	160.2	179.7	57.2	-93.3	0	0	0	110.7	R69 T73 T88 E90	R69-Y71 HydrophobicContact CG-CD1 4.12Å; R69-Y71 HydrophobicContact CG-CE1 4.31Å; Y71-T73 PolarHBondContact O-N 2.82Å; Y71-T88 HydrophobicContact CE1-CG2 4.28Å; Y71-T88 HydrophobicContact CE2-CG2 4.12Å; Y71-T88 PolarHBondContact N-O 3Å; Y71-T88 PolarHBondContact O-N 3.42Å; Y71-E90 HydrophobicContact CE1-CG 3.91Å; Y71-E90 PolarHBondContact OH-OE1 3.28Å
72	P	98.1	Very high	96.2	Very high	101 Å²	101	87.6 Å²	87.6	66%	0.656	48%	0.475	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.7	128.5	175.7	-24.3	34.8	0	0	0	111.6	P74 N86	P72-P74 WeakPolarHBondContact O-CD 3.01Å; P72-N86 CarbonylContact C-O 3.57Å; P72-N86 WeakPolarHBondContact CA-O 3.03Å
73	T	98.1	Very high	96.1	Very high	11 Å²	11	91 Å²	91	7%	0.067	50%	0.495	C	S	.	.	P	Polyproline II helix	trans	-63.8	126.4	179.5	-55	0	0	0	0	110	Y71 Q75 K77 M78 M81 K85 N86 I87 T88	Y71-T73 PolarHBondContact O-N 2.82Å; T73-Q75 PolarHBondContact O-N 3.35Å; T73-K77 HydrophobicContact CG2-CB 3.92Å; T73-M78 HydrophobicContact CG2-CG 3.42Å; T73-M78 VanDerWaalsContact CG2-CG 3.42Å; T73-M81 HydrophobicContact CG2-CE 3.73Å; T73-K85 WeakPolarHBondContact CB-O 3.46Å; T73-K85 PolarHBondContact OG1-O 2.69Å; T73-N86 PolarHBondContact N-O 3.49Å; T73-N86 PolarHBondContact OG1-O 3.04Å; T73-I87 PolarHBondContact OG1-N 3.07Å; T73-T88 WeakPolarHBondContact CB-OG1 3.24Å; T73-T88 WeakPolarHBondContact CG2-OG1 3Å; T73-T88 PolarHBondContact OG1-N 2.83Å; T73-T88 VanDerWaalsContact OG1-N 3.15Å; T73-T88 PolarHBondContact OG1-OG1 3.09Å
74	P	97.8	Very high	96.2	Very high	65 Å²	65	87.6 Å²	87.6	42%	0.422	49%	0.488	S	S	.	.	P	Polyproline II helix	trans	-58.3	139.6	175.3	-24.8	34.1	0	0	0	111.5	P72 M76 K77 M78	P72-P74 WeakPolarHBondContact O-CD 3.01Å; P74-M76 PolarHBondContact O-N 3.45Å; P74-M76 VanDerWaalsContact O-N 3.14Å; P74-K77 HydrophobicContact CB-CG 4.42Å; P74-K77 WeakPolarHBondContact O-CA 3.38Å; P74-K77 WeakPolarHBondContact O-CB 3.47Å; P74-K77 PolarHBondContact O-N 3.22Å; P74-M78 PolarHBondContact O-N 2.86Å; P74-M78 VanDerWaalsContact O-N 3.1Å
75	Q	96.9	Very high	96.3	Very high	135 Å²	135	92.3 Å²	92.3	63%	0.631	50%	0.501	S	S	*	.	H	α-helix	trans	-52.9	-41.3	-177	-172.9	177.9	6.3	0	0	112.7	T73 K77 M78 Q79	T73-Q75 PolarHBondContact O-N 3.35Å; Q75-K77 VanDerWaalsContact C-N 3.28Å; Q75-K77 PolarHBondContact O-N 3.12Å; Q75-M78 PolarHBondContact O-N 3.05Å; Q75-M78 VanDerWaalsContact O-N 3.16Å; Q75-Q79 WeakPolarHBondContact O-CG 3Å; Q75-Q79 PolarHBondContact O-N 3.37Å; Q75-Q79 VanDerWaalsContact O-N 3.15Å
76	M	96.9	Very high	96.4	Very high	142 Å²	142	95.3 Å²	95.3	70%	0.7	51%	0.513	S	S	*	.	H	α-helix	trans	-59.8	-35	176.7	-64	-62	173	0	0	113.1	P74	P74-M76 PolarHBondContact O-N 3.45Å; P74-M76 VanDerWaalsContact O-N 3.14Å
77	K	96.8	Very high	96.5	Very high	131 Å²	131	99 Å²	99	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-77.1	-34	176.6	-70.2	-65.9	-172.3	-178.3	0	111.9	T73 P74 Q75 Q79 T80 M81	T73-K77 HydrophobicContact CG2-CB 3.92Å; P74-K77 HydrophobicContact CB-CG 4.42Å; P74-K77 WeakPolarHBondContact O-CA 3.38Å; P74-K77 WeakPolarHBondContact O-CB 3.47Å; P74-K77 PolarHBondContact O-N 3.22Å; Q75-K77 VanDerWaalsContact C-N 3.28Å; Q75-K77 PolarHBondContact O-N 3.12Å; K77-Q79 VanDerWaalsContact C-N 3.33Å; K77-Q79 PolarHBondContact O-N 2.93Å; K77-T80 PolarHBondContact O-N 2.99Å; K77-T80 PolarHBondContact O-OG1 2.68Å; K77-M81 HydrophobicContact CB-CE 4.41Å; K77-M81 WeakPolarHBondContact O-CG 3.38Å
78	M	96.9	Very high	96.6	Very high	51 Å²	51	94.7 Å²	94.7	25%	0.251	51%	0.514	S	S	.	.	H	α-helix	trans	-64.7	-37.9	176.9	-61.7	-165.8	-38.7	0	0	112	T73 P74 Q75 T80 M81	T73-M78 HydrophobicContact CG2-CG 3.42Å; T73-M78 VanDerWaalsContact CG2-CG 3.42Å; P74-M78 PolarHBondContact O-N 2.86Å; P74-M78 VanDerWaalsContact O-N 3.1Å; Q75-M78 PolarHBondContact O-N 3.05Å; Q75-M78 VanDerWaalsContact O-N 3.16Å; M78-T80 PolarHBondContact O-N 3.25Å; M78-M81 WeakPolarHBondContact O-CB 3.47Å; M78-M81 PolarHBondContact O-N 3.46Å; M78-M81 VanDerWaalsContact O-N 3.12Å
79	Q	97.1	Very high	96.6	Very high	137 Å²	137	94 Å²	94	64%	0.64	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.5	-23.3	179.9	-71.4	173.7	-2.5	0	0	113.5	Q75 K77	Q75-Q79 WeakPolarHBondContact O-CG 3Å; Q75-Q79 PolarHBondContact O-N 3.37Å; Q75-Q79 VanDerWaalsContact O-N 3.15Å; K77-Q79 VanDerWaalsContact C-N 3.33Å; K77-Q79 PolarHBondContact O-N 2.93Å
80	T	97.3	Very high	96.7	Very high	114 Å²	114	91.2 Å²	91.2	70%	0.699	50%	0.502	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.9	-3.4	177.2	63.6	0	0	0	0	113.6	K77 M78	K77-T80 PolarHBondContact O-N 2.99Å; K77-T80 PolarHBondContact O-OG1 2.68Å; M78-T80 PolarHBondContact O-N 3.25Å
81	M	96.8	Very high	96.6	Very high	67 Å²	67	89.8 Å²	89.8	33%	0.33	49%	0.49	S	S	.	.			trans	-91.3	135.3	-178	-64.9	174.8	-175.3	0	0	110.7	T73 K77 M78 V83 K85	T73-M81 HydrophobicContact CG2-CE 3.73Å; K77-M81 HydrophobicContact CB-CE 4.41Å; K77-M81 WeakPolarHBondContact O-CG 3.38Å; M78-M81 WeakPolarHBondContact O-CB 3.47Å; M78-M81 PolarHBondContact O-N 3.46Å; M78-M81 VanDerWaalsContact O-N 3.12Å; M81-V83 VanDerWaalsContact C-N 3.28Å; M81-V83 PolarHBondContact O-N 3.36Å; M81-K85 HydrophobicContact SD-CB 4.42Å
82	S	97.3	Very high	96.6	Very high	127 Å²	127	88 Å²	88	89%	0.888	49%	0.487	S	S	*	.	S	Bend	trans	-64.5	-35.4	170.7	54.9	0	0	0	0	112.2
83	V	96.1	Very high	96.6	Very high	94 Å²	94	85.2 Å²	85.2	57%	0.57	47%	0.469	S	S	*	.	S	Bend	trans	-125	100.9	172.6	-177.9	0	0	0	0	108.1	M81	M81-V83 VanDerWaalsContact C-N 3.28Å; M81-V83 PolarHBondContact O-N 3.36Å
84	P	95.6	Very high	96.6	Very high	79 Å²	79	85.9 Å²	85.9	51%	0.513	48%	0.475	S	S	.	.			trans	-58.9	140.1	-177.9	-26.5	35.3	0	0	0	112.9
85	K	95.1	Very high	96.6	Very high	126 Å²	126	85.1 Å²	85.1	55%	0.548	47%	0.469	S	S	.	.			trans	-125.4	126.8	173.8	-62	-65.1	-176	-178.8	0	109.3	T73 M81 I87	T73-K85 WeakPolarHBondContact CB-O 3.46Å; T73-K85 PolarHBondContact OG1-O 2.69Å; M81-K85 HydrophobicContact SD-CB 4.42Å; K85-I87 VanDerWaalsContact C-N 3.26Å; K85-I87 PolarHBondContact O-N 3.38Å
86	N	97.3	Very high	96.6	Very high	121 Å²	121	80.1 Å²	80.1	65%	0.647	45%	0.45	S	S	*	.	S	Bend	trans	-72.9	-20.4	-178.7	-65.3	-9.6	0	0	0	113.3	P72 T73	P72-N86 CarbonylContact C-O 3.57Å; P72-N86 WeakPolarHBondContact CA-O 3.03Å; T73-N86 PolarHBondContact N-O 3.49Å; T73-N86 PolarHBondContact OG1-O 3.04Å
87	I	96.6	Very high	96.6	Very high	104 Å²	104	78 Å²	78	53%	0.533	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	130.7	179.8	-56.5	-61.7	0	0	0	109	A70 T73 K85	A70-I87 HydrophobicContact CB-CG2 4.04Å; T73-I87 PolarHBondContact OG1-N 3.07Å; K85-I87 VanDerWaalsContact C-N 3.26Å; K85-I87 PolarHBondContact O-N 3.38Å
88	T	95.7	Very high	96.7	Very high	32 Å²	32	76.6 Å²	76.6	20%	0.196	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	132.1	169.9	-66.9	0	0	0	0	108.8	A70 Y71 T73	A70-T88 WeakPolarHBondContact CA-O 3.43Å; Y71-T88 HydrophobicContact CE1-CG2 4.28Å; Y71-T88 HydrophobicContact CE2-CG2 4.12Å; Y71-T88 PolarHBondContact N-O 3Å; Y71-T88 PolarHBondContact O-N 3.42Å; T73-T88 WeakPolarHBondContact CB-OG1 3.24Å; T73-T88 WeakPolarHBondContact CG2-OG1 3Å; T73-T88 PolarHBondContact OG1-N 2.83Å; T73-T88 VanDerWaalsContact OG1-N 3.15Å; T73-T88 PolarHBondContact OG1-OG1 3.09Å
89	S	95.1	Very high	96.7	Very high	73 Å²	73	76.3 Å²	76.3	51%	0.51	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	122.4	173.3	-179.8	0	0	0	0	109.4	R69	R69-S89 WeakPolarHBondContact O-CA 2.79Å
90	E	95.6	Very high	96.7	Very high	68 Å²	68	75.5 Å²	75.5	32%	0.318	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	117.7	170.4	-73.2	177.9	-172.9	0	0	108.1	S68 R69 Y71	S68-E90 CarbonylContact C-O 3.52Å; S68-E90 VanDerWaalsContact CA-O 3.31Å; S68-E90 WeakPolarHBondContact CA-O 2.94Å; R69-E90 HydrophobicContact CG-CB 4.07Å; R69-E90 IonicContact CZ-OE2 3.81Å; R69-E90 PolarHBondContact N-O 3.5Å; R69-E90 IonicContact NE-OE2 3.54Å; R69-E90 PolarHBondContact NE-OE2 2.82Å; R69-E90 IonicContact NH2-OE1 3.21Å; R69-E90 IonicContact NH2-OE2 3.14Å; R69-E90 PolarHBondContact NH2-OE2 2.74Å; R69-E90 PolarHBondContact O-N 3.37Å; Y71-E90 HydrophobicContact CE1-CG 3.91Å; Y71-E90 PolarHBondContact OH-OE1 3.28Å
91	A	95.4	Very high	96.6	Very high	40 Å²	40	76.1 Å²	76.1	33%	0.331	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.4	147	-176.5	0	0	0	0	0	111.2
92	S	96.8	Very high	96.4	Very high	31 Å²	31	75.2 Å²	75.2	22%	0.217	42%	0.418	C	S	.	.			trans	-123.2	146.4	166.6	57.8	0	0	0	0	108.9	C66 F67 S118	C66-S92 WeakPolarHBondContact CB-O 3.4Å; C66-S92 WeakPolarHBondContact CB-OG 3.4Å; F67-S92 PolarHBondContact N-OG 2.65Å; F67-S92 PolarHBondContact O-N 2.91Å; F67-S92 PolarHBondContact O-OG 3.48Å; S92-S118 CarbonylContact C-O 3.49Å; S92-S118 VanDerWaalsContact CA-O 3.24Å; S92-S118 WeakPolarHBondContact CA-O 3.36Å
93	C	97.3	Very high	96	Very high	41 Å²	41	75.1 Å²	75.1	28%	0.277	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	146.9	-175.8	-74.2	0	0	0	0	110.5	C66 V95 C117 S118 C120	C66-C93 VanDerWaalsContact SG-C 3.56Å; C93-V95 HydrophobicContact CB-CG1 4.26Å; C93-V95 PolarHBondContact O-N 2.8Å; C93-C117 WeakPolarHBondContact O-CA 3.4Å; C93-S118 PolarHBondContact N-O 3.01Å; C93-S118 PolarHBondContact O-N 2.68Å; C93-C120 VanDerWaalsContact CA-SG 3.6Å; C93-C120 HydrophobicContact CB-CB 3.95Å; C93-C120 WeakPolarHBondContact CB-SG 3.38Å; C93-C120 PolarHBondContact N-SG 3.35Å; C93-C120 WeakPolarHBondContact SG-CB 3.33Å; C93-C120 CovalentContact SG-SG 2.03Å; C93-C120 PolarHBondContact SG-SG 3.48Å
94	C	97.5	Very high	95.5	Very high	26 Å²	26	72.2 Å²	72.2	18%	0.176	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.8	109.5	176	-173.6	0	0	0	0	109.4	C44 C66	C44-C94 WeakPolarHBondContact CA-SG 3.41Å; C44-C94 HydrophobicContact CB-CB 3.64Å; C44-C94 WeakPolarHBondContact CB-SG 3.41Å; C44-C94 WeakPolarHBondContact SG-CA 3.28Å; C44-C94 WeakPolarHBondContact SG-CB 3.42Å; C44-C94 CovalentContact SG-SG 2.04Å; C44-C94 PolarHBondContact SG-SG 2.87Å; C66-C94 VanDerWaalsContact SG-CA 3.59Å; C66-C94 PolarHBondContact SG-N 2.85Å; C66-C94 VanDerWaalsContact SG-N 3.38Å
95	V	97.8	Very high	95	Very high	49 Å²	49	71.7 Å²	71.7	30%	0.297	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	163.5	-175.9	-61.3	0	0	0	0	110.9	C93 C115 H116 S118	C93-V95 HydrophobicContact CB-CG1 4.26Å; C93-V95 PolarHBondContact O-N 2.8Å; V95-C115 WeakPolarHBondContact O-CA 3.42Å; V95-H116 PolarHBondContact N-O 3.37Å; V95-H116 PolarHBondContact O-N 2.9Å; V95-S118 VanDerWaalsContact CG2-CB 3.46Å
96	A	98	Very high	94.6	Very high	30 Å²	30	72.2 Å²	72.2	25%	0.248	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71	128.7	173	0	0	0	0	0	110.6	H112 E114	A96-H112 HydrophobicContact CB-CB 4.27Å; A96-E114 CarbonylContact C-O 3.58Å; A96-E114 WeakPolarHBondContact CA-O 3.18Å
97	K	97.8	Very high	94.2	Very high	98 Å²	98	71.5 Å²	71.5	43%	0.426	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.7	-43.5	164.9	-166.4	169.4	146.7	-139.1	0	110.7	E114 H116	K97-E114 HydrophobicContact CB-CB 4.15Å; K97-E114 HydrophobicContact CB-CG 4.19Å; K97-E114 HydrophobicContact CD-CG 4.41Å; K97-E114 WeakPolarHBondContact CD-OE1 3.48Å; K97-E114 PolarHBondContact N-O 2.91Å; K97-E114 IonicContact NZ-OE1 2.75Å; K97-E114 PolarHBondContact NZ-OE1 3.34Å; K97-E114 IonicContact NZ-OE2 2.88Å; K97-E114 PolarHBondContact NZ-OE2 3.47Å; K97-H116 WeakPolarHBondContact CA-ND1 3.3Å; K97-H116 WeakPolarHBondContact CB-ND1 3.2Å; K97-H116 PolarHBondContact N-ND1 2.88Å
98	H	98	Very high	94	Very high	100 Å²	100	70.6 Å²	70.6	46%	0.463	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	142	178.9	-64.1	-52.8	0	0	0	109.8	T113 E114	H98-T113 VanDerWaalsContact CB-OG1 3.24Å; H98-T113 WeakPolarHBondContact CB-OG1 3.37Å; H98-T113 PolarHBondContact O-N 3.42Å; H98-T113 PolarHBondContact O-OG1 2.85Å; H98-E114 HydrophobicContact CB-CB 4.42Å; H98-E114 IonicContact CD2-OE2 2.75Å; H98-E114 PolarHBondContact CD2-OE2 2.87Å; H98-E114 IonicContact NE2-OE2 2.7Å; H98-E114 PolarHBondContact O-N 3.25Å
99	S	97.1	Very high	93.9	Very high	46 Å²	46	69.9 Å²	69.9	32%	0.322	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-160.1	157.7	179.1	60.1	0	0	0	0	109.2	N111	S99-N111 CarbonylContact C-O 3.58Å; S99-N111 WeakPolarHBondContact CA-O 3.13Å; S99-N111 WeakPolarHBondContact CB-O 3.39Å
100	Y	96.7	Very high	93.9	Very high	119 Å²	119	73.2 Å²	73.2	47%	0.467	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	156.5	168.9	61.9	-87.1	0	0	0	109.9	M102 R110 N111 T113	Y100-M102 HydrophobicContact CD2-CB 4.32Å; Y100-M102 HydrophobicContact CE2-CB 4.08Å; Y100-M102 HydrophobicContact CE2-CG 4.28Å; Y100-M102 HydrophobicContact CE2-SD 3.96Å; Y100-R110 WeakPolarHBondContact O-CA 3.38Å; Y100-N111 HydrophobicContact CD1-CB 4.49Å; Y100-N111 HydrophobicContact CD2-CB 4.45Å; Y100-N111 HydrophobicContact CE1-CB 3.98Å; Y100-N111 HydrophobicContact CE2-CB 3.93Å; Y100-N111 PolarHBondContact N-O 2.75Å; Y100-N111 PolarHBondContact O-N 3.42Å; Y100-N111 PolarHBondContact OH-ND2 2.85Å; Y100-T113 HydrophobicContact CD1-CG2 3.87Å; Y100-T113 HydrophobicContact CE1-CG2 3.76Å
101	E	95.5	Very high	93.9	Very high	128 Å²	128	70.2 Å²	70.2	60%	0.598	39%	0.388	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.9	138	175.1	-74.6	171.5	-158	0	0	109.9	V109 R110	E101-V109 WeakPolarHBondContact CA-O 3.33Å; E101-R110 HydrophobicContact CG-CG 3.63Å; E101-R110 IonicContact OE1-CZ 3.41Å; E101-R110 IonicContact OE1-NE 3.03Å; E101-R110 PolarHBondContact OE1-NE 3.33Å; E101-R110 IonicContact OE1-NH2 2.91Å; E101-R110 PolarHBondContact OE1-NH2 2.87Å
102	M	91.6	Very high	94	Very high	47 Å²	47	70.1 Å²	70.1	23%	0.232	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.5	161.1	174.3	65.1	178.1	-71.6	0	0	109.9	A57 I59 Y100 V109 N111	A57-M102 HydrophobicContact CB-CE 3.96Å; I59-M102 HydrophobicContact CG1-SD 4.28Å; Y100-M102 HydrophobicContact CD2-CB 4.32Å; Y100-M102 HydrophobicContact CE2-CB 4.08Å; Y100-M102 HydrophobicContact CE2-CG 4.28Å; Y100-M102 HydrophobicContact CE2-SD 3.96Å; M102-V109 HydrophobicContact CG-CG2 3.74Å; M102-V109 PolarHBondContact N-O 3.34Å; M102-V109 WeakPolarHBondContact O-CG2 3.26Å; M102-V109 PolarHBondContact O-N 3.49Å; M102-V109 VanDerWaalsContact O-O 3.13Å; M102-N111 HydrophobicContact CG-CB 4.28Å; M102-N111 HydrophobicContact SD-CB 3.81Å; M102-N111 PolarHBondContact SD-ND2 3.4Å
103	M	89.6	Confident	94.1	Very high	126 Å²	126	72.2 Å²	72.2	62%	0.621	39%	0.392	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.4	122.1	174.9	-67.8	-64.3	180	0	0	109.5	P108	M103-P108 HydrophobicContact CE-CB 4.03Å; M103-P108 HydrophobicContact SD-CB 3.88Å
104	Q	85.4	Confident	94.1	Very high	32 Å²	32	73.9 Å²	73.9	15%	0.15	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	94.2	165.6	-169.8	66.7	30.1	0	0	107.6	L52 K54 I59 T106 I107 V109	L52-Q104 WeakPolarHBondContact O-CG 3.38Å; K54-Q104 PolarHBondContact O-NE2 2.87Å; I59-Q104 HydrophobicContact CD1-CB 3.83Å; I59-Q104 HydrophobicContact CD1-CG 3.76Å; Q104-T106 PolarHBondContact O-N 3.29Å; Q104-I107 PolarHBondContact N-O 2.86Å; Q104-I107 PolarHBondContact O-N 2.89Å; Q104-V109 HydrophobicContact CB-CG1 4.31Å; Q104-V109 HydrophobicContact CB-CG2 3.95Å
105	G	85.3	Confident	94.1	Very high	69 Å²	69	73.9 Å²	73.9	71%	0.711	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.6	-114.4	-166.1	0	0	0	0	0	110.6
106	T	86.8	Confident	94.1	Very high	136 Å²	136	74.5 Å²	74.5	83%	0.834	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.8	0.1	178.1	54.9	0	0	0	0	113.8	Q104	Q104-T106 PolarHBondContact O-N 3.29Å
107	I	88.8	Confident	94.1	Very high	107 Å²	107	76 Å²	76	55%	0.549	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	120.6	-175.4	-57.6	174.6	0	0	0	109	Q104 V109	Q104-I107 PolarHBondContact N-O 2.86Å; Q104-I107 PolarHBondContact O-N 2.89Å; I107-V109 HydrophobicContact CG2-CG1 4.04Å; I107-V109 PolarHBondContact O-N 3.26Å
108	P	92.3	Very high	94.1	Very high	85 Å²	85	73.4 Å²	73.4	55%	0.552	40%	0.397	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.8	127.2	170.6	28.5	-32.2	0	0	0	109.3	M103	M103-P108 HydrophobicContact CE-CB 4.03Å; M103-P108 HydrophobicContact SD-CB 3.88Å
109	V	93.2	Very high	94.1	Very high	17 Å²	17	72.6 Å²	72.6	10%	0.103	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	150.5	179.5	-64.3	0	0	0	0	109.6	I59 E101 M102 Q104 I107	I59-V109 HydrophobicContact CD1-CG2 3.7Å; I59-V109 HydrophobicContact CG1-CG2 4.44Å; E101-V109 WeakPolarHBondContact CA-O 3.33Å; M102-V109 HydrophobicContact CG-CG2 3.74Å; M102-V109 PolarHBondContact N-O 3.34Å; M102-V109 WeakPolarHBondContact O-CG2 3.26Å; M102-V109 PolarHBondContact O-N 3.49Å; M102-V109 VanDerWaalsContact O-O 3.13Å; Q104-V109 HydrophobicContact CB-CG1 4.31Å; Q104-V109 HydrophobicContact CB-CG2 3.95Å; I107-V109 HydrophobicContact CG2-CG1 4.04Å; I107-V109 PolarHBondContact O-N 3.26Å
110	R	95.4	Very high	94	Very high	142 Å²	142	71 Å²	71	54%	0.536	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.4	120.7	169.7	-82.5	-172.6	170.1	-177	-3.7	110.1	Y100 E101	Y100-R110 WeakPolarHBondContact O-CA 3.38Å; E101-R110 HydrophobicContact CG-CG 3.63Å; E101-R110 IonicContact OE1-CZ 3.41Å; E101-R110 IonicContact OE1-NE 3.03Å; E101-R110 PolarHBondContact OE1-NE 3.33Å; E101-R110 IonicContact OE1-NH2 2.91Å; E101-R110 PolarHBondContact OE1-NH2 2.87Å
111	N	95.7	Very high	93.9	Very high	6 Å²	6	74 Å²	74	3%	0.032	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.5	119.2	171.6	-161.5	-11.4	0	0	0	108.8	Q58 Y60 S99 Y100 M102	Q58-N111 PolarHBondContact O-ND2 2.72Å; Y60-N111 PolarHBondContact N-OD1 2.86Å; S99-N111 CarbonylContact C-O 3.58Å; S99-N111 WeakPolarHBondContact CA-O 3.13Å; S99-N111 WeakPolarHBondContact CB-O 3.39Å; Y100-N111 HydrophobicContact CD1-CB 4.49Å; Y100-N111 HydrophobicContact CD2-CB 4.45Å; Y100-N111 HydrophobicContact CE1-CB 3.98Å; Y100-N111 HydrophobicContact CE2-CB 3.93Å; Y100-N111 PolarHBondContact N-O 2.75Å; Y100-N111 PolarHBondContact O-N 3.42Å; Y100-N111 PolarHBondContact OH-ND2 2.85Å; M102-N111 HydrophobicContact CG-CB 4.28Å; M102-N111 HydrophobicContact SD-CB 3.81Å; M102-N111 PolarHBondContact SD-ND2 3.4Å
112	H	97.8	Very high	93.8	Very high	37 Å²	37	78.3 Å²	78.3	17%	0.171	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.6	146.4	-177.1	-60.9	-174.9	0	0	0	110.1	L46 Y60 C62 A96	L46-H112 HydrophobicContact CD1-CB 3.6Å; L46-H112 WeakPolarHBondContact CD1-O 3.46Å; Y60-H112 WeakPolarHBondContact O-CB 3.32Å; Y60-H112 PolarHBondContact O-N 3.43Å; C62-H112 PolarHBondContact N-ND1 3.44Å; C62-H112 PolarHBondContact SG-ND1 2.87Å; A96-H112 HydrophobicContact CB-CB 4.27Å
113	T	97.7	Very high	93.7	Very high	76 Å²	76	80.2 Å²	80.2	47%	0.466	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	-23.1	178.1	59	0	0	0	0	112.9	H98 Y100	H98-T113 VanDerWaalsContact CB-OG1 3.24Å; H98-T113 WeakPolarHBondContact CB-OG1 3.37Å; H98-T113 PolarHBondContact O-N 3.42Å; H98-T113 PolarHBondContact O-OG1 2.85Å; Y100-T113 HydrophobicContact CD1-CG2 3.87Å; Y100-T113 HydrophobicContact CE1-CG2 3.76Å
114	E	98.1	Very high	93.6	Very high	76 Å²	76	81.6 Å²	81.6	36%	0.355	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.5	144.2	176.5	-171	-175.2	169.4	0	0	110.2	A96 K97 H98	A96-E114 CarbonylContact C-O 3.58Å; A96-E114 WeakPolarHBondContact CA-O 3.18Å; K97-E114 HydrophobicContact CB-CB 4.15Å; K97-E114 HydrophobicContact CB-CG 4.19Å; K97-E114 HydrophobicContact CD-CG 4.41Å; K97-E114 WeakPolarHBondContact CD-OE1 3.48Å; K97-E114 PolarHBondContact N-O 2.91Å; K97-E114 IonicContact NZ-OE1 2.75Å; K97-E114 PolarHBondContact NZ-OE1 3.34Å; K97-E114 IonicContact NZ-OE2 2.88Å; K97-E114 PolarHBondContact NZ-OE2 3.47Å; H98-E114 HydrophobicContact CB-CB 4.42Å; H98-E114 IonicContact CD2-OE2 2.75Å; H98-E114 PolarHBondContact CD2-OE2 2.87Å; H98-E114 IonicContact NE2-OE2 2.7Å; H98-E114 PolarHBondContact O-N 3.25Å
115	C	98.2	Very high	93.3	Very high	25 Å²	25	88.5 Å²	88.5	17%	0.169	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	143.7	-179.4	-53.6	0	0	0	0	111.7	S45 C62 V95	S45-C115 VanDerWaalsContact C-SG 3.59Å; C62-C115 WeakPolarHBondContact CA-SG 3.31Å; C62-C115 HydrophobicContact CB-CB 3.78Å; C62-C115 WeakPolarHBondContact CB-SG 3.39Å; C62-C115 WeakPolarHBondContact SG-CA 3.25Å; C62-C115 WeakPolarHBondContact SG-CB 3.47Å; C62-C115 CovalentContact SG-SG 2.03Å; C62-C115 PolarHBondContact SG-SG 3.41Å; V95-C115 WeakPolarHBondContact O-CA 3.42Å
116	H	98.1	Very high	92	Very high	63 Å²	63	96.7 Å²	96.7	29%	0.292	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.8	164.3	170.9	70.2	-67.7	0	0	0	111.6	V95 K97 S118	V95-H116 PolarHBondContact N-O 3.37Å; V95-H116 PolarHBondContact O-N 2.9Å; K97-H116 WeakPolarHBondContact CA-ND1 3.3Å; K97-H116 WeakPolarHBondContact CB-ND1 3.2Å; K97-H116 PolarHBondContact N-ND1 2.88Å; H116-S118 VanDerWaalsContact CD2-CB 3.48Å; H116-S118 WeakPolarHBondContact CD2-CB 3.26Å; H116-S118 WeakPolarHBondContact NE2-CB 3.27Å; H116-S118 PolarHBondContact NE2-OG 2.85Å; H116-S118 VanDerWaalsContact NE2-OG 3.07Å
117	C	97.9	Very high	92.2	Very high	62 Å²	62	94.8 Å²	94.8	42%	0.419	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.7	118.8	171	-65.1	0	0	0	0	109.5	C66 C93	C66-C117 VanDerWaalsContact CA-SG 3.52Å; C66-C117 HydrophobicContact CB-CB 3.69Å; C66-C117 WeakPolarHBondContact CB-SG 3.41Å; C66-C117 WeakPolarHBondContact SG-CA 3.45Å; C66-C117 WeakPolarHBondContact SG-CB 3.44Å; C66-C117 CovalentContact SG-SG 2.03Å; C66-C117 PolarHBondContact SG-SG 3.3Å; C93-C117 WeakPolarHBondContact O-CA 3.4Å
118	S	97.8	Very high	92.4	Very high	42 Å²	42	94.1 Å²	94.1	29%	0.294	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	-166.4	-174.2	-146.7	0	0	0	0	113.1	S92 C93 V95 H116 C120	S92-S118 CarbonylContact C-O 3.49Å; S92-S118 VanDerWaalsContact CA-O 3.24Å; S92-S118 WeakPolarHBondContact CA-O 3.36Å; C93-S118 PolarHBondContact N-O 3.01Å; C93-S118 PolarHBondContact O-N 2.68Å; V95-S118 VanDerWaalsContact CG2-CB 3.46Å; H116-S118 VanDerWaalsContact CD2-CB 3.48Å; H116-S118 WeakPolarHBondContact CD2-CB 3.26Å; H116-S118 WeakPolarHBondContact NE2-CB 3.27Å; H116-S118 PolarHBondContact NE2-OG 2.85Å; H116-S118 VanDerWaalsContact NE2-OG 3.07Å; S118-C120 PolarHBondContact O-N 2.99Å
119	T	97.1	Very high	92.4	Very high	84 Å²	84	94.6 Å²	94.6	52%	0.515	46%	0.458	S	S	.	.			trans	-57.8	130.3	-179.6	-52.2	0	0	0	0	111.9	Y121	T119-Y121 HydrophobicContact CG2-CD1 3.96Å; T119-Y121 HydrophobicContact CG2-CE1 3.56Å
120	C	96.1	Very high	92.4	Very high	12 Å²	12	99.2 Å²	99.2	8%	0.081	48%	0.479	C	S	.	.			trans	-86.2	115.1	173.7	-63.5	0	0	0	0	110.9	C93 S118 H123	C93-C120 VanDerWaalsContact CA-SG 3.6Å; C93-C120 HydrophobicContact CB-CB 3.95Å; C93-C120 WeakPolarHBondContact CB-SG 3.38Å; C93-C120 PolarHBondContact N-SG 3.35Å; C93-C120 WeakPolarHBondContact SG-CB 3.33Å; C93-C120 CovalentContact SG-SG 2.03Å; C93-C120 PolarHBondContact SG-SG 3.48Å; S118-C120 PolarHBondContact O-N 2.99Å; C120-H123 HydrophobicContact CB-CB 3.84Å; C120-H123 VanDerWaalsContact CB-CG 3.42Å; C120-H123 WeakPolarHBondContact CB-ND1 3.16Å; C120-H123 PolarHBondContact O-CE1 2.98Å; C120-H123 PolarHBondContact O-ND1 3.38Å
121	Y	94.3	Very high	92.2	Very high	181 Å²	181	96.5 Å²	96.5	71%	0.71	48%	0.475	S	S	*	.	S	Bend	trans	-88.2	-31.1	177.5	-61.5	-42.5	0	0	0	114.3	T119	T119-Y121 HydrophobicContact CG2-CD1 3.96Å; T119-Y121 HydrophobicContact CG2-CE1 3.56Å
122	Y	92.4	Very high	91.9	Very high	220 Å²	220	102.5 Å²	102.5	86%	0.863	51%	0.505	S	S	*	.	S	Bend	trans	-116.3	20.5	-169.9	-50.7	-68.9	0	0	0	113.9
123	H	89.7	Confident	91.5	Very high	86 Å²	86	107.2 Å²	107.2	40%	0.398	53%	0.529	S	S	.	.			trans	-89.7	-6.8	-175.7	73.7	-66.6	0	0	0	114.5	C120	C120-H123 HydrophobicContact CB-CB 3.84Å; C120-H123 VanDerWaalsContact CB-CG 3.42Å; C120-H123 WeakPolarHBondContact CB-ND1 3.16Å; C120-H123 PolarHBondContact O-CE1 2.98Å; C120-H123 PolarHBondContact O-ND1 3.38Å
124	K	87.8	Confident	91	Very high	156 Å²	156	109.6 Å²	109.6	68%	0.678	53%	0.534	S	S	*	.	S	Bend	trans	-106.7	136.2	179.2	-65.3	179.9	-179.2	177.1	0	109.2
125	L	80.1	Confident	90.5	Very high	176 Å²	176	112.4 Å²	112.4	92%	0.921	55%	0.548	S	S	*	.			trans	-71.2	125.7	164.5	-61.3	171.6	0	0	0	107.1
126	I	56.1	Low	89.8	Confident	242 Å²	242	120.4 Å²	120.4	100%	1.241	58%	0.583	S	S	*	*			trans	-66	0	174.8	-63.2	171.9	0	0	0	108.9

Retrieved 126 of 126 residues in 22.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).