A0A087Y8I9_POEFO Loading...

BET1-like protein

Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex.

AlphaFold DB , UniProt , Accession A0A087Y8I9, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 143 aa.

						>A0A087Y8I9_POEFO|A0A087Y8I9
MFFFLPLTKWRTYVIEETRWSCASEQLIVPSESNMADWNRGHGSVDSMLDAENKRLADNLASKVSRLKSLAYDIDRDVEDQNDYLDNMDSNFMSATGLLSGSVKRFSTMVRSGKDNRRLLCYVSGGLVLAFFLLYYLVSRIQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.1	Very low	45.9	Very low	231 Å²	231	159.1 Å²	159.1	100%	1.138	74%	0.74	S	S	*	*				0	63.6	0	-158.9	169.7	-172.9	0	0	106.3
2	F	38.3	Very low	46.5	Very low	194 Å²	194	153 Å²	153	85%	0.851	72%	0.722	S	S	*	*				49.7	120.2	69.4	-85.8	-73.5	0	0	0	112.8
3	F	40.3	Very low	46.6	Very low	156 Å²	156	154 Å²	154	68%	0.684	72%	0.717	S	S	*	*			trans	76.2	98.6	160	-101.4	-98.5	0	0	0	116.6
4	F	46.4	Very low	47.1	Very low	169 Å²	169	148.8 Å²	148.8	74%	0.741	70%	0.701	S	S	*	*				165	84.3	112.3	-104	-92	0	0	0	109.2
5	L	48.1	Very low	47.5	Very low	160 Å²	160	145.1 Å²	145.1	84%	0.838	69%	0.686	S	S	*	*	S	Bend	trans	-121.3	143.3	145.7	-98.7	124.3	0	0	0	106.8
6	P	45.3	Very low	47.7	Very low	68 Å²	68	142.1 Å²	142.1	44%	0.442	67%	0.671	S	S	.	*			trans	-65	145.7	-140	24	-34.1	0	0	0	112.2	T8 K9	P6-T8 PolarHBondContact O-N 3.2Å; P6-K9 PolarHBondContact O-N 2.62Å
7	L	51.1	Low	47.7	Very low	128 Å²	128	141.2 Å²	141.2	67%	0.67	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.3	2.9	171.9	-74.5	165.1	0	0	0	114
8	T	49.8	Very low	47.7	Very low	106 Å²	106	137.7 Å²	137.7	65%	0.65	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.4	-20.4	170.8	57.4	0	0	0	0	113.4	P6 T12	P6-T8 PolarHBondContact O-N 3.2Å; T8-T12 PolarHBondContact O-OG1 2.81Å
9	K	52.6	Low	47.8	Very low	159 Å²	159	138.3 Å²	138.3	69%	0.691	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.5	-26.1	-177.3	-137.4	-174.7	-175.1	-174	0	114.7	P6 T12 Y13	P6-K9 PolarHBondContact O-N 2.62Å; K9-T12 PolarHBondContact O-OG1 3.37Å; K9-Y13 PolarHBondContact O-N 3.21Å
10	W	44.1	Very low	47.8	Very low	191 Å²	191	140.3 Å²	140.3	72%	0.723	65%	0.652	S	S	*	*	H	α-helix	trans	-73.6	-29.1	174.5	-86	91	0	0	0	112.8	V14	W10-V14 PolarHBondContact O-N 3Å
11	R	49.5	Very low	47.9	Very low	188 Å²	188	137.4 Å²	137.4	71%	0.709	65%	0.648	S	S	*	*	H	α-helix	trans	-74.9	-26.6	178.2	-157.3	174.7	-179.1	-97.3	-0.1	112.8	I15	R11-I15 WeakPolarHBondContact O-CD1 3.14Å; R11-I15 VanDerWaalsContact O-CG1 3.25Å; R11-I15 WeakPolarHBondContact O-CG1 3.26Å
12	T	53.1	Low	48.3	Very low	86 Å²	86	131.3 Å²	131.3	53%	0.528	63%	0.627	S	S	.	*	H	α-helix	trans	-81.5	-36.6	173.5	28.3	0	0	0	0	112.5	T8 K9 I15 E16	T8-T12 PolarHBondContact O-OG1 2.81Å; K9-T12 PolarHBondContact O-OG1 3.37Å; T12-I15 PolarHBondContact O-N 2.81Å; T12-E16 PolarHBondContact O-N 2.86Å
13	Y	47.9	Very low	48.8	Very low	166 Å²	166	125.4 Å²	125.4	65%	0.651	61%	0.614	S	S	*	*	H	α-helix	trans	-67.4	-43.8	179.7	-140.4	-90.9	0	0	0	112.7	K9 I15 E16 E17	K9-Y13 PolarHBondContact O-N 3.21Å; Y13-I15 VanDerWaalsContact C-N 3.35Å; Y13-I15 PolarHBondContact O-N 3.23Å; Y13-E16 PolarHBondContact O-N 3.42Å; Y13-E17 PolarHBondContact O-N 3.42Å
14	V	53	Low	49.4	Very low	81 Å²	81	122.5 Å²	122.5	49%	0.491	61%	0.613	S	S	.	*	H	α-helix	trans	-67.9	-31.5	178.6	169.3	0	0	0	0	112.9	W10 T18	W10-V14 PolarHBondContact O-N 3Å; V14-T18 PolarHBondContact O-N 3.47Å; V14-T18 PolarHBondContact O-OG1 3.39Å
15	I	53.7	Low	49.6	Very low	94 Å²	94	122.6 Å²	122.6	48%	0.482	62%	0.616	S	S	.	*	H	α-helix	trans	-74.6	-32.9	178.1	-69.7	-177.6	0	0	0	111.5	R11 T12 Y13 T18 R19	R11-I15 WeakPolarHBondContact O-CD1 3.14Å; R11-I15 VanDerWaalsContact O-CG1 3.25Å; R11-I15 WeakPolarHBondContact O-CG1 3.26Å; T12-I15 PolarHBondContact O-N 2.81Å; Y13-I15 VanDerWaalsContact C-N 3.35Å; Y13-I15 PolarHBondContact O-N 3.23Å; I15-T18 WeakPolarHBondContact CA-OG1 3.35Å; I15-T18 PolarHBondContact O-OG1 2.82Å; I15-R19 WeakPolarHBondContact O-CB 3.08Å; I15-R19 PolarHBondContact O-N 3.43Å; I15-R19 VanDerWaalsContact O-N 3.15Å
16	E	50.9	Low	49.9	Very low	96 Å²	96	123 Å²	123	45%	0.449	61%	0.614	S	S	.	*	H	α-helix	trans	-74	-36.3	177.8	-163	135.1	-135.9	0	0	111.6	T12 Y13 R19 W20	T12-E16 PolarHBondContact O-N 2.86Å; Y13-E16 PolarHBondContact O-N 3.42Å; E16-R19 WeakPolarHBondContact O-CB 3.26Å; E16-R19 PolarHBondContact O-N 2.83Å; E16-R19 IonicContact OE1-CZ 3.84Å; E16-R19 IonicContact OE1-NH1 3.71Å; E16-R19 IonicContact OE1-NH2 2.82Å; E16-R19 PolarHBondContact OE1-NH2 3.31Å; E16-W20 PolarHBondContact O-N 3.49Å
17	E	47.8	Very low	50.3	Low	127 Å²	127	127.9 Å²	127.9	59%	0.593	64%	0.635	S	S	*	*	H	α-helix	trans	-72.9	-33.5	179.3	-149.1	154.3	-164.9	0	0	112.7	Y13 W20 S21	Y13-E17 PolarHBondContact O-N 3.42Å; E17-W20 PolarHBondContact O-N 3.45Å; E17-S21 PolarHBondContact O-N 3.49Å
18	T	46.4	Very low	50.3	Low	79 Å²	79	129.5 Å²	129.5	49%	0.485	64%	0.643	S	S	.	*	H	α-helix	trans	-73	-26.8	169.4	40.5	0	0	0	0	113.2	V14 I15 W20 S21 C22	V14-T18 PolarHBondContact O-N 3.47Å; V14-T18 PolarHBondContact O-OG1 3.39Å; I15-T18 WeakPolarHBondContact CA-OG1 3.35Å; I15-T18 PolarHBondContact O-OG1 2.82Å; T18-W20 VanDerWaalsContact C-N 3.31Å; T18-W20 PolarHBondContact O-N 3.03Å; T18-S21 PolarHBondContact O-N 3.42Å; T18-C22 PolarHBondContact O-N 2.8Å; T18-C22 VanDerWaalsContact O-N 3.1Å
19	R	50.7	Low	50.1	Low	148 Å²	148	130.8 Å²	130.8	56%	0.558	65%	0.65	S	S	*	*	H	α-helix	trans	-65.8	-32.9	173.5	-164.5	172.4	77.3	-146.5	-5.7	112.1	I15 E16 A23	I15-R19 WeakPolarHBondContact O-CB 3.08Å; I15-R19 PolarHBondContact O-N 3.43Å; I15-R19 VanDerWaalsContact O-N 3.15Å; E16-R19 WeakPolarHBondContact O-CB 3.26Å; E16-R19 PolarHBondContact O-N 2.83Å; E16-R19 IonicContact OE1-CZ 3.84Å; E16-R19 IonicContact OE1-NH1 3.71Å; E16-R19 IonicContact OE1-NH2 2.82Å; E16-R19 PolarHBondContact OE1-NH2 3.31Å; R19-A23 WeakPolarHBondContact O-CB 3.36Å; R19-A23 PolarHBondContact O-N 3.49Å
20	W	47.5	Very low	49.9	Very low	178 Å²	178	129.1 Å²	129.1	67%	0.674	66%	0.655	S	S	*	*	H	α-helix	trans	-73.2	-38.3	171.7	-64	105.6	0	0	0	112.1	E16 E17 T18 C22 A23 S24	E16-W20 PolarHBondContact O-N 3.49Å; E17-W20 PolarHBondContact O-N 3.45Å; T18-W20 VanDerWaalsContact C-N 3.31Å; T18-W20 PolarHBondContact O-N 3.03Å; W20-C22 PolarHBondContact O-N 2.8Å; W20-A23 PolarHBondContact O-N 2.88Å; W20-S24 PolarHBondContact O-N 3.2Å; W20-S24 PolarHBondContact O-OG 3.44Å
21	S	48.8	Very low	50	Low	81 Å²	81	125 Å²	125	57%	0.566	66%	0.656	S	S	*	*	H	α-helix	trans	-71.4	-29.7	-176.6	-153.6	0	0	0	0	114.1	E17 T18	E17-S21 PolarHBondContact O-N 3.49Å; T18-S21 PolarHBondContact O-N 3.42Å
22	C	48.6	Very low	50.2	Low	103 Å²	103	125.5 Å²	125.5	70%	0.696	67%	0.666	S	S	*	*	H	α-helix	trans	-87	-21.3	173.5	-68.1	0	0	0	0	113.4	T18 W20	T18-C22 PolarHBondContact O-N 2.8Å; T18-C22 VanDerWaalsContact O-N 3.1Å; W20-C22 PolarHBondContact O-N 2.8Å
23	A	50.4	Low	50.2	Low	69 Å²	69	125.2 Å²	125.2	57%	0.57	67%	0.668	S	S	*	*	H	α-helix	trans	-86.2	-18.9	178	0	0	0	0	0	113.5	R19 W20	R19-A23 WeakPolarHBondContact O-CB 3.36Å; R19-A23 PolarHBondContact O-N 3.49Å; W20-A23 PolarHBondContact O-N 2.88Å
24	S	52.6	Low	50.4	Low	96 Å²	96	124.5 Å²	124.5	67%	0.671	68%	0.675	S	S	*	*	S	Bend	trans	-89.4	-2.9	176.6	65.3	0	0	0	0	114.5	W20	W20-S24 PolarHBondContact O-N 3.2Å; W20-S24 PolarHBondContact O-OG 3.44Å
25	E	49.1	Very low	50.3	Low	171 Å²	171	130 Å²	130	80%	0.799	70%	0.698	S	S	*	*	S	Bend	trans	-115.5	17.8	179.5	-151	150.4	105	0	0	113.6
26	Q	56.1	Low	50.3	Low	169 Å²	169	130.1 Å²	130.1	79%	0.79	71%	0.713	S	S	*	*	S	Bend	trans	-127.4	105.4	159	-75.3	-170.2	4.8	0	0	109.1
27	L	53.1	Low	50.4	Low	169 Å²	169	131.4 Å²	131.4	89%	0.885	72%	0.723	S	S	*	*			trans	128.9	57.3	148.3	-146.6	96	0	0	0	115.1
28	I	50.6	Low	50	Low	163 Å²	163	132.6 Å²	132.6	84%	0.836	72%	0.722	S	S	*	*			trans	-133.3	87.8	149.3	-61.3	-175.3	0	0	0	108.7
29	V	46.3	Very low	50.4	Low	132 Å²	132	136 Å²	136	80%	0.8	74%	0.737	S	S	*	*	S	Bend	trans	152.8	143.3	133.4	-86.2	0	0	0	0	111.9
30	P	47.5	Very low	50.2	Low	124 Å²	124	137.1 Å²	137.1	81%	0.805	74%	0.741	S	S	*	*			cis	-121.2	148.1	-35.1	33	-17.4	0	0	0	112.1
31	S	47.2	Very low	50.5	Low	105 Å²	105	130.5 Å²	130.5	73%	0.734	73%	0.728	S	S	*	*			trans	-72.9	134.8	179.8	52.7	0	0	0	0	113.2	S33	S31-S33 VanDerWaalsContact C-N 3.34Å; S31-S33 PolarHBondContact O-N 2.87Å
32	E	52.4	Low	50.5	Low	198 Å²	198	133.7 Å²	133.7	93%	0.925	73%	0.734	S	S	*	*	S	Bend	trans	-70.8	78.9	169.1	-160.2	-178.2	148.5	0	0	110.3
33	S	54	Low	50.6	Low	80 Å²	80	130.8 Å²	130.8	56%	0.559	72%	0.722	S	S	*	*			trans	-166.5	64.2	173.5	65.6	0	0	0	0	114.2	S31	S31-S33 VanDerWaalsContact C-N 3.34Å; S31-S33 PolarHBondContact O-N 2.87Å
34	N	51.5	Low	50.5	Low	152 Å²	152	131.5 Å²	131.5	81%	0.813	72%	0.722	S	S	*	*			trans	-161.6	54.9	162	-100.9	-16.6	0	0	0	113.7	A36	N34-A36 VanDerWaalsContact C-N 3.33Å
35	M	51.5	Low	50.3	Low	196 Å²	196	130.9 Å²	130.9	97%	0.966	71%	0.714	S	S	*	*	S	Bend	trans	-87.7	14.1	168.4	-67.5	-166.8	-167.5	0	0	113.8
36	A	52.4	Low	50.1	Low	96 Å²	96	126.6 Å²	126.6	79%	0.793	70%	0.697	S	S	*	*	S	Bend	trans	-144.7	9.7	-166.1	0	0	0	0	0	119.1	N34	N34-A36 VanDerWaalsContact C-N 3.33Å
37	D	52.8	Low	49.7	Very low	123 Å²	123	122.6 Å²	122.6	66%	0.658	69%	0.687	S	S	*	*			trans	-144.3	131.3	177	-165.7	27.3	0	0	0	113.5
38	W	41.1	Very low	49.4	Very low	153 Å²	153	121.2 Å²	121.2	58%	0.58	68%	0.678	S	S	*	*			trans	81.7	81.2	-168.3	-61.7	97.3	0	0	0	115.1	R40	W38-R40 HydrophobicContact CB-CB 3.85Å; W38-R40 HydrophobicContact CB-CG 4.32Å; W38-R40 VanDerWaalsContact CB-N 3.34Å; W38-R40 HydrophobicContact CD2-CB 4.28Å; W38-R40 HydrophobicContact CD2-CG 3.82Å; W38-R40 VanDerWaalsContact CE2-NE 3.35Å; W38-R40 VanDerWaalsContact CE2-NH2 3.25Å; W38-R40 HydrophobicContact CE3-CB 3.77Å; W38-R40 HydrophobicContact CE3-CG 3.23Å; W38-R40 VanDerWaalsContact CE3-NE 3.31Å; W38-R40 HydrophobicContact CG-CB 4.39Å; W38-R40 HydrophobicContact CG-CG 4.33Å; W38-R40 HydrophobicContact CZ3-CG 3.63Å; W38-R40 PolarHBondContact O-N 3.37Å
39	N	53.7	Low	49.2	Very low	149 Å²	149	118.9 Å²	118.9	80%	0.797	67%	0.667	S	S	*	*			cis	27.6	14.6	49.7	-145.7	40	0	0	0	116.4	G41	N39-G41 PolarHBondContact O-N 3.38Å
40	R	46.4	Very low	49.2	Very low	172 Å²	172	116.6 Å²	116.6	65%	0.649	65%	0.65	S	S	*	*			trans	-79.4	17.4	149.9	-109.7	156.8	-134.6	-173.2	8.2	109.1	W38	W38-R40 HydrophobicContact CB-CB 3.85Å; W38-R40 HydrophobicContact CB-CG 4.32Å; W38-R40 VanDerWaalsContact CB-N 3.34Å; W38-R40 HydrophobicContact CD2-CB 4.28Å; W38-R40 HydrophobicContact CD2-CG 3.82Å; W38-R40 VanDerWaalsContact CE2-NE 3.35Å; W38-R40 VanDerWaalsContact CE2-NH2 3.25Å; W38-R40 HydrophobicContact CE3-CB 3.77Å; W38-R40 HydrophobicContact CE3-CG 3.23Å; W38-R40 VanDerWaalsContact CE3-NE 3.31Å; W38-R40 HydrophobicContact CG-CB 4.39Å; W38-R40 HydrophobicContact CG-CG 4.33Å; W38-R40 HydrophobicContact CZ3-CG 3.63Å; W38-R40 PolarHBondContact O-N 3.37Å
41	G	53.5	Low	49.4	Very low	39 Å²	39	114 Å²	114	40%	0.402	64%	0.639	S	S	.	*	T	Hydrogen-bonded Turn	trans	-41	143.5	141.4	0	0	0	0	0	109.6	N39	N39-G41 PolarHBondContact O-N 3.38Å
42	H	49.3	Very low	49.2	Very low	149 Å²	149	115.3 Å²	115.3	69%	0.69	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	89	5.8	175.9	-62	-57.6	0	0	0	120.2	D46	H42-D46 IonicContact CE1-OD2 3.61Å; H42-D46 IonicContact CG-OD2 3.81Å; H42-D46 IonicContact ND1-OD2 2.79Å; H42-D46 PolarHBondContact ND1-OD2 2.86Å
43	G	50.2	Low	48.9	Very low	42 Å²	42	111.1 Å²	111.1	43%	0.433	62%	0.618	S	S	.	*	S	Bend	trans	-105.1	-65.5	171.3	0	0	0	0	0	114.3	S47	G43-S47 WeakPolarHBondContact O-CB 3.36Å; G43-S47 PolarHBondContact O-N 2.89Å; G43-S47 PolarHBondContact O-OG 2.83Å
44	S	48.7	Very low	48.6	Very low	84 Å²	84	113.7 Å²	113.7	59%	0.587	62%	0.619	S	S	*	*	H	α-helix	trans	-87.1	-28.4	-172	154.2	0	0	0	0	113.4	M48	S44-M48 WeakPolarHBondContact O-CB 3.32Å; S44-M48 WeakPolarHBondContact O-CG 3.13Å; S44-M48 PolarHBondContact O-N 2.83Å
45	V	48.7	Very low	48.2	Very low	82 Å²	82	116.2 Å²	116.2	50%	0.497	62%	0.617	S	S	.	*	H	α-helix	trans	-78	-36.2	174.7	-93.1	0	0	0	0	111.7	L49	V45-L49 HydrophobicContact CB-CD1 4.37Å; V45-L49 WeakPolarHBondContact O-CB 3.29Å; V45-L49 WeakPolarHBondContact O-CD1 3.25Å; V45-L49 WeakPolarHBondContact O-CG 3.42Å; V45-L49 PolarHBondContact O-N 3.4Å
46	D	45.6	Very low	48	Very low	82 Å²	82	111.8 Å²	111.8	44%	0.439	60%	0.596	S	S	.	*	H	α-helix	trans	-65.7	-39.6	171.5	-100.3	-78.2	0	0	0	111.9	H42 D50	H42-D46 IonicContact CE1-OD2 3.61Å; H42-D46 IonicContact CG-OD2 3.81Å; H42-D46 IonicContact ND1-OD2 2.79Å; H42-D46 PolarHBondContact ND1-OD2 2.86Å; D46-D50 VanDerWaalsContact O-CB 3.23Å; D46-D50 WeakPolarHBondContact O-CB 3.38Å; D46-D50 PolarHBondContact O-N 3.46Å
47	S	47.8	Very low	47.6	Very low	84 Å²	84	109.8 Å²	109.8	59%	0.587	58%	0.58	S	S	*	*	H	α-helix	trans	-75.1	-28.6	-177.7	-56.2	0	0	0	0	114.1	G43 A51	G43-S47 WeakPolarHBondContact O-CB 3.36Å; G43-S47 PolarHBondContact O-N 2.89Å; G43-S47 PolarHBondContact O-OG 2.83Å; S47-A51 WeakPolarHBondContact O-CB 3.11Å
48	M	45.2	Very low	47.3	Very low	140 Å²	140	109.9 Å²	109.9	69%	0.69	58%	0.581	S	S	*	*	H	α-helix	trans	-91	-21.8	176.8	-66.6	-176.4	110.3	0	0	112.5	S44	S44-M48 WeakPolarHBondContact O-CB 3.32Å; S44-M48 WeakPolarHBondContact O-CG 3.13Å; S44-M48 PolarHBondContact O-N 2.83Å
49	L	47.7	Very low	47.5	Very low	115 Å²	115	106.3 Å²	106.3	60%	0.602	57%	0.573	S	S	*	*	H	α-helix	trans	-90.1	-33.3	174.7	-62.2	170.6	0	0	0	112.6	V45 N53	V45-L49 HydrophobicContact CB-CD1 4.37Å; V45-L49 WeakPolarHBondContact O-CB 3.29Å; V45-L49 WeakPolarHBondContact O-CD1 3.25Å; V45-L49 WeakPolarHBondContact O-CG 3.42Å; V45-L49 PolarHBondContact O-N 3.4Å; L49-N53 WeakPolarHBondContact O-CB 3.33Å; L49-N53 PolarHBondContact O-N 2.84Å
50	D	46.4	Very low	47.2	Very low	84 Å²	84	104.8 Å²	104.8	45%	0.449	56%	0.564	S	S	.	*	H	α-helix	trans	-75.6	-29.2	177	-163.9	56.2	0	0	0	112.9	D46 K54	D46-D50 VanDerWaalsContact O-CB 3.23Å; D46-D50 WeakPolarHBondContact O-CB 3.38Å; D46-D50 PolarHBondContact O-N 3.46Å; D50-K54 PolarHBondContact O-N 2.79Å; D50-K54 IonicContact OD1-NZ 3.45Å; D50-K54 PolarHBondContact OD1-NZ 3.39Å; D50-K54 IonicContact OD2-NZ 2.92Å; D50-K54 PolarHBondContact OD2-NZ 3.44Å
51	A	50.5	Low	47.1	Very low	70 Å²	70	100 Å²	100	58%	0.579	56%	0.561	S	S	*	*	H	α-helix	trans	-74.4	-31.1	176.9	0	0	0	0	0	113.3	S47	S47-A51 WeakPolarHBondContact O-CB 3.11Å
52	E	43.5	Very low	46.4	Very low	132 Å²	132	101 Å²	101	62%	0.617	56%	0.562	S	S	*	*	H	α-helix	trans	-86	-33.1	172.7	-83	-140.3	148.1	0	0	112.9	R55 L56	E52-R55 PolarHBondContact O-N 3.22Å; E52-L56 HydrophobicContact CB-CD1 4.36Å; E52-L56 WeakPolarHBondContact O-CB 3.03Å; E52-L56 WeakPolarHBondContact O-CG 3.45Å; E52-L56 PolarHBondContact O-N 3.28Å
53	N	46.9	Very low	46.1	Very low	110 Å²	110	99.8 Å²	99.8	59%	0.588	56%	0.555	S	S	*	*	H	α-helix	trans	-70	-34.7	-179.2	-151.3	-2	0	0	0	111.9	L49 R55 A57	L49-N53 WeakPolarHBondContact O-CB 3.33Å; L49-N53 PolarHBondContact O-N 2.84Å; N53-R55 VanDerWaalsContact C-N 3.3Å; N53-R55 PolarHBondContact O-N 2.83Å; N53-A57 WeakPolarHBondContact O-CB 3.4Å; N53-A57 PolarHBondContact O-N 2.91Å
54	K	47	Very low	45.9	Very low	134 Å²	134	102 Å²	102	58%	0.583	56%	0.56	S	S	*	*	H	α-helix	trans	-65.5	-27.2	171.7	-93.3	-176.8	-175.6	70.4	0	114.2	D50	D50-K54 PolarHBondContact O-N 2.79Å; D50-K54 IonicContact OD1-NZ 3.45Å; D50-K54 PolarHBondContact OD1-NZ 3.39Å; D50-K54 IonicContact OD2-NZ 2.92Å; D50-K54 PolarHBondContact OD2-NZ 3.44Å
55	R	42.5	Very low	45.5	Very low	205 Å²	205	101.9 Å²	101.9	77%	0.774	56%	0.559	S	S	*	*	H	α-helix	trans	-93.3	-25.2	-178.7	-136	-172.6	84.9	102.4	0.2	113.5	E52 N53	E52-R55 PolarHBondContact O-N 3.22Å; N53-R55 VanDerWaalsContact C-N 3.3Å; N53-R55 PolarHBondContact O-N 2.83Å
56	L	48.2	Very low	45.1	Very low	102 Å²	102	108.1 Å²	108.1	53%	0.534	57%	0.573	S	S	.	*	H	α-helix	trans	-82.5	-29.9	174.7	-69.4	166.6	0	0	0	111.8	E52 L60	E52-L56 HydrophobicContact CB-CD1 4.36Å; E52-L56 WeakPolarHBondContact O-CB 3.03Å; E52-L56 WeakPolarHBondContact O-CG 3.45Å; E52-L56 PolarHBondContact O-N 3.28Å; L56-L60 WeakPolarHBondContact O-CD1 3.3Å
57	A	44.5	Very low	45.1	Very low	54 Å²	54	110.3 Å²	110.3	45%	0.446	58%	0.584	S	S	.	*	H	α-helix	trans	-68.5	-41.9	176.5	0	0	0	0	0	113.6	N53 N59	N53-A57 WeakPolarHBondContact O-CB 3.4Å; N53-A57 PolarHBondContact O-N 2.91Å; A57-N59 PolarHBondContact O-N 3.46Å
58	D	46.8	Very low	45	Very low	126 Å²	126	114 Å²	114	67%	0.674	59%	0.59	S	S	*	*	H	α-helix	trans	-77	-21.5	-176.2	-83.3	-13.6	0	0	0	114.4	S62	D58-S62 PolarHBondContact O-OG 3.03Å; D58-S62 VanDerWaalsContact O-OG 3.09Å
59	N	43.4	Very low	44.7	Very low	78 Å²	78	111.4 Å²	111.4	42%	0.417	59%	0.585	S	S	.	*	H	α-helix	trans	-89.1	-12.3	178	-129.8	-99.5	0	0	0	113.6	A57 K63	A57-N59 PolarHBondContact O-N 3.46Å; N59-K63 WeakPolarHBondContact O-CB 3.13Å; N59-K63 WeakPolarHBondContact O-CG 3.31Å; N59-K63 VanDerWaalsContact OD1-CE 3.27Å; N59-K63 WeakPolarHBondContact OD1-CE 3.48Å; N59-K63 PolarHBondContact OD1-NZ 3.48Å
60	L	47.8	Very low	44.5	Very low	117 Å²	117	112.9 Å²	112.9	61%	0.613	59%	0.593	S	S	*	*	H	α-helix	trans	-84.4	-40.6	172.8	-97.9	68.7	0	0	0	111.5	L56 S62 K63 V64	L56-L60 WeakPolarHBondContact O-CD1 3.3Å; L60-S62 PolarHBondContact O-N 3.45Å; L60-K63 PolarHBondContact O-N 3.02Å; L60-V64 VanDerWaalsContact O-CB 3.31Å; L60-V64 WeakPolarHBondContact O-CB 3.45Å; L60-V64 WeakPolarHBondContact O-CG2 3.23Å; L60-V64 PolarHBondContact O-N 3.24Å
61	A	44.5	Very low	44.7	Very low	70 Å²	70	112.5 Å²	112.5	58%	0.579	60%	0.601	S	S	*	*	H	α-helix	trans	-63.8	-40.6	179	0	0	0	0	0	113	S65	A61-S65 PolarHBondContact O-N 2.95Å
62	S	38.8	Very low	44.7	Very low	60 Å²	60	118.5 Å²	118.5	42%	0.42	61%	0.611	S	S	.	*	H	α-helix	trans	-76.7	-23.2	-179.8	55.8	0	0	0	0	114.2	D58 L60	D58-S62 PolarHBondContact O-OG 3.03Å; D58-S62 VanDerWaalsContact O-OG 3.09Å; L60-S62 PolarHBondContact O-N 3.45Å
63	K	44.4	Very low	44.9	Very low	124 Å²	124	118 Å²	118	54%	0.539	61%	0.612	S	S	.	*	H	α-helix	trans	-90.4	-26.1	174.1	-75.7	175.4	174.4	161.1	0	113.2	N59 L60 L67	N59-K63 WeakPolarHBondContact O-CB 3.13Å; N59-K63 WeakPolarHBondContact O-CG 3.31Å; N59-K63 VanDerWaalsContact OD1-CE 3.27Å; N59-K63 WeakPolarHBondContact OD1-CE 3.48Å; N59-K63 PolarHBondContact OD1-NZ 3.48Å; L60-K63 PolarHBondContact O-N 3.02Å; K63-L67 PolarHBondContact O-N 2.87Å
64	V	45.2	Very low	45.1	Very low	90 Å²	90	119.1 Å²	119.1	55%	0.545	62%	0.617	S	S	.	*	H	α-helix	trans	-71.8	-30.9	170.7	172.8	0	0	0	0	111.3	L60 R66 K68	L60-V64 VanDerWaalsContact O-CB 3.31Å; L60-V64 WeakPolarHBondContact O-CB 3.45Å; L60-V64 WeakPolarHBondContact O-CG2 3.23Å; L60-V64 PolarHBondContact O-N 3.24Å; V64-R66 PolarHBondContact O-N 3.27Å; V64-K68 WeakPolarHBondContact O-CB 3.49Å; V64-K68 PolarHBondContact O-N 3.45Å
65	S	40.4	Very low	45.5	Very low	80 Å²	80	120.5 Å²	120.5	56%	0.559	63%	0.631	S	S	*	*	H	α-helix	trans	-70.9	-28.3	175.3	-165.8	0	0	0	0	114.1	A61 S69	A61-S65 PolarHBondContact O-N 2.95Å; S65-S69 PolarHBondContact O-N 3.24Å
66	R	39.8	Very low	46.1	Very low	214 Å²	214	120.4 Å²	120.4	81%	0.808	63%	0.63	S	S	*	*	H	α-helix	trans	-83.2	-35.7	177.2	-68.5	-175.8	-178.9	-113.3	1	112.3	V64 S69 L70	V64-R66 PolarHBondContact O-N 3.27Å; R66-S69 PolarHBondContact O-N 2.85Å; R66-L70 PolarHBondContact O-N 2.67Å
67	L	46.5	Very low	46.2	Very low	127 Å²	127	122 Å²	122	67%	0.665	64%	0.639	S	S	*	*	H	α-helix	trans	-72.7	-28.5	171.3	-79.9	156.7	0	0	0	112.8	K63 S69 L70 A71	K63-L67 PolarHBondContact O-N 2.87Å; L67-S69 VanDerWaalsContact C-N 3.32Å; L67-L70 PolarHBondContact O-N 3.49Å; L67-A71 PolarHBondContact O-N 3.17Å
68	K	44.5	Very low	46.7	Very low	162 Å²	162	125.6 Å²	125.6	70%	0.704	66%	0.656	S	S	*	*	H	α-helix	trans	-70	-26.8	172	-170.4	173.8	-175.8	-177.5	0	112.8	V64	V64-K68 WeakPolarHBondContact O-CB 3.49Å; V64-K68 PolarHBondContact O-N 3.45Å
69	S	38.6	Very low	47	Very low	86 Å²	86	128.1 Å²	128.1	60%	0.601	66%	0.663	S	S	*	*	H	α-helix	trans	-82.8	-19.2	175.5	-164.4	0	0	0	0	113.6	S65 R66 L67	S65-S69 PolarHBondContact O-N 3.24Å; R66-S69 PolarHBondContact O-N 2.85Å; L67-S69 VanDerWaalsContact C-N 3.32Å
70	L	44.3	Very low	47.5	Very low	145 Å²	145	131.3 Å²	131.3	76%	0.759	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90	-3.5	174.2	-149.7	80.6	0	0	0	112.9	R66 L67	R66-L70 PolarHBondContact O-N 2.67Å; L67-L70 PolarHBondContact O-N 3.49Å
71	A	49.8	Very low	47.3	Very low	76 Å²	76	132.4 Å²	132.4	63%	0.628	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93	-0.6	173.1	0	0	0	0	0	113	L67	L67-A71 PolarHBondContact O-N 3.17Å
72	Y	52.3	Low	47.7	Very low	196 Å²	196	136.6 Å²	136.6	77%	0.769	70%	0.695	S	S	*	*	S	Bend	trans	-124.1	-3.5	-169.5	-163.7	-98.3	0	0	0	116.5
73	D	46.4	Very low	48.4	Very low	122 Å²	122	139.5 Å²	139.5	65%	0.652	71%	0.706	S	S	*	*	S	Bend	trans	-137.9	120.4	170.1	-94	-32.8	0	0	0	106.1
74	I	52.5	Low	48.6	Very low	133 Å²	133	140.2 Å²	140.2	68%	0.682	71%	0.706	S	S	*	*			cis	-153.2	122.5	21.6	-83.3	129.8	0	0	0	105	R76	I74-R76 HydrophobicContact CG2-CB 3.97Å; I74-R76 PolarHBondContact O-N 2.93Å
75	D	55.2	Low	48.9	Very low	164 Å²	164	142.8 Å²	142.8	88%	0.877	72%	0.716	S	S	*	*			trans	-65.9	103.9	152.3	-167.8	26.9	0	0	0	105.4
76	R	54.4	Low	49.7	Very low	202 Å²	202	145.2 Å²	145.2	76%	0.762	72%	0.723	S	S	*	*			trans	-177.1	132.4	150.5	-108	-177.1	-163.6	171.2	4.2	114.2	I74	I74-R76 HydrophobicContact CG2-CB 3.97Å; I74-R76 PolarHBondContact O-N 2.93Å
77	D	49.6	Very low	50.5	Low	136 Å²	136	140 Å²	140	73%	0.727	71%	0.711	S	S	*	*			trans	88.2	88.5	150	-55.8	-21.3	0	0	0	116.4
78	V	56.4	Low	51.1	Low	130 Å²	130	139.6 Å²	139.6	79%	0.788	71%	0.707	S	S	*	*				-14.8	147.6	127.9	-169.1	0	0	0	0	113.9
79	E	52.9	Low	52	Low	179 Å²	179	136.6 Å²	136.6	84%	0.836	70%	0.699	S	S	*	*			trans	94.5	104.3	159.2	-114.2	167.6	156.1	0	0	115.6
80	D	52.7	Low	53.4	Low	145 Å²	145	135.3 Å²	135.3	78%	0.775	69%	0.69	S	S	*	*				114.1	61	129.7	-139.5	21.8	0	0	0	116.9
81	Q	44	Very low	54.7	Low	139 Å²	139	133 Å²	133	65%	0.65	68%	0.678	S	S	*	*			trans	-133.9	73	158.8	-65.6	-174.1	27.8	0	0	110.5	D83 Y84	Q81-D83 PolarHBondContact O-N 3.48Å; Q81-Y84 HydrophobicContact CB-CD2 3.74Å; Q81-Y84 HydrophobicContact CB-CE2 4.02Å
82	N	54	Low	55.8	Low	158 Å²	158	136 Å²	136	85%	0.845	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.3	36.5	163	-172.4	39.4	0	0	0	112.6
83	D	53.4	Low	56.9	Low	122 Å²	122	132.7 Å²	132.7	65%	0.652	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-133.2	6.3	-177.5	-141.3	18.6	0	0	0	111.8	Q81	Q81-D83 PolarHBondContact O-N 3.48Å
84	Y	46.9	Very low	58.4	Low	138 Å²	138	130.7 Å²	130.7	54%	0.541	67%	0.666	S	S	.	*	T	Hydrogen-bonded Turn	trans	-80.7	-11.1	-179	-102.7	-79.7	0	0	0	114.7	Q81	Q81-Y84 HydrophobicContact CB-CD2 3.74Å; Q81-Y84 HydrophobicContact CB-CE2 4.02Å
85	L	52.8	Low	59.5	Low	145 Å²	145	126.9 Å²	126.9	76%	0.759	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.2	-33.1	-178.9	-64.8	176.4	0	0	0	112.8
86	D	57.6	Low	60.6	Low	130 Å²	130	122 Å²	122	70%	0.695	63%	0.63	S	S	*	*	H	α-helix	trans	-81	-33.4	-173.8	-156.9	49.4	0	0	0	112.3
87	N	55.8	Low	62	Low	104 Å²	104	115 Å²	115	56%	0.556	62%	0.621	S	S	*	*	H	α-helix	trans	-78.1	-17.2	177.3	-158.9	8.4	0	0	0	113.4	S90 N91	N87-S90 PolarHBondContact O-OG 3.09Å; N87-N91 PolarHBondContact O-ND2 2.84Å; N87-N91 PolarHBondContact OD1-ND2 3.18Å
88	M	58.2	Low	63.5	Low	120 Å²	120	115 Å²	115	59%	0.591	62%	0.62	S	S	*	*	H	α-helix	trans	-72.2	-40.6	174.4	-85.4	-165.6	-162	0	0	112.3	F92	M88-F92 WeakPolarHBondContact O-CB 3.19Å; M88-F92 PolarHBondContact O-N 3.44Å
89	D	64.6	Low	64.3	Low	99 Å²	99	113.8 Å²	113.8	53%	0.529	61%	0.609	S	S	.	*	H	α-helix	trans	-64.9	-45.4	-175.5	-172.6	69	0	0	0	112.1	F92 M93	D89-F92 PolarHBondContact O-N 3.4Å; D89-M93 WeakPolarHBondContact O-CG 3.3Å; D89-M93 PolarHBondContact O-N 3.38Å
90	S	67.6	Low	65.5	Low	59 Å²	59	109 Å²	109	41%	0.413	60%	0.595	S	S	.	*	H	α-helix	trans	-67.6	-40.9	179.9	62.9	0	0	0	0	113.5	N87 F92 S94	N87-S90 PolarHBondContact O-OG 3.09Å; S90-F92 VanDerWaalsContact C-N 3.35Å; S90-S94 WeakPolarHBondContact O-CB 3.47Å; S90-S94 PolarHBondContact O-N 2.89Å; S90-S94 VanDerWaalsContact O-N 3.17Å; S90-S94 PolarHBondContact O-OG 3.5Å
91	N	72.3	Confident	66.8	Low	96 Å²	96	103.9 Å²	103.9	51%	0.513	58%	0.577	S	S	.	*	H	α-helix	trans	-69.1	-34.5	172.6	-77	-71.6	0	0	0	111.5	N87 A95	N87-N91 PolarHBondContact O-ND2 2.84Å; N87-N91 PolarHBondContact OD1-ND2 3.18Å; N91-A95 WeakPolarHBondContact O-CB 3.31Å; N91-A95 PolarHBondContact O-N 3.48Å
92	F	72.1	Confident	68.3	Low	138 Å²	138	100.8 Å²	100.8	61%	0.605	57%	0.57	S	S	*	*	H	α-helix	trans	-68.8	-43.3	176.8	-176.6	-99.6	0	0	0	111.9	M88 D89 S90 S94 A95 T96	M88-F92 WeakPolarHBondContact O-CB 3.19Å; M88-F92 PolarHBondContact O-N 3.44Å; D89-F92 PolarHBondContact O-N 3.4Å; S90-F92 VanDerWaalsContact C-N 3.35Å; F92-S94 PolarHBondContact O-N 3.35Å; F92-A95 PolarHBondContact O-N 2.77Å; F92-T96 WeakPolarHBondContact O-CB 3.16Å; F92-T96 PolarHBondContact O-N 3.11Å; F92-T96 PolarHBondContact O-OG1 3.04Å
93	M	76.4	Confident	69.3	Low	128 Å²	128	97 Å²	97	63%	0.631	55%	0.553	S	S	*	*	H	α-helix	trans	-61.2	-44.2	174.3	-76	-172.5	68.5	0	0	111.6	D89 T96 G97	D89-M93 WeakPolarHBondContact O-CG 3.3Å; D89-M93 PolarHBondContact O-N 3.38Å; M93-T96 PolarHBondContact O-N 3.37Å; M93-G97 PolarHBondContact O-N 2.99Å; M93-G97 VanDerWaalsContact O-N 3.11Å
94	S	77.3	Confident	70.4	Confident	80 Å²	80	98.7 Å²	98.7	56%	0.559	55%	0.554	S	S	*	*	H	α-helix	trans	-65.6	-44.7	178.4	-59.3	0	0	0	0	112	S90 F92 G97 L98	S90-S94 WeakPolarHBondContact O-CB 3.47Å; S90-S94 PolarHBondContact O-N 2.89Å; S90-S94 VanDerWaalsContact O-N 3.17Å; S90-S94 PolarHBondContact O-OG 3.5Å; F92-S94 PolarHBondContact O-N 3.35Å; S94-G97 PolarHBondContact O-N 2.77Å; S94-L98 PolarHBondContact O-N 3.36Å
95	A	74.8	Confident	71.7	Confident	52 Å²	52	101.9 Å²	101.9	43%	0.43	57%	0.565	S	S	.	*	H	α-helix	trans	-66.8	-35.7	175.2	0	0	0	0	0	112	N91 F92 G97 L98 L99	N91-A95 WeakPolarHBondContact O-CB 3.31Å; N91-A95 PolarHBondContact O-N 3.48Å; F92-A95 PolarHBondContact O-N 2.77Å; A95-G97 PolarHBondContact O-N 3.45Å; A95-L98 PolarHBondContact O-N 3.39Å; A95-L99 WeakPolarHBondContact O-CB 3.44Å; A95-L99 PolarHBondContact O-N 3.46Å
96	T	79.5	Confident	72.7	Confident	62 Å²	62	98.8 Å²	98.8	38%	0.38	55%	0.546	S	S	.	.	H	α-helix	trans	-63.4	-40.6	177.4	-67	0	0	0	0	111.6	F92 M93 L99 S100	F92-T96 WeakPolarHBondContact O-CB 3.16Å; F92-T96 PolarHBondContact O-N 3.11Å; F92-T96 PolarHBondContact O-OG1 3.04Å; M93-T96 PolarHBondContact O-N 3.37Å; T96-L99 PolarHBondContact O-N 2.98Å; T96-S100 VanDerWaalsContact O-CB 3.26Å; T96-S100 WeakPolarHBondContact O-CB 3.13Å; T96-S100 PolarHBondContact O-N 2.96Å
97	G	82.7	Confident	73.2	Confident	54 Å²	54	94.6 Å²	94.6	56%	0.557	53%	0.527	S	S	*	.	H	α-helix	trans	-62.8	-43.7	175.6	0	0	0	0	0	113.2	M93 S94 A95	M93-G97 PolarHBondContact O-N 2.99Å; M93-G97 VanDerWaalsContact O-N 3.11Å; S94-G97 PolarHBondContact O-N 2.77Å; A95-G97 PolarHBondContact O-N 3.45Å
98	L	82.6	Confident	73.9	Confident	138 Å²	138	93.7 Å²	93.7	72%	0.723	53%	0.525	S	S	*	.	H	α-helix	trans	-71	-41.7	177	-63.7	176.1	0	0	0	112	S94 A95 S100 G101 S102	S94-L98 PolarHBondContact O-N 3.36Å; A95-L98 PolarHBondContact O-N 3.39Å; L98-S100 VanDerWaalsContact C-N 3.33Å; L98-S100 PolarHBondContact O-N 3.31Å; L98-G101 PolarHBondContact O-N 2.85Å; L98-S102 PolarHBondContact O-N 3.47Å
99	L	72.1	Confident	74.2	Confident	103 Å²	103	92.8 Å²	92.8	54%	0.539	52%	0.521	S	S	.	.	H	α-helix	trans	-67.9	-33.9	179.3	-173.1	62	0	0	0	111.2	A95 T96 G101 S102 V103	A95-L99 WeakPolarHBondContact O-CB 3.44Å; A95-L99 PolarHBondContact O-N 3.46Å; T96-L99 PolarHBondContact O-N 2.98Å; L99-G101 VanDerWaalsContact C-N 3.25Å; L99-G101 PolarHBondContact O-N 3.4Å; L99-S102 CarbonylContact O-C 3.6Å; L99-S102 PolarHBondContact O-N 2.89Å; L99-V103 HydrophobicContact CD1-CG2 4.13Å; L99-V103 HydrophobicContact CG-CG2 3.9Å; L99-V103 WeakPolarHBondContact O-CB 3.45Å; L99-V103 VanDerWaalsContact O-CG2 3.26Å; L99-V103 WeakPolarHBondContact O-CG2 3.42Å; L99-V103 PolarHBondContact O-N 3.39Å
100	S	78.1	Confident	74.3	Confident	78 Å²	78	90.9 Å²	90.9	55%	0.545	51%	0.512	S	S	.	.	H	α-helix	trans	-56.7	-39.1	173.4	-177.4	0	0	0	0	112	T96 L98 K104	T96-S100 VanDerWaalsContact O-CB 3.26Å; T96-S100 WeakPolarHBondContact O-CB 3.13Å; T96-S100 PolarHBondContact O-N 2.96Å; L98-S100 VanDerWaalsContact C-N 3.33Å; L98-S100 PolarHBondContact O-N 3.31Å; S100-K104 VanDerWaalsContact O-CB 3.29Å; S100-K104 WeakPolarHBondContact O-CB 3.5Å; S100-K104 PolarHBondContact O-N 2.89Å
101	G	80.6	Confident	74.1	Confident	39 Å²	39	98 Å²	98	40%	0.402	53%	0.53	S	S	.	.	H	α-helix	trans	-65	-43.3	172.3	0	0	0	0	0	113.3	L98 L99 K104 R105	L98-G101 PolarHBondContact O-N 2.85Å; L99-G101 VanDerWaalsContact C-N 3.25Å; L99-G101 PolarHBondContact O-N 3.4Å; G101-K104 PolarHBondContact O-N 2.71Å; G101-R105 PolarHBondContact O-N 3.48Å; G101-R105 VanDerWaalsContact O-N 3.13Å
102	S	74.9	Confident	73.6	Confident	73 Å²	73	97.2 Å²	97.2	51%	0.51	53%	0.532	S	S	.	.	H	α-helix	trans	-68.3	-40.6	177.5	-65.2	0	0	0	0	112.7	L98 L99 K104 R105 F106	L98-S102 PolarHBondContact O-N 3.47Å; L99-S102 CarbonylContact O-C 3.6Å; L99-S102 PolarHBondContact O-N 2.89Å; S102-K104 VanDerWaalsContact C-N 3.35Å; S102-R105 PolarHBondContact O-N 2.84Å; S102-F106 VanDerWaalsContact O-CB 3.27Å; S102-F106 WeakPolarHBondContact O-CB 3.32Å; S102-F106 PolarHBondContact O-N 3.3Å
103	V	76.1	Confident	73.2	Confident	78 Å²	78	93.7 Å²	93.7	47%	0.473	54%	0.535	S	S	.	.	H	α-helix	trans	-66.1	-37.8	175.3	170	0	0	0	0	110.4	L99 F106 S107	L99-V103 HydrophobicContact CD1-CG2 4.13Å; L99-V103 HydrophobicContact CG-CG2 3.9Å; L99-V103 WeakPolarHBondContact O-CB 3.45Å; L99-V103 VanDerWaalsContact O-CG2 3.26Å; L99-V103 WeakPolarHBondContact O-CG2 3.42Å; L99-V103 PolarHBondContact O-N 3.39Å; V103-F106 PolarHBondContact O-N 3.49Å; V103-S107 WeakPolarHBondContact O-CB 3.07Å; V103-S107 PolarHBondContact O-N 3.45Å
104	K	76.4	Confident	72.2	Confident	158 Å²	158	96.6 Å²	96.6	69%	0.687	54%	0.544	S	S	*	.	H	α-helix	trans	-63.2	-44.1	174.2	-170.1	172.3	-175.4	176.4	0	111.5	S100 G101 S102 T108	S100-K104 VanDerWaalsContact O-CB 3.29Å; S100-K104 WeakPolarHBondContact O-CB 3.5Å; S100-K104 PolarHBondContact O-N 2.89Å; G101-K104 PolarHBondContact O-N 2.71Å; S102-K104 VanDerWaalsContact C-N 3.35Å; K104-T108 PolarHBondContact O-N 3.06Å; K104-T108 PolarHBondContact O-OG1 3.3Å
105	R	74.4	Confident	71.2	Confident	205 Å²	205	99.9 Å²	99.9	77%	0.774	56%	0.556	S	S	*	*	H	α-helix	trans	-67.6	-40.3	174.4	-72.5	-175.8	176	177.5	0.2	112.5	G101 S102 T108 M109	G101-R105 PolarHBondContact O-N 3.48Å; G101-R105 VanDerWaalsContact O-N 3.13Å; S102-R105 PolarHBondContact O-N 2.84Å; R105-T108 PolarHBondContact O-N 3.22Å; R105-M109 WeakPolarHBondContact O-CB 3.34Å; R105-M109 PolarHBondContact O-N 3.23Å
106	F	72.6	Confident	70.3	Confident	81 Å²	81	99.5 Å²	99.5	36%	0.355	55%	0.546	S	S	.	.	H	α-helix	trans	-63.2	-44.8	176.1	-177.2	-106.1	0	0	0	111.2	S102 V103 T108 M109 V110 L120 V123	S102-F106 VanDerWaalsContact O-CB 3.27Å; S102-F106 WeakPolarHBondContact O-CB 3.32Å; S102-F106 PolarHBondContact O-N 3.3Å; V103-F106 PolarHBondContact O-N 3.49Å; F106-T108 VanDerWaalsContact C-N 3.34Å; F106-T108 PolarHBondContact O-N 3.25Å; F106-M109 CarbonylContact O-C 3.56Å; F106-M109 WeakPolarHBondContact O-CB 3.42Å; F106-M109 PolarHBondContact O-N 2.92Å; F106-M109 VanDerWaalsContact O-N 3.09Å; F106-V110 HydrophobicContact CD1-CG2 3.78Å; F106-V110 HydrophobicContact CD2-CG2 4.33Å; F106-V110 HydrophobicContact CE1-CG2 3.52Å; F106-V110 HydrophobicContact CE2-CG2 4.08Å; F106-V110 HydrophobicContact CG-CG2 4.19Å; F106-V110 HydrophobicContact CZ-CG2 3.68Å; F106-V110 WeakPolarHBondContact O-CB 3.27Å; F106-V110 WeakPolarHBondContact O-CG2 3.29Å; F106-V110 PolarHBondContact O-N 3.11Å; F106-L120 HydrophobicContact CE2-CD2 4.05Å; F106-L120 HydrophobicContact CZ-CD2 3.99Å; F106-V123 HydrophobicContact CD2-CG1 4.47Å; F106-V123 HydrophobicContact CE2-CB 4.02Å; F106-V123 HydrophobicContact CE2-CG1 3.52Å; F106-V123 HydrophobicContact CE2-CG2 4.2Å; F106-V123 HydrophobicContact CZ-CB 4.22Å; F106-V123 HydrophobicContact CZ-CG1 3.62Å
107	S	68.9	Low	69.6	Low	42 Å²	42	106.3 Å²	106.3	29%	0.294	57%	0.565	S	S	.	*	H	α-helix	trans	-60.4	-41.6	174.4	-177.2	0	0	0	0	111.8	V103 V110 R111	V103-S107 WeakPolarHBondContact O-CB 3.07Å; V103-S107 PolarHBondContact O-N 3.45Å; S107-V110 PolarHBondContact O-N 3.44Å; S107-R111 WeakPolarHBondContact O-CB 3.26Å; S107-R111 WeakPolarHBondContact O-CG 3.22Å; S107-R111 PolarHBondContact O-N 3Å
108	T	68.9	Low	68.8	Low	85 Å²	85	113.5 Å²	113.5	52%	0.521	58%	0.575	S	S	.	*	H	α-helix	trans	-63.8	-39.9	172.5	-57.8	0	0	0	0	112	K104 R105 F106 R111 S112	K104-T108 PolarHBondContact O-N 3.06Å; K104-T108 PolarHBondContact O-OG1 3.3Å; R105-T108 PolarHBondContact O-N 3.22Å; F106-T108 VanDerWaalsContact C-N 3.34Å; F106-T108 PolarHBondContact O-N 3.25Å; T108-R111 PolarHBondContact O-N 3.25Å; T108-S112 PolarHBondContact O-N 3.28Å; T108-S112 PolarHBondContact O-OG 2.85Å
109	M	65.2	Low	68.5	Low	101 Å²	101	111.7 Å²	111.7	50%	0.498	57%	0.566	S	S	.	*	H	α-helix	trans	-70.3	-36.5	178	-171.9	-178.4	-70.9	0	0	112.9	R105 F106	R105-M109 WeakPolarHBondContact O-CB 3.34Å; R105-M109 PolarHBondContact O-N 3.23Å; F106-M109 CarbonylContact O-C 3.56Å; F106-M109 WeakPolarHBondContact O-CB 3.42Å; F106-M109 PolarHBondContact O-N 2.92Å; F106-M109 VanDerWaalsContact O-N 3.09Å
110	V	66.8	Low	68.6	Low	58 Å²	58	108.9 Å²	108.9	35%	0.352	55%	0.551	S	S	.	*	H	α-helix	trans	-65.9	-39.2	173.9	174.8	0	0	0	0	110.7	F106 S107 L120	F106-V110 HydrophobicContact CD1-CG2 3.78Å; F106-V110 HydrophobicContact CD2-CG2 4.33Å; F106-V110 HydrophobicContact CE1-CG2 3.52Å; F106-V110 HydrophobicContact CE2-CG2 4.08Å; F106-V110 HydrophobicContact CG-CG2 4.19Å; F106-V110 HydrophobicContact CZ-CG2 3.68Å; F106-V110 WeakPolarHBondContact O-CB 3.27Å; F106-V110 WeakPolarHBondContact O-CG2 3.29Å; F106-V110 PolarHBondContact O-N 3.11Å; S107-V110 PolarHBondContact O-N 3.44Å; V110-L120 HydrophobicContact CB-CD1 4.42Å; V110-L120 HydrophobicContact CB-CD2 4.04Å; V110-L120 HydrophobicContact CG1-CD1 4.1Å; V110-L120 HydrophobicContact CG1-CD2 4.35Å; V110-L120 HydrophobicContact CG2-CD2 3.32Å
111	R	63.9	Low	68.6	Low	208 Å²	208	109.1 Å²	109.1	79%	0.785	55%	0.552	S	S	*	*	H	α-helix	trans	-77.7	-29.4	-179	-73	175.3	179.4	-172.5	0	113.5	S107 T108 G113	S107-R111 WeakPolarHBondContact O-CB 3.26Å; S107-R111 WeakPolarHBondContact O-CG 3.22Å; S107-R111 PolarHBondContact O-N 3Å; T108-R111 PolarHBondContact O-N 3.25Å; R111-G113 PolarHBondContact O-N 3.06Å
112	S	61.4	Low	68.7	Low	80 Å²	80	116 Å²	116	56%	0.559	57%	0.567	S	S	*	*	S	Bend	trans	-75.9	73	171.6	-73.2	0	0	0	0	110.4	T108 N116	T108-S112 PolarHBondContact O-N 3.28Å; T108-S112 PolarHBondContact O-OG 2.85Å; S112-N116 PolarHBondContact O-ND2 2.9Å
113	G	63.6	Low	69	Low	64 Å²	64	115.9 Å²	115.9	66%	0.66	56%	0.563	S	S	*	*			trans	-83.2	119.2	-175.5	0	0	0	0	0	113.5	R111	R111-G113 PolarHBondContact O-N 3.06Å
114	K	55.5	Low	69.3	Low	190 Å²	190	115.8 Å²	115.8	83%	0.826	57%	0.566	S	S	*	*	S	Bend		-162.9	-35.6	124.9	-148.9	153.2	69.6	157.7	0	113.1
115	D	55.6	Low	69.7	Low	149 Å²	149	110 Å²	110	80%	0.797	55%	0.551	S	S	*	*	S	Bend	trans	-95	-10.8	-177	-62.3	-36	0	0	0	114.4	R117	D115-R117 PolarHBondContact O-N 2.99Å
116	N	55.8	Low	70.2	Confident	43 Å²	43	102 Å²	102	23%	0.23	53%	0.532	C	S	.	.	T	Hydrogen-bonded Turn	trans	-89.1	0.2	-169.1	-62.3	-46.8	0	0	0	115	S112 R118 L119 L120	S112-N116 PolarHBondContact O-ND2 2.9Å; N116-R118 VanDerWaalsContact C-N 3.28Å; N116-R118 PolarHBondContact O-N 3.09Å; N116-L119 PolarHBondContact O-N 3.38Å; N116-L119 VanDerWaalsContact O-N 3.11Å; N116-L120 WeakPolarHBondContact O-CG 3.26Å; N116-L120 PolarHBondContact O-N 2.78Å
117	R	65	Low	70.8	Confident	205 Å²	205	103 Å²	103	77%	0.774	54%	0.54	S	S	*	.	H	α-helix	trans	-60.6	-35	-172.8	-177.1	171	146.1	-147.5	-4	113.1	D115 C121	D115-R117 PolarHBondContact O-N 2.99Å; R117-C121 PolarHBondContact O-N 3.32Å; R117-C121 PolarHBondContact O-SG 3.01Å
118	R	67.7	Low	71.5	Confident	205 Å²	205	104.5 Å²	104.5	77%	0.774	55%	0.548	S	S	*	.	H	α-helix	trans	-69.3	-44.9	175.1	-66.6	-175.6	-179.7	-170.5	0.3	111.7	N116 L120 C121 Y122	N116-R118 VanDerWaalsContact C-N 3.28Å; N116-R118 PolarHBondContact O-N 3.09Å; R118-L120 VanDerWaalsContact C-N 3.32Å; R118-L120 PolarHBondContact O-N 3.43Å; R118-C121 PolarHBondContact O-N 2.77Å; R118-Y122 WeakPolarHBondContact O-CD2 3.35Å; R118-Y122 PolarHBondContact O-N 3.06Å
119	L	75.5	Confident	72.2	Confident	100 Å²	100	105.9 Å²	105.9	52%	0.524	55%	0.551	S	S	.	*	H	α-helix	trans	-61.4	-40.8	176.7	-69.4	173.2	0	0	0	111.5	N116 Y122 V123	N116-L119 PolarHBondContact O-N 3.38Å; N116-L119 VanDerWaalsContact O-N 3.11Å; L119-Y122 PolarHBondContact O-N 2.94Å; L119-V123 VanDerWaalsContact O-CG2 3.3Å; L119-V123 WeakPolarHBondContact O-CG2 3.29Å; L119-V123 PolarHBondContact O-N 3.01Å
120	L	74.8	Confident	73.1	Confident	44 Å²	44	103.1 Å²	103.1	23%	0.23	55%	0.545	C	S	.	.	H	α-helix	trans	-63.5	-43.9	174.8	-66	179.6	0	0	0	112.5	F106 V110 N116 R118 Y122 V123 S124	F106-L120 HydrophobicContact CE2-CD2 4.05Å; F106-L120 HydrophobicContact CZ-CD2 3.99Å; V110-L120 HydrophobicContact CB-CD1 4.42Å; V110-L120 HydrophobicContact CB-CD2 4.04Å; V110-L120 HydrophobicContact CG1-CD1 4.1Å; V110-L120 HydrophobicContact CG1-CD2 4.35Å; V110-L120 HydrophobicContact CG2-CD2 3.32Å; N116-L120 WeakPolarHBondContact O-CG 3.26Å; N116-L120 PolarHBondContact O-N 2.78Å; R118-L120 VanDerWaalsContact C-N 3.32Å; R118-L120 PolarHBondContact O-N 3.43Å; L120-Y122 VanDerWaalsContact C-N 3.33Å; L120-Y122 PolarHBondContact O-N 3.44Å; L120-V123 PolarHBondContact O-N 3.24Å; L120-S124 VanDerWaalsContact O-CB 3.29Å; L120-S124 WeakPolarHBondContact O-CB 3.23Å; L120-S124 PolarHBondContact O-N 3.22Å
121	C	77.8	Confident	73.9	Confident	84 Å²	84	106.8 Å²	106.8	57%	0.568	56%	0.556	S	S	*	*	H	α-helix	trans	-59.7	-42.9	174.2	-73.6	0	0	0	0	111.8	R117 R118 G125	R117-C121 PolarHBondContact O-N 3.32Å; R117-C121 PolarHBondContact O-SG 3.01Å; R118-C121 PolarHBondContact O-N 2.77Å; C121-G125 PolarHBondContact O-N 3.13Å
122	Y	81.7	Confident	74.8	Confident	183 Å²	183	103.4 Å²	103.4	72%	0.718	55%	0.548	S	S	*	.	H	α-helix	trans	-65.6	-44.7	176.6	-80.6	-66.4	0	0	0	112.7	R118 L119 L120 G125 G126	R118-Y122 WeakPolarHBondContact O-CD2 3.35Å; R118-Y122 PolarHBondContact O-N 3.06Å; L119-Y122 PolarHBondContact O-N 2.94Å; L120-Y122 VanDerWaalsContact C-N 3.33Å; L120-Y122 PolarHBondContact O-N 3.44Å; Y122-G125 PolarHBondContact O-N 2.82Å; Y122-G126 PolarHBondContact O-N 3.46Å
123	V	81.8	Confident	75.6	Confident	70 Å²	70	104.8 Å²	104.8	42%	0.424	55%	0.548	S	S	.	.	H	α-helix	trans	-65.5	-41.3	178.8	174.3	0	0	0	0	111	F106 L119 L120 G126 L127	F106-V123 HydrophobicContact CD2-CG1 4.47Å; F106-V123 HydrophobicContact CE2-CB 4.02Å; F106-V123 HydrophobicContact CE2-CG1 3.52Å; F106-V123 HydrophobicContact CE2-CG2 4.2Å; F106-V123 HydrophobicContact CZ-CB 4.22Å; F106-V123 HydrophobicContact CZ-CG1 3.62Å; L119-V123 VanDerWaalsContact O-CG2 3.3Å; L119-V123 WeakPolarHBondContact O-CG2 3.29Å; L119-V123 PolarHBondContact O-N 3.01Å; L120-V123 PolarHBondContact O-N 3.24Å; V123-G126 PolarHBondContact O-N 2.77Å; V123-L127 WeakPolarHBondContact O-CB 3.13Å; V123-L127 PolarHBondContact O-N 3Å
124	S	81.9	Confident	76.5	Confident	76 Å²	76	106.7 Å²	106.7	53%	0.531	54%	0.543	S	S	.	.	H	α-helix	trans	-62.7	-46	175.7	179.5	0	0	0	0	111.9	L120 L127 V128	L120-S124 VanDerWaalsContact O-CB 3.29Å; L120-S124 WeakPolarHBondContact O-CB 3.23Å; L120-S124 PolarHBondContact O-N 3.22Å; S124-L127 PolarHBondContact O-N 3.42Å; S124-V128 WeakPolarHBondContact O-CG2 3.11Å; S124-V128 PolarHBondContact O-N 3.32Å
125	G	85.3	Confident	77.7	Confident	36 Å²	36	105.4 Å²	105.4	37%	0.371	53%	0.534	S	S	.	.	H	α-helix	trans	-64.3	-42.4	176.2	0	0	0	0	0	112.9	C121 Y122 L127 V128 L129	C121-G125 PolarHBondContact O-N 3.13Å; Y122-G125 PolarHBondContact O-N 2.82Å; G125-L127 VanDerWaalsContact C-N 3.35Å; G125-L127 PolarHBondContact O-N 3.47Å; G125-V128 PolarHBondContact O-N 2.99Å; G125-L129 WeakPolarHBondContact O-CG 3.44Å; G125-L129 PolarHBondContact O-N 3.33Å
126	G	85.6	Confident	78.7	Confident	37 Å²	37	104.9 Å²	104.9	38%	0.381	52%	0.522	S	S	.	.	H	α-helix	trans	-63	-38.8	176.1	0	0	0	0	0	112.8	Y122 V123 L129 A130	Y122-G126 PolarHBondContact O-N 3.46Å; V123-G126 PolarHBondContact O-N 2.77Å; G126-L129 PolarHBondContact O-N 2.76Å; G126-A130 VanDerWaalsContact O-CB 3.31Å; G126-A130 WeakPolarHBondContact O-CB 3.27Å; G126-A130 PolarHBondContact O-N 3.36Å
127	L	83.3	Confident	79.5	Confident	102 Å²	102	107.5 Å²	107.5	53%	0.534	54%	0.535	S	S	.	.	H	α-helix	trans	-63	-47.5	176.3	-174.6	65.2	0	0	0	111.2	V123 S124 G125 L129 A130 F131	V123-L127 WeakPolarHBondContact O-CB 3.13Å; V123-L127 PolarHBondContact O-N 3Å; S124-L127 PolarHBondContact O-N 3.42Å; G125-L127 VanDerWaalsContact C-N 3.35Å; G125-L127 PolarHBondContact O-N 3.47Å; L127-L129 PolarHBondContact O-N 2.89Å; L127-A130 PolarHBondContact O-N 2.87Å; L127-F131 HydrophobicContact CD1-CD2 4.03Å; L127-F131 HydrophobicContact CD1-CE2 3.6Å; L127-F131 HydrophobicContact CD2-CE2 4.23Å; L127-F131 HydrophobicContact CG-CD2 3.88Å; L127-F131 HydrophobicContact CG-CE2 3.68Å; L127-F131 WeakPolarHBondContact O-CD2 3.09Å; L127-F131 PolarHBondContact O-N 3.37Å
128	V	84.6	Confident	79.8	Confident	74 Å²	74	101.3 Å²	101.3	45%	0.448	52%	0.52	S	S	.	.	H	α-helix	trans	-59.9	-47.3	177.5	174.7	0	0	0	0	110.7	S124 G125 A130 F131 F132	S124-V128 WeakPolarHBondContact O-CG2 3.11Å; S124-V128 PolarHBondContact O-N 3.32Å; G125-V128 PolarHBondContact O-N 2.99Å; V128-A130 PolarHBondContact O-N 2.99Å; V128-F131 WeakPolarHBondContact O-CB 3.34Å; V128-F131 PolarHBondContact O-N 3.42Å; V128-F132 HydrophobicContact CG1-CD2 3.74Å; V128-F132 HydrophobicContact CG1-CE2 3.61Å; V128-F132 VanDerWaalsContact O-CD2 3.23Å; V128-F132 WeakPolarHBondContact O-CD2 3.21Å; V128-F132 PolarHBondContact O-N 3.19Å
129	L	84.6	Confident	80	Confident	114 Å²	114	93.1 Å²	93.1	60%	0.597	49%	0.494	S	S	*	.	H	α-helix	trans	-60.9	-42.7	176.4	-74.7	171.8	0	0	0	112.6	G125 G126 L127 F131 F132 L133	G125-L129 WeakPolarHBondContact O-CG 3.44Å; G125-L129 PolarHBondContact O-N 3.33Å; G126-L129 PolarHBondContact O-N 2.76Å; L127-L129 PolarHBondContact O-N 2.89Å; L129-F131 VanDerWaalsContact C-N 3.33Å; L129-F131 PolarHBondContact O-N 3.02Å; L129-F132 PolarHBondContact O-N 3.36Å; L129-L133 WeakPolarHBondContact O-CB 3.3Å; L129-L133 VanDerWaalsContact O-CG 3.3Å; L129-L133 WeakPolarHBondContact O-CG 3.02Å; L129-L133 PolarHBondContact O-N 3.1Å
130	A	82.8	Confident	79.5	Confident	44 Å²	44	95.2 Å²	95.2	36%	0.364	50%	0.495	S	S	.	.	H	α-helix	trans	-61.6	-40.9	176.5	0	0	0	0	0	111.7	G126 L127 V128 L133 L134	G126-A130 VanDerWaalsContact O-CB 3.31Å; G126-A130 WeakPolarHBondContact O-CB 3.27Å; G126-A130 PolarHBondContact O-N 3.36Å; L127-A130 PolarHBondContact O-N 2.87Å; V128-A130 PolarHBondContact O-N 2.99Å; A130-L133 PolarHBondContact O-N 2.79Å; A130-L134 WeakPolarHBondContact O-CB 3.11Å; A130-L134 VanDerWaalsContact O-CG 3.3Å; A130-L134 WeakPolarHBondContact O-CG 3.38Å; A130-L134 PolarHBondContact O-N 3.47Å
131	F	84.5	Confident	78.6	Confident	134 Å²	134	99.3 Å²	99.3	59%	0.588	52%	0.516	S	S	*	.	H	α-helix	trans	-61.9	-45	173.9	-87.9	-71.5	0	0	0	112.5	L127 V128 L129 L134 Y135	L127-F131 HydrophobicContact CD1-CD2 4.03Å; L127-F131 HydrophobicContact CD1-CE2 3.6Å; L127-F131 HydrophobicContact CD2-CE2 4.23Å; L127-F131 HydrophobicContact CG-CD2 3.88Å; L127-F131 HydrophobicContact CG-CE2 3.68Å; L127-F131 WeakPolarHBondContact O-CD2 3.09Å; L127-F131 PolarHBondContact O-N 3.37Å; V128-F131 WeakPolarHBondContact O-CB 3.34Å; V128-F131 PolarHBondContact O-N 3.42Å; L129-F131 VanDerWaalsContact C-N 3.33Å; L129-F131 PolarHBondContact O-N 3.02Å; F131-L134 PolarHBondContact O-N 3.48Å; F131-Y135 WeakPolarHBondContact O-CB 3.33Å; F131-Y135 PolarHBondContact O-N 3.25Å
132	F	81.9	Confident	77.4	Confident	137 Å²	137	103 Å²	103	60%	0.601	53%	0.525	S	S	*	.	H	α-helix	trans	-63.6	-40.6	176.4	-85.1	-75.7	0	0	0	112.3	V128 L129 Y135 Y136	V128-F132 HydrophobicContact CG1-CD2 3.74Å; V128-F132 HydrophobicContact CG1-CE2 3.61Å; V128-F132 VanDerWaalsContact O-CD2 3.23Å; V128-F132 WeakPolarHBondContact O-CD2 3.21Å; V128-F132 PolarHBondContact O-N 3.19Å; L129-F132 PolarHBondContact O-N 3.36Å; F132-Y135 PolarHBondContact O-N 3.07Å; F132-Y136 WeakPolarHBondContact O-CB 3.4Å; F132-Y136 PolarHBondContact O-N 3.48Å
133	L	78.1	Confident	75.6	Confident	110 Å²	110	101.1 Å²	101.1	58%	0.576	54%	0.538	S	S	*	.	H	α-helix	trans	-65.2	-43.9	176.3	-73.6	171.3	0	0	0	111.7	L129 A130 Y136 L137	L129-L133 WeakPolarHBondContact O-CB 3.3Å; L129-L133 VanDerWaalsContact O-CG 3.3Å; L129-L133 WeakPolarHBondContact O-CG 3.02Å; L129-L133 PolarHBondContact O-N 3.1Å; A130-L133 PolarHBondContact O-N 2.79Å; L133-Y136 PolarHBondContact O-N 3.34Å; L133-L137 WeakPolarHBondContact O-CB 3.21Å; L133-L137 VanDerWaalsContact O-CG 3.29Å; L133-L137 WeakPolarHBondContact O-CG 3.37Å; L133-L137 PolarHBondContact O-N 3.26Å
134	L	83.1	Confident	75.3	Confident	104 Å²	104	102.7 Å²	102.7	55%	0.545	54%	0.544	S	S	.	.	H	α-helix	trans	-64.4	-43	175.2	-73.4	176.7	0	0	0	111.4	A130 F131 Y136 L137 V138	A130-L134 WeakPolarHBondContact O-CB 3.11Å; A130-L134 VanDerWaalsContact O-CG 3.3Å; A130-L134 WeakPolarHBondContact O-CG 3.38Å; A130-L134 PolarHBondContact O-N 3.47Å; F131-L134 PolarHBondContact O-N 3.48Å; L134-Y136 VanDerWaalsContact C-N 3.35Å; L134-Y136 PolarHBondContact O-N 3.2Å; L134-L137 PolarHBondContact O-N 3.19Å; L134-V138 WeakPolarHBondContact O-CB 3.44Å; L134-V138 VanDerWaalsContact O-CG2 3.25Å; L134-V138 WeakPolarHBondContact O-CG2 3.42Å; L134-V138 PolarHBondContact O-N 3.19Å
135	Y	80.3	Confident	74.9	Confident	163 Å²	163	104.1 Å²	104.1	64%	0.639	55%	0.545	S	S	*	.	H	α-helix	trans	-58.8	-47.8	174.5	174.7	-100.7	0	0	0	110.9	F131 F132 L137 V138 S139	F131-Y135 WeakPolarHBondContact O-CB 3.33Å; F131-Y135 PolarHBondContact O-N 3.25Å; F132-Y135 PolarHBondContact O-N 3.07Å; Y135-L137 PolarHBondContact O-N 3.36Å; Y135-V138 PolarHBondContact O-N 3.15Å; Y135-S139 VanDerWaalsContact O-CB 3.26Å; Y135-S139 WeakPolarHBondContact O-CB 3.49Å; Y135-S139 PolarHBondContact O-N 3.26Å; Y135-S139 PolarHBondContact O-OG 3.49Å
136	Y	77.7	Confident	74.4	Confident	138 Å²	138	107.9 Å²	107.9	54%	0.541	55%	0.554	S	S	.	*	H	α-helix	trans	-62.9	-43.8	177.4	-174.7	-99.1	0	0	0	111.8	F132 L133 L134 S139 R140	F132-Y136 WeakPolarHBondContact O-CB 3.4Å; F132-Y136 PolarHBondContact O-N 3.48Å; L133-Y136 PolarHBondContact O-N 3.34Å; L134-Y136 VanDerWaalsContact C-N 3.35Å; L134-Y136 PolarHBondContact O-N 3.2Å; Y136-S139 PolarHBondContact O-N 3.31Å; Y136-R140 HydrophobicContact CD1-CG 3.9Å; Y136-R140 HydrophobicContact CD2-CG 4.39Å; Y136-R140 HydrophobicContact CE1-CG 3.59Å; Y136-R140 HydrophobicContact CE2-CG 4.11Å; Y136-R140 HydrophobicContact CG-CG 4.3Å; Y136-R140 VanDerWaalsContact O-CB 3.26Å; Y136-R140 WeakPolarHBondContact O-CB 3.49Å; Y136-R140 WeakPolarHBondContact O-CG 3.2Å; Y136-R140 PolarHBondContact O-N 2.74Å
137	L	70.9	Confident	73.7	Confident	98 Å²	98	112.1 Å²	112.1	51%	0.513	57%	0.565	S	S	.	*	H	α-helix	trans	-63.1	-47	177	-75.4	174.5	0	0	0	111.7	L133 L134 Y135 R140 I141	L133-L137 WeakPolarHBondContact O-CB 3.21Å; L133-L137 VanDerWaalsContact O-CG 3.29Å; L133-L137 WeakPolarHBondContact O-CG 3.37Å; L133-L137 PolarHBondContact O-N 3.26Å; L134-L137 PolarHBondContact O-N 3.19Å; Y135-L137 PolarHBondContact O-N 3.36Å; L137-R140 CarbonylContact O-C 3.54Å; L137-R140 PolarHBondContact O-N 3.21Å; L137-I141 WeakPolarHBondContact O-CB 3.44Å; L137-I141 VanDerWaalsContact O-CD1 3.32Å; L137-I141 WeakPolarHBondContact O-CD1 3.48Å; L137-I141 WeakPolarHBondContact O-CG1 3.47Å; L137-I141 PolarHBondContact O-N 3.3Å
138	V	72.4	Confident	73.1	Confident	75 Å²	75	112.7 Å²	112.7	46%	0.455	57%	0.566	S	S	.	*	H	α-helix	trans	-62.6	-45.8	177	171.8	0	0	0	0	110.4	L134 Y135 R140 I141 Q142	L134-V138 WeakPolarHBondContact O-CB 3.44Å; L134-V138 VanDerWaalsContact O-CG2 3.25Å; L134-V138 WeakPolarHBondContact O-CG2 3.42Å; L134-V138 PolarHBondContact O-N 3.19Å; Y135-V138 PolarHBondContact O-N 3.15Å; V138-R140 VanDerWaalsContact C-N 3.29Å; V138-R140 PolarHBondContact O-N 3.17Å; V138-I141 PolarHBondContact O-N 3.31Å; V138-Q142 WeakPolarHBondContact O-CB 3.45Å; V138-Q142 PolarHBondContact O-N 2.99Å
139	S	71.1	Confident	72.3	Confident	32 Å²	32	115.3 Å²	115.3	22%	0.224	57%	0.574	C	S	.	*	H	α-helix	trans	-63.1	-33.6	175.6	-65.2	0	0	0	0	112.7	Y135 Y136 S143	Y135-S139 VanDerWaalsContact O-CB 3.26Å; Y135-S139 WeakPolarHBondContact O-CB 3.49Å; Y135-S139 PolarHBondContact O-N 3.26Å; Y135-S139 PolarHBondContact O-OG 3.49Å; Y136-S139 PolarHBondContact O-N 3.31Å; S139-S143 WeakPolarHBondContact O-CB 3.25Å; S139-S143 PolarHBondContact O-N 3.42Å; S139-S143 PolarHBondContact O-OG 2.78Å
140	R	66.1	Low	71.5	Confident	145 Å²	145	115.4 Å²	115.4	55%	0.547	57%	0.573	S	S	.	*	H	α-helix	trans	-76.2	-28.8	175.2	-71.1	-71.1	-75.6	175.2	-3.1	113.6	Y136 L137 V138	Y136-R140 HydrophobicContact CD1-CG 3.9Å; Y136-R140 HydrophobicContact CD2-CG 4.39Å; Y136-R140 HydrophobicContact CE1-CG 3.59Å; Y136-R140 HydrophobicContact CE2-CG 4.11Å; Y136-R140 HydrophobicContact CG-CG 4.3Å; Y136-R140 VanDerWaalsContact O-CB 3.26Å; Y136-R140 WeakPolarHBondContact O-CB 3.49Å; Y136-R140 WeakPolarHBondContact O-CG 3.2Å; Y136-R140 PolarHBondContact O-N 2.74Å; L137-R140 CarbonylContact O-C 3.54Å; L137-R140 PolarHBondContact O-N 3.21Å; V138-R140 VanDerWaalsContact C-N 3.29Å; V138-R140 PolarHBondContact O-N 3.17Å
141	I	55.8	Low	70.6	Confident	130 Å²	130	120.8 Å²	120.8	67%	0.667	59%	0.589	S	S	*	*	H	α-helix	trans	-77.4	-30.1	172.6	-66.3	159.6	0	0	0	110.1	L137 V138	L137-I141 WeakPolarHBondContact O-CB 3.44Å; L137-I141 VanDerWaalsContact O-CD1 3.32Å; L137-I141 WeakPolarHBondContact O-CD1 3.48Å; L137-I141 WeakPolarHBondContact O-CG1 3.47Å; L137-I141 PolarHBondContact O-N 3.3Å; V138-I141 PolarHBondContact O-N 3.31Å
142	Q	52.4	Low	69.4	Low	161 Å²	161	119.8 Å²	119.8	75%	0.752	59%	0.589	S	S	*	*	H	α-helix	trans	-87.1	-13.9	180	-170	174.4	0.3	0	0	113.8	V138	V138-Q142 WeakPolarHBondContact O-CB 3.45Å; V138-Q142 PolarHBondContact O-N 2.99Å
143	S	43.5	Very low	68.3	Low	144 Å²	144	118.2 Å²	118.2	100%	1.007	59%	0.588	S	S	*	*			trans	-97	0	176.1	-53.8	0	0	0	0	110.7	S139	S139-S143 WeakPolarHBondContact O-CB 3.25Å; S139-S143 PolarHBondContact O-N 3.42Å; S139-S143 PolarHBondContact O-OG 2.78Å

Retrieved 143 of 143 residues in 303 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).