A0A087Y925_POEFO Loading...

Transcription initiation factor TFIID subunit 12

AlphaFold DB , UniProt , Accession A0A087Y925, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 131 aa.

						>A0A087Y925_POEFO|A0A087Y925
MANSTPIIVKGLTSGPAGRSSPEGSQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSNTLEVKDVQLHLERQWNMWIPGYGSDEIRPFKKACTTEAHKQRMALIRKTTKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.3	Very low	42	Very low	249 Å²	249	140.6 Å²	140.6	100%	1.227	82%	0.819	S	S	*	*				0	96	0	-77.7	167.2	166.1	0	0	107.6
2	A	40.5	Very low	41.5	Very low	99 Å²	99	143.4 Å²	143.4	82%	0.818	83%	0.826	S	S	*	*			trans	-83.7	128.4	173.6	0	0	0	0	0	107.7
3	N	40	Very low	41.3	Very low	164 Å²	164	143 Å²	143	88%	0.877	83%	0.828	S	S	*	*			trans	-130.8	99.3	168	-147.6	7.2	0	0	0	108.5
4	S	39.4	Very low	41.9	Very low	108 Å²	108	141.9 Å²	141.9	76%	0.755	83%	0.832	S	S	*	*	P	Polyproline II helix	trans	-84	116.4	176.3	-58.9	0	0	0	0	108.7
5	T	51.7	Low	42	Very low	128 Å²	128	136.3 Å²	136.3	79%	0.785	82%	0.817	S	S	*	*	P	Polyproline II helix	trans	-79.9	127.2	165.5	38.1	0	0	0	0	109.9
6	P	43.2	Very low	42.4	Very low	115 Å²	115	136.4 Å²	136.4	75%	0.747	82%	0.822	S	S	*	*	P	Polyproline II helix	trans	-80.4	128.4	174.3	29.7	-30.6	0	0	0	111.5
7	I	39.3	Very low	42.5	Very low	154 Å²	154	134.1 Å²	134.1	79%	0.79	82%	0.821	S	S	*	*	P	Polyproline II helix	trans	-79.7	117.1	168	-61.4	175.5	0	0	0	107.6	V9	I7-V9 HydrophobicContact CG2-CG2 4.12Å; I7-V9 PolarHBondContact O-N 3.24Å
8	I	43.8	Very low	42.5	Very low	153 Å²	153	130.1 Å²	130.1	79%	0.785	81%	0.811	S	S	*	*			trans	-81.7	99.3	172.9	-63.3	169.8	0	0	0	108	K10	I8-K10 PolarHBondContact O-N 3.14Å
9	V	44.3	Very low	42.8	Very low	125 Å²	125	132.8 Å²	132.8	76%	0.758	80%	0.804	S	S	*	*			trans	-83.1	104.1	164.9	176.8	0	0	0	0	107.3	I7 G11	I7-V9 HydrophobicContact CG2-CG2 4.12Å; I7-V9 PolarHBondContact O-N 3.24Å; V9-G11 PolarHBondContact O-N 3.32Å; V9-G11 VanDerWaalsContact O-N 3.16Å
10	K	42.7	Very low	42.8	Very low	190 Å²	190	131.6 Å²	131.6	83%	0.826	80%	0.801	S	S	*	*			trans	-77.9	98.4	171.5	-136.7	170.4	-174.3	177.1	0	107.5	I8	I8-K10 PolarHBondContact O-N 3.14Å
11	G	32.4	Very low	42.9	Very low	62 Å²	62	129.1 Å²	129.1	64%	0.639	79%	0.79	S	S	*	*			trans	-61.7	131.7	178.2	0	0	0	0	0	111.6	V9 T13	V9-G11 PolarHBondContact O-N 3.32Å; V9-G11 VanDerWaalsContact O-N 3.16Å; G11-T13 PolarHBondContact O-N 3.49Å
12	L	37.1	Very low	43.1	Very low	174 Å²	174	122 Å²	122	91%	0.911	76%	0.762	S	S	*	*			trans	-77.9	110.4	165.1	-78.2	92.9	0	0	0	108.3	S14	L12-S14 PolarHBondContact O-N 3.29Å
13	T	39	Very low	43.5	Very low	138 Å²	138	127 Å²	127	85%	0.847	77%	0.769	S	S	*	*			trans	-76.6	116.5	165.6	53.8	0	0	0	0	108.8	G11 G15	G11-T13 PolarHBondContact O-N 3.49Å; T13-G15 PolarHBondContact O-N 3.48Å
14	S	49.3	Very low	43.8	Very low	127 Å²	127	123.1 Å²	123.1	89%	0.888	77%	0.767	S	S	*	*			trans	-71.2	112.2	168.2	50.4	0	0	0	0	110.1	L12	L12-S14 PolarHBondContact O-N 3.29Å
15	G	42.7	Very low	44.8	Very low	59 Å²	59	121.8 Å²	121.8	61%	0.608	76%	0.758	S	S	*	*			trans	-138.3	153.4	164	0	0	0	0	0	108.9	T13 A17	T13-G15 PolarHBondContact O-N 3.48Å; G15-A17 PolarHBondContact O-N 2.82Å
16	P	48.5	Very low	45.4	Very low	137 Å²	137	120.5 Å²	120.5	89%	0.89	74%	0.743	S	S	*	*			trans	-72.9	103.3	-175.2	30.7	-29.7	0	0	0	107.9	G18	P16-G18 PolarHBondContact O-N 3.46Å
17	A	45.2	Very low	47	Very low	97 Å²	97	119.9 Å²	119.9	80%	0.802	74%	0.737	S	S	*	*			trans	-66.5	104.9	169.3	0	0	0	0	0	107.3	G15 R19	G15-A17 PolarHBondContact O-N 2.82Å; A17-R19 PolarHBondContact O-N 3.08Å
18	G	42	Very low	49.2	Very low	62 Å²	62	114.8 Å²	114.8	64%	0.639	71%	0.711	S	S	*	*			trans	-51	127.8	160.5	0	0	0	0	0	108.1	P16 S20	P16-G18 PolarHBondContact O-N 3.46Å; G18-S20 PolarHBondContact O-N 3.05Å
19	R	47.3	Very low	51.5	Low	183 Å²	183	110.5 Å²	110.5	69%	0.691	70%	0.695	S	S	*	*			trans	-57.9	86.8	167.3	-95.4	-177.4	171.5	-138.1	-4.8	107.7	A17 D60	A17-R19 PolarHBondContact O-N 3.08Å; R19-D60 IonicContact NH1-OD1 3.74Å
20	S	43.8	Very low	53.7	Low	107 Å²	107	107.3 Å²	107.3	75%	0.748	67%	0.671	S	S	*	*			trans	-92.9	95.7	151.4	42.4	0	0	0	0	104.1	G18	G18-S20 PolarHBondContact O-N 3.05Å
21	S	43.9	Very low	56	Low	81 Å²	81	105.2 Å²	105.2	57%	0.566	66%	0.662	S	S	*	*			trans	-54.7	126.3	166.6	-79.6	0	0	0	0	107.1	E23	S21-E23 PolarHBondContact O-N 2.89Å; S21-E23 VanDerWaalsContact O-N 3.11Å
22	P	48.6	Very low	58.8	Low	99 Å²	99	108.2 Å²	108.2	64%	0.643	66%	0.657	S	S	*	*			trans	-65.1	116.6	172.2	25.9	-29.7	0	0	0	107.5	G24 S25	P22-G24 PolarHBondContact O-N 3.06Å; P22-S25 PolarHBondContact O-N 3.3Å
23	E	48.8	Very low	61.5	Low	204 Å²	204	100.6 Å²	100.6	95%	0.953	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.3	3.9	176	-69	-173.8	108.2	0	0	114.4	S21	S21-E23 PolarHBondContact O-N 2.89Å; S21-E23 VanDerWaalsContact O-N 3.11Å
24	G	47.9	Very low	64.1	Low	82 Å²	82	97.4 Å²	97.4	85%	0.845	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.3	3.6	175.8	0	0	0	0	0	115.7	P22	P22-G24 PolarHBondContact O-N 3.06Å
25	S	58.7	Low	66.2	Low	80 Å²	80	94.6 Å²	94.6	56%	0.559	57%	0.568	S	S	*	*			trans	-127.7	18.4	-170.1	-169.5	0	0	0	0	114.8	P22 V27	P22-S25 PolarHBondContact O-N 3.3Å; S25-V27 WeakPolarHBondContact O-CG2 3.39Å; S25-V27 PolarHBondContact O-N 3.04Å
26	Q	65.7	Low	68.6	Low	101 Å²	101	95.9 Å²	95.9	47%	0.472	56%	0.56	S	S	.	*			trans	-72.3	106.2	176.2	-154.8	-178	-1.7	0	0	109.1	L28	Q26-L28 VanDerWaalsContact C-N 3.29Å; Q26-L28 VanDerWaalsContact CG-O 3.31Å; Q26-L28 WeakPolarHBondContact CG-O 3.49Å; Q26-L28 PolarHBondContact NE2-O 3.31Å; Q26-L28 PolarHBondContact O-N 2.96Å
27	V	76	Confident	70.8	Confident	102 Å²	102	90.5 Å²	90.5	62%	0.618	53%	0.525	S	S	*	.	S	Bend	trans	-74.6	-27.7	-171.3	-149.2	0	0	0	0	110.8	S25 I62	S25-V27 WeakPolarHBondContact O-CG2 3.39Å; S25-V27 PolarHBondContact O-N 3.04Å; V27-I62 HydrophobicContact CB-CD1 3.8Å; V27-I62 HydrophobicContact CG1-CD1 4.22Å; V27-I62 HydrophobicContact CG2-CD1 3.75Å
28	L	86.3	Confident	73.1	Confident	48 Å²	48	93.6 Å²	93.6	25%	0.251	52%	0.516	S	S	.	.	S	Bend	trans	-114.6	123.6	175.9	-175.9	63.8	0	0	0	109.8	Q26 K32 L55 A58	Q26-L28 VanDerWaalsContact C-N 3.29Å; Q26-L28 VanDerWaalsContact CG-O 3.31Å; Q26-L28 WeakPolarHBondContact CG-O 3.49Å; Q26-L28 PolarHBondContact NE2-O 3.31Å; Q26-L28 PolarHBondContact O-N 2.96Å; L28-K32 HydrophobicContact CD1-CB 3.94Å; L28-K32 HydrophobicContact CD1-CG 3.97Å; L28-L55 HydrophobicContact CB-CD2 4.1Å; L28-L55 HydrophobicContact CD2-CD2 3.95Å; L28-L55 HydrophobicContact CG-CD2 3.89Å; L28-L55 WeakPolarHBondContact O-CD2 3.45Å; L28-A58 HydrophobicContact CD2-CB 4.28Å
29	S	90.9	Very high	75.7	Confident	62 Å²	62	98.4 Å²	98.4	43%	0.434	52%	0.521	S	S	.	.			trans	-84.8	149.6	175.2	65.4	0	0	0	0	111.7	K31 K32 L33	S29-K31 PolarHBondContact O-N 2.94Å; S29-K32 PolarHBondContact O-N 3.45Å; S29-K32 PolarHBondContact OG-N 3.01Å; S29-L33 PolarHBondContact O-N 3.4Å
30	K	90.3	Very high	77.9	Confident	58 Å²	58	96.1 Å²	96.1	25%	0.252	52%	0.521	S	S	.	.	H	α-helix	trans	-51.3	-41.3	173.7	-164.2	167.6	-168.4	157.8	0	112.5	K32 L33 Q34 E48 E51 E52 L55	K30-K32 PolarHBondContact O-N 3.35Å; K30-L33 WeakPolarHBondContact O-CB 3.45Å; K30-L33 PolarHBondContact O-N 3.22Å; K30-Q34 WeakPolarHBondContact O-CG 3.24Å; K30-Q34 PolarHBondContact O-N 3.19Å; K30-E48 IonicContact NZ-OE1 3.91Å; K30-E48 PolarHBondContact NZ-OE1 3.41Å; K30-E51 WeakPolarHBondContact CE-OE2 3.25Å; K30-E51 WeakPolarHBondContact CG-OE2 3.47Å; K30-E51 IonicContact NZ-OE2 3.37Å; K30-E52 IonicContact NZ-OE1 2.72Å; K30-E52 PolarHBondContact NZ-OE1 2.98Å; K30-L55 HydrophobicContact CB-CD1 4.39Å
31	K	91.6	Very high	80.3	Confident	146 Å²	146	93.8 Å²	93.8	64%	0.635	50%	0.501	S	S	*	.	H	α-helix	trans	-57.9	-45.2	174.4	-178	-177.7	175.4	108.2	0	112.3	S29 L33 Q34 D35	S29-K31 PolarHBondContact O-N 2.94Å; K31-L33 VanDerWaalsContact C-N 3.35Å; K31-Q34 PolarHBondContact O-N 3.45Å; K31-D35 VanDerWaalsContact O-CG 3.29Å; K31-D35 PolarHBondContact O-N 3.13Å
32	K	92.4	Very high	82.6	Confident	126 Å²	126	94.6 Å²	94.6	55%	0.548	50%	0.504	S	S	.	.	H	α-helix	trans	-71.2	-32.8	-177.7	-167.1	58.7	171.6	169.4	0	112.1	L28 S29 K30 L36	L28-K32 HydrophobicContact CD1-CB 3.94Å; L28-K32 HydrophobicContact CD1-CG 3.97Å; S29-K32 PolarHBondContact O-N 3.45Å; S29-K32 PolarHBondContact OG-N 3.01Å; K30-K32 PolarHBondContact O-N 3.35Å; K32-L36 WeakPolarHBondContact O-CB 3.42Å; K32-L36 PolarHBondContact O-N 2.93Å
33	L	93.3	Very high	84.7	Confident	14 Å²	14	96.9 Å²	96.9	7%	0.073	51%	0.511	C	S	.	.	H	α-helix	trans	-61.7	-47.6	170.5	178	62.8	0	0	0	110.8	S29 K30 K31 D35 L36 V37 E51 L54 L55	S29-L33 PolarHBondContact O-N 3.4Å; K30-L33 WeakPolarHBondContact O-CB 3.45Å; K30-L33 PolarHBondContact O-N 3.22Å; K31-L33 VanDerWaalsContact C-N 3.35Å; L33-D35 PolarHBondContact O-N 2.95Å; L33-L36 WeakPolarHBondContact O-CB 3.39Å; L33-L36 PolarHBondContact O-N 3.49Å; L33-L36 VanDerWaalsContact O-N 3.13Å; L33-V37 HydrophobicContact CD1-CG2 4.48Å; L33-V37 WeakPolarHBondContact O-CG2 3.41Å; L33-V37 PolarHBondContact O-N 3.33Å; L33-E51 HydrophobicContact CD2-CB 4.04Å; L33-E51 HydrophobicContact CD2-CG 4.26Å; L33-L54 HydrophobicContact CD1-CD1 4.47Å; L33-L54 HydrophobicContact CD2-CB 4.2Å; L33-L55 HydrophobicContact CD2-CD1 4.45Å; L33-L55 HydrophobicContact CD2-CD2 4.25Å; L33-L55 HydrophobicContact CD2-CG 4Å
34	Q	93.1	Very high	86.7	Confident	71 Å²	71	92.5 Å²	92.5	33%	0.332	49%	0.49	S	S	.	.	H	α-helix	trans	-62.3	-41	177.6	-71.5	174.3	-8.4	0	0	112.7	K30 K31 L36 V37 R38 E51	K30-Q34 WeakPolarHBondContact O-CG 3.24Å; K30-Q34 PolarHBondContact O-N 3.19Å; K31-Q34 PolarHBondContact O-N 3.45Å; Q34-L36 VanDerWaalsContact C-N 3.29Å; Q34-L36 PolarHBondContact O-N 3.4Å; Q34-V37 PolarHBondContact O-N 2.94Å; Q34-R38 WeakPolarHBondContact O-CG 2.76Å; Q34-R38 PolarHBondContact O-N 2.98Å; Q34-R38 VanDerWaalsContact O-N 3.08Å; Q34-E51 VanDerWaalsContact CG-OE1 3.24Å; Q34-E51 WeakPolarHBondContact CG-OE1 3.49Å; Q34-E51 PolarHBondContact NE2-OE1 2.97Å; Q34-E51 PolarHBondContact NE2-OE2 2.86Å
35	D	93.5	Very high	88.6	Confident	67 Å²	67	97.1 Å²	97.1	36%	0.358	49%	0.49	S	S	.	.	H	α-helix	trans	-60.8	-40.5	174.4	-68.8	-23.4	0	0	0	111.1	K31 L33 R38 E39	K31-D35 VanDerWaalsContact O-CG 3.29Å; K31-D35 PolarHBondContact O-N 3.13Å; L33-D35 PolarHBondContact O-N 2.95Å; D35-R38 PolarHBondContact O-N 3.25Å; D35-E39 PolarHBondContact O-N 3.44Å; D35-E39 VanDerWaalsContact O-N 3.14Å
36	L	93.8	Very high	90.2	Very high	86 Å²	86	95 Å²	95	45%	0.45	47%	0.472	S	S	.	.	H	α-helix	trans	-67.3	-42.8	178.3	-176.4	67.9	0	0	0	112.1	K32 L33 Q34 R38 E39 I40	K32-L36 WeakPolarHBondContact O-CB 3.42Å; K32-L36 PolarHBondContact O-N 2.93Å; L33-L36 WeakPolarHBondContact O-CB 3.39Å; L33-L36 PolarHBondContact O-N 3.49Å; L33-L36 VanDerWaalsContact O-N 3.13Å; Q34-L36 VanDerWaalsContact C-N 3.29Å; Q34-L36 PolarHBondContact O-N 3.4Å; L36-R38 VanDerWaalsContact C-N 3.32Å; L36-R38 PolarHBondContact O-N 3.26Å; L36-E39 WeakPolarHBondContact O-CB 3.41Å; L36-E39 PolarHBondContact O-N 3.01Å; L36-I40 HydrophobicContact CG-CD1 4.34Å; L36-I40 WeakPolarHBondContact O-CG1 3.43Å; L36-I40 PolarHBondContact O-N 3.02Å
37	V	94.3	Very high	91.6	Very high	24 Å²	24	96 Å²	96	15%	0.145	48%	0.481	C	S	.	.	H	α-helix	trans	-60.1	-45.4	176.8	172.6	0	0	0	0	110.2	L33 Q34 E39 I40 D41 L46	L33-V37 HydrophobicContact CD1-CG2 4.48Å; L33-V37 WeakPolarHBondContact O-CG2 3.41Å; L33-V37 PolarHBondContact O-N 3.33Å; Q34-V37 PolarHBondContact O-N 2.94Å; V37-E39 VanDerWaalsContact C-N 3.27Å; V37-E39 PolarHBondContact O-N 3.19Å; V37-I40 PolarHBondContact O-N 3.04Å; V37-D41 CarbonylContact O-C 3.4Å; V37-D41 PolarHBondContact O-N 3.27Å; V37-L46 HydrophobicContact CG1-CG 4.4Å; V37-L46 HydrophobicContact CG2-CD1 3.6Å; V37-L46 HydrophobicContact CG2-CG 4.23Å
38	R	93.9	Very high	92.5	Very high	162 Å²	162	97.4 Å²	97.4	61%	0.611	48%	0.481	S	S	*	.	H	α-helix	trans	-65	-28.7	178.6	-72.8	176.9	179.1	178	1.8	114.1	Q34 D35 L36 I40	Q34-R38 WeakPolarHBondContact O-CG 2.76Å; Q34-R38 PolarHBondContact O-N 2.98Å; Q34-R38 VanDerWaalsContact O-N 3.08Å; D35-R38 PolarHBondContact O-N 3.25Å; L36-R38 VanDerWaalsContact C-N 3.32Å; L36-R38 PolarHBondContact O-N 3.26Å; R38-I40 VanDerWaalsContact C-N 3.31Å
39	E	94.9	Very high	92.8	Very high	163 Å²	163	101.7 Å²	101.7	76%	0.762	50%	0.504	S	S	*	.	H	α-helix	trans	-69.3	-32.8	174	-172.5	176.9	170	0	0	111.5	D35 L36 V37	D35-E39 PolarHBondContact O-N 3.44Å; D35-E39 VanDerWaalsContact O-N 3.14Å; L36-E39 WeakPolarHBondContact O-CB 3.41Å; L36-E39 PolarHBondContact O-N 3.01Å; V37-E39 VanDerWaalsContact C-N 3.27Å; V37-E39 PolarHBondContact O-N 3.19Å
40	I	93.9	Very high	93.1	Very high	135 Å²	135	101.3 Å²	101.3	69%	0.692	50%	0.499	S	S	*	.	H	α-helix	trans	-82.4	-53.2	179.1	-62.1	168.1	0	0	0	111	L36 V37 R38	L36-I40 HydrophobicContact CG-CD1 4.34Å; L36-I40 WeakPolarHBondContact O-CG1 3.43Å; L36-I40 PolarHBondContact O-N 3.02Å; V37-I40 PolarHBondContact O-N 3.04Å; R38-I40 VanDerWaalsContact C-N 3.31Å
41	D	93.6	Very high	93.2	Very high	59 Å²	59	99.1 Å²	99.1	32%	0.316	49%	0.489	S	S	.	.			trans	-140.3	110.9	174.6	-169.5	-16.9	0	0	0	110.5	V37 N43 E44	V37-D41 CarbonylContact O-C 3.4Å; V37-D41 PolarHBondContact O-N 3.27Å; D41-N43 PolarHBondContact O-N 3.02Å; D41-N43 PolarHBondContact OD1-N 3.3Å; D41-E44 HydrophobicContact CB-CB 4Å; D41-E44 PolarHBondContact O-N 3.09Å
42	P	93	Very high	93.2	Very high	97 Å²	97	96.3 Å²	96.3	63%	0.63	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.9	-13.9	180	28.8	-35.1	0	0	0	114.2
43	N	92.1	Very high	93.3	Very high	148 Å²	148	95.4 Å²	95.4	79%	0.791	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.4	-11.4	-178.6	-54.8	-59.9	0	0	0	113.2	D41	D41-N43 PolarHBondContact O-N 3.02Å; D41-N43 PolarHBondContact OD1-N 3.3Å
44	E	90.6	Very high	93.4	Very high	111 Å²	111	97.7 Å²	97.7	52%	0.519	49%	0.489	S	S	.	.			trans	-88.6	134	-178.6	-169.1	163.5	-157.4	0	0	110.9	D41	D41-E44 HydrophobicContact CB-CB 4Å; D41-E44 PolarHBondContact O-N 3.09Å
45	Q	89.8	Confident	93.4	Very high	179 Å²	179	94.4 Å²	94.4	84%	0.836	47%	0.474	S	S	*	.			trans	-127.1	117.6	176.4	-171.2	168.7	7.8	0	0	108.6
46	L	92	Very high	93.4	Very high	37 Å²	37	94.9 Å²	94.9	19%	0.194	47%	0.474	C	S	.	.			trans	-75.3	143.2	178.8	-63.6	179.4	0	0	0	110.7	V37 V50 E51 L54	V37-L46 HydrophobicContact CG1-CG 4.4Å; V37-L46 HydrophobicContact CG2-CD1 3.6Å; V37-L46 HydrophobicContact CG2-CG 4.23Å; L46-V50 HydrophobicContact CD2-CG1 4.13Å; L46-E51 HydrophobicContact CB-CG 3.69Å; L46-E51 HydrophobicContact CD1-CG 4.17Å; L46-L54 HydrophobicContact CD1-CD1 3.68Å
47	D	95	Very high	93.4	Very high	122 Å²	122	95.2 Å²	95.2	65%	0.652	48%	0.476	S	S	*	.			trans	-69.5	152.2	167.4	-71.7	-37.4	0	0	0	110.5	D49 V50 E51	D47-D49 VanDerWaalsContact C-N 3.32Å; D47-D49 PolarHBondContact O-N 3.27Å; D47-V50 HydrophobicContact CB-CG2 4.23Å; D47-V50 WeakPolarHBondContact O-CB 3.35Å; D47-V50 PolarHBondContact O-N 3.11Å; D47-E51 PolarHBondContact O-N 3.37Å
48	E	93.4	Very high	93.4	Very high	131 Å²	131	95.2 Å²	95.2	61%	0.612	48%	0.478	S	S	*	.	H	α-helix	trans	-55.9	-44.4	-177.7	175.2	155.9	-138.2	0	0	112.6	K30 V50 E51 E52	K30-E48 IonicContact NZ-OE1 3.91Å; K30-E48 PolarHBondContact NZ-OE1 3.41Å; E48-V50 PolarHBondContact O-N 3.43Å; E48-E51 PolarHBondContact O-N 2.99Å; E48-E52 WeakPolarHBondContact O-CG 3.4Å; E48-E52 PolarHBondContact O-N 3.33Å
49	D	94.1	Very high	93.3	Very high	138 Å²	138	89.5 Å²	89.5	74%	0.738	46%	0.459	S	S	*	.	H	α-helix	trans	-62.4	-32.1	179	-65.5	-27.6	0	0	0	112.5	D47 M53	D47-D49 VanDerWaalsContact C-N 3.32Å; D47-D49 PolarHBondContact O-N 3.27Å; D49-M53 WeakPolarHBondContact O-CB 3.31Å; D49-M53 PolarHBondContact O-N 2.79Å; D49-M53 VanDerWaalsContact O-N 3.09Å
50	V	95.7	Very high	93.3	Very high	53 Å²	53	84.9 Å²	84.9	32%	0.321	44%	0.44	S	S	.	.	H	α-helix	trans	-75	-40.7	177.9	-178.7	0	0	0	0	110.4	L46 D47 E48 M53 L54	L46-V50 HydrophobicContact CD2-CG1 4.13Å; D47-V50 HydrophobicContact CB-CG2 4.23Å; D47-V50 WeakPolarHBondContact O-CB 3.35Å; D47-V50 PolarHBondContact O-N 3.11Å; E48-V50 PolarHBondContact O-N 3.43Å; V50-M53 PolarHBondContact O-N 3.19Å; V50-L54 HydrophobicContact CG1-CD1 4.22Å; V50-L54 HydrophobicContact CG1-CG 4.46Å; V50-L54 WeakPolarHBondContact O-CG 3.47Å; V50-L54 PolarHBondContact O-N 2.95Å
51	E	92.8	Very high	93.4	Very high	12 Å²	12	81.3 Å²	81.3	6%	0.056	42%	0.42	C	S	.	.	H	α-helix	trans	-58.6	-48.2	174.2	-67.5	-172.9	163.4	0	0	111	K30 L33 Q34 L46 D47 E48 M53 L54 L55	K30-E51 WeakPolarHBondContact CE-OE2 3.25Å; K30-E51 WeakPolarHBondContact CG-OE2 3.47Å; K30-E51 IonicContact NZ-OE2 3.37Å; L33-E51 HydrophobicContact CD2-CB 4.04Å; L33-E51 HydrophobicContact CD2-CG 4.26Å; Q34-E51 VanDerWaalsContact CG-OE1 3.24Å; Q34-E51 WeakPolarHBondContact CG-OE1 3.49Å; Q34-E51 PolarHBondContact NE2-OE1 2.97Å; Q34-E51 PolarHBondContact NE2-OE2 2.86Å; L46-E51 HydrophobicContact CB-CG 3.69Å; L46-E51 HydrophobicContact CD1-CG 4.17Å; D47-E51 PolarHBondContact O-N 3.37Å; E48-E51 PolarHBondContact O-N 2.99Å; E51-M53 VanDerWaalsContact C-N 3.34Å; E51-M53 PolarHBondContact O-N 3.29Å; E51-L54 PolarHBondContact O-N 3.45Å; E51-L55 WeakPolarHBondContact O-CD1 3.43Å; E51-L55 VanDerWaalsContact O-CG 3.25Å; E51-L55 WeakPolarHBondContact O-CG 3.42Å; E51-L55 PolarHBondContact O-N 2.97Å
52	E	92.6	Very high	93.4	Very high	88 Å²	88	81.5 Å²	81.5	41%	0.411	42%	0.42	S	S	.	.	H	α-helix	trans	-62.4	-40.5	178	-63	-53.9	145.7	0	0	111.9	K30 E48 L55 Q56	K30-E52 IonicContact NZ-OE1 2.72Å; K30-E52 PolarHBondContact NZ-OE1 2.98Å; E48-E52 WeakPolarHBondContact O-CG 3.4Å; E48-E52 PolarHBondContact O-N 3.33Å; E52-L55 PolarHBondContact O-N 3.37Å; E52-Q56 PolarHBondContact O-N 3.25Å
53	M	94.8	Very high	93.4	Very high	106 Å²	106	82.3 Å²	82.3	52%	0.522	42%	0.415	S	S	.	.	H	α-helix	trans	-62.4	-44.3	175.6	-175.8	-175.7	67.6	0	0	111.9	D49 V50 E51 L55 Q56 I57	D49-M53 WeakPolarHBondContact O-CB 3.31Å; D49-M53 PolarHBondContact O-N 2.79Å; D49-M53 VanDerWaalsContact O-N 3.09Å; V50-M53 PolarHBondContact O-N 3.19Å; E51-M53 VanDerWaalsContact C-N 3.34Å; E51-M53 PolarHBondContact O-N 3.29Å; M53-L55 VanDerWaalsContact C-N 3.33Å; M53-L55 PolarHBondContact O-N 2.75Å; M53-Q56 PolarHBondContact O-N 3.35Å; M53-I57 HydrophobicContact CG-CD1 4.03Å; M53-I57 VanDerWaalsContact O-CG1 3.28Å; M53-I57 WeakPolarHBondContact O-CG1 3.49Å; M53-I57 PolarHBondContact O-N 3.4Å
54	L	94.4	Very high	93.6	Very high	62 Å²	62	77.9 Å²	77.9	33%	0.325	40%	0.396	S	S	.	.	H	α-helix	trans	-65.1	-38	178.3	-72.5	173.3	0	0	0	112.1	L33 L46 V50 E51 I57 A58	L33-L54 HydrophobicContact CD1-CD1 4.47Å; L33-L54 HydrophobicContact CD2-CB 4.2Å; L46-L54 HydrophobicContact CD1-CD1 3.68Å; V50-L54 HydrophobicContact CG1-CD1 4.22Å; V50-L54 HydrophobicContact CG1-CG 4.46Å; V50-L54 WeakPolarHBondContact O-CG 3.47Å; V50-L54 PolarHBondContact O-N 2.95Å; E51-L54 PolarHBondContact O-N 3.45Å; L54-I57 PolarHBondContact O-N 3.5Å; L54-A58 WeakPolarHBondContact O-CB 3.44Å; L54-A58 PolarHBondContact O-N 2.9Å
55	L	93.2	Very high	93.9	Very high	3 Å²	3	73.1 Å²	73.1	2%	0.016	38%	0.375	C	S	.	.	H	α-helix	trans	-62.8	-44.8	174.8	-70	163.5	0	0	0	111	L28 K30 L33 E51 E52 M53 I57 A58 D59	L28-L55 HydrophobicContact CB-CD2 4.1Å; L28-L55 HydrophobicContact CD2-CD2 3.95Å; L28-L55 HydrophobicContact CG-CD2 3.89Å; L28-L55 WeakPolarHBondContact O-CD2 3.45Å; K30-L55 HydrophobicContact CB-CD1 4.39Å; L33-L55 HydrophobicContact CD2-CD1 4.45Å; L33-L55 HydrophobicContact CD2-CD2 4.25Å; L33-L55 HydrophobicContact CD2-CG 4Å; E51-L55 WeakPolarHBondContact O-CD1 3.43Å; E51-L55 VanDerWaalsContact O-CG 3.25Å; E51-L55 WeakPolarHBondContact O-CG 3.42Å; E51-L55 PolarHBondContact O-N 2.97Å; E52-L55 PolarHBondContact O-N 3.37Å; M53-L55 VanDerWaalsContact C-N 3.33Å; M53-L55 PolarHBondContact O-N 2.75Å; L55-I57 VanDerWaalsContact C-N 3.35Å; L55-I57 PolarHBondContact O-N 3.29Å; L55-A58 WeakPolarHBondContact O-CB 3.42Å; L55-A58 PolarHBondContact O-N 3.21Å; L55-D59 PolarHBondContact O-N 2.93Å
56	Q	93.3	Very high	94.2	Very high	76 Å²	76	68.1 Å²	68.1	36%	0.355	36%	0.356	S	S	.	.	H	α-helix	trans	-61.9	-42.4	175.8	-175.3	61.4	54.8	0	0	112.1	E52 M53 A58 D59 D60	E52-Q56 PolarHBondContact O-N 3.25Å; M53-Q56 PolarHBondContact O-N 3.35Å; Q56-A58 VanDerWaalsContact C-N 3.29Å; Q56-A58 PolarHBondContact O-N 3Å; Q56-D59 PolarHBondContact O-N 3.34Å; Q56-D60 PolarHBondContact NE2-OD1 3.41Å; Q56-D60 PolarHBondContact O-N 3.37Å
57	I	94.5	Very high	94.4	Very high	94 Å²	94	69.6 Å²	69.6	48%	0.482	37%	0.367	S	S	.	.	H	α-helix	trans	-61.7	-40.3	176.3	-69	165.4	0	0	0	110.6	M53 L54 L55 F61	M53-I57 HydrophobicContact CG-CD1 4.03Å; M53-I57 VanDerWaalsContact O-CG1 3.28Å; M53-I57 WeakPolarHBondContact O-CG1 3.49Å; M53-I57 PolarHBondContact O-N 3.4Å; L54-I57 PolarHBondContact O-N 3.5Å; L55-I57 VanDerWaalsContact C-N 3.35Å; L55-I57 PolarHBondContact O-N 3.29Å; I57-F61 VanDerWaalsContact O-CB 3.27Å; I57-F61 WeakPolarHBondContact O-CB 3.23Å; I57-F61 PolarHBondContact O-N 2.94Å
58	A	94.3	Very high	94.5	Very high	24 Å²	24	64.5 Å²	64.5	20%	0.198	34%	0.342	C	S	.	.	H	α-helix	trans	-64	-43	177.2	0	0	0	0	0	111.8	L28 L54 L55 Q56 F61 I62	L28-A58 HydrophobicContact CD2-CB 4.28Å; L54-A58 WeakPolarHBondContact O-CB 3.44Å; L54-A58 PolarHBondContact O-N 2.9Å; L55-A58 WeakPolarHBondContact O-CB 3.42Å; L55-A58 PolarHBondContact O-N 3.21Å; Q56-A58 VanDerWaalsContact C-N 3.29Å; Q56-A58 PolarHBondContact O-N 3Å; A58-F61 WeakPolarHBondContact O-CB 3.33Å; A58-F61 PolarHBondContact O-N 3.5Å; A58-I62 VanDerWaalsContact O-CG1 3.28Å; A58-I62 WeakPolarHBondContact O-CG1 3.47Å; A58-I62 PolarHBondContact O-N 3.27Å
59	D	92.3	Very high	94.6	Very high	41 Å²	41	58.3 Å²	58.3	22%	0.219	31%	0.313	C	S	.	.	H	α-helix	trans	-65	-45	177.2	-73.5	-24.1	0	0	0	111.6	L55 Q56 F61 I62 E63	L55-D59 PolarHBondContact O-N 2.93Å; Q56-D59 PolarHBondContact O-N 3.34Å; D59-F61 VanDerWaalsContact C-N 3.3Å; D59-F61 PolarHBondContact O-N 2.96Å; D59-I62 PolarHBondContact O-N 3.03Å; D59-E63 PolarHBondContact O-N 3.13Å
60	D	94.1	Very high	94.8	Very high	67 Å²	67	54.4 Å²	54.4	36%	0.358	30%	0.296	S	S	.	.	H	α-helix	trans	-63.4	-37.1	176.6	-70.7	-19	0	0	0	111.5	R19 Q56 E63 S64	R19-D60 IonicContact NH1-OD1 3.74Å; Q56-D60 PolarHBondContact NE2-OD1 3.41Å; Q56-D60 PolarHBondContact O-N 3.37Å; D60-E63 PolarHBondContact O-N 3.29Å; D60-S64 VanDerWaalsContact O-CB 3.31Å; D60-S64 WeakPolarHBondContact O-CB 3.46Å; D60-S64 PolarHBondContact O-N 2.9Å
61	F	95.1	Very high	94.8	Very high	60 Å²	60	57.6 Å²	57.6	26%	0.263	31%	0.307	S	S	.	.	H	α-helix	trans	-61.3	-47.6	173.4	169.5	-100	0	0	0	111.4	I57 A58 D59 S64 V65 L90 W94 M96	I57-F61 VanDerWaalsContact O-CB 3.27Å; I57-F61 WeakPolarHBondContact O-CB 3.23Å; I57-F61 PolarHBondContact O-N 2.94Å; A58-F61 WeakPolarHBondContact O-CB 3.33Å; A58-F61 PolarHBondContact O-N 3.5Å; D59-F61 VanDerWaalsContact C-N 3.3Å; D59-F61 PolarHBondContact O-N 2.96Å; F61-S64 PolarHBondContact O-N 2.99Å; F61-V65 HydrophobicContact CD1-CG2 4.44Å; F61-V65 HydrophobicContact CD2-CG2 4.02Å; F61-V65 HydrophobicContact CE1-CG2 4.1Å; F61-V65 HydrophobicContact CE2-CG2 3.64Å; F61-V65 HydrophobicContact CG-CG2 4.41Å; F61-V65 HydrophobicContact CZ-CG2 3.7Å; F61-V65 WeakPolarHBondContact O-CB 3.28Å; F61-V65 VanDerWaalsContact O-CG2 3.28Å; F61-V65 WeakPolarHBondContact O-CG2 3.28Å; F61-V65 PolarHBondContact O-N 2.93Å; F61-L90 HydrophobicContact CE2-CD2 4.27Å; F61-L90 HydrophobicContact CZ-CD2 3.73Å; F61-W94 HydrophobicContact CD2-CD2 4.02Å; F61-W94 AromaticContact CD2-CE2 3.68Å; F61-W94 HydrophobicContact CD2-CE3 4.12Å; F61-W94 AromaticContact CD2-CH2 3.6Å; F61-W94 HydrophobicContact CD2-CH2 3.6Å; F61-W94 AromaticContact CD2-CZ2 3.48Å; F61-W94 HydrophobicContact CD2-CZ2 3.48Å; F61-W94 VanDerWaalsContact CD2-CZ2 3.48Å; F61-W94 AromaticContact CD2-CZ3 3.92Å; F61-W94 HydrophobicContact CD2-CZ3 3.92Å; F61-W94 AromaticContact CE2-CD2 3.56Å; F61-W94 HydrophobicContact CE2-CD2 3.56Å; F61-W94 AromaticContact CE2-CE2 3.53Å; F61-W94 AromaticContact CE2-CE3 3.88Å; F61-W94 HydrophobicContact CE2-CE3 3.88Å; F61-W94 AromaticContact CE2-CG 4Å; F61-W94 HydrophobicContact CE2-CG 4Å; F61-W94 HydrophobicContact CE2-CH2 4.17Å; F61-W94 AromaticContact CE2-CZ2 3.86Å; F61-W94 HydrophobicContact CE2-CZ2 3.86Å; F61-W94 HydrophobicContact CE2-CZ3 4.17Å; F61-W94 AromaticContact CE2-NE1 3.91Å; F61-M96 HydrophobicContact CZ-SD 4.38Å
62	I	94.3	Very high	94.9	Very high	62 Å²	62	59.3 Å²	59.3	32%	0.318	32%	0.316	S	S	.	.	H	α-helix	trans	-61.9	-46.6	178.7	-67.9	165.7	0	0	0	110.3	V27 A58 D59 S64 V65 V66	V27-I62 HydrophobicContact CB-CD1 3.8Å; V27-I62 HydrophobicContact CG1-CD1 4.22Å; V27-I62 HydrophobicContact CG2-CD1 3.75Å; A58-I62 VanDerWaalsContact O-CG1 3.28Å; A58-I62 WeakPolarHBondContact O-CG1 3.47Å; A58-I62 PolarHBondContact O-N 3.27Å; D59-I62 PolarHBondContact O-N 3.03Å; I62-S64 VanDerWaalsContact C-N 3.32Å; I62-S64 PolarHBondContact O-N 2.77Å; I62-V65 PolarHBondContact O-N 3.37Å; I62-V66 HydrophobicContact CG2-CG2 4.09Å; I62-V66 WeakPolarHBondContact O-CB 3.3Å; I62-V66 VanDerWaalsContact O-CG2 3.23Å; I62-V66 WeakPolarHBondContact O-CG2 3.44Å; I62-V66 PolarHBondContact O-N 2.72Å
63	E	94	Very high	95.1	Very high	114 Å²	114	55.3 Å²	55.3	53%	0.533	30%	0.298	S	S	.	.	H	α-helix	trans	-58.9	-44.6	178.7	-175.2	171.2	-155.1	0	0	111.4	D59 D60 T67	D59-E63 PolarHBondContact O-N 3.13Å; D60-E63 PolarHBondContact O-N 3.29Å; E63-T67 WeakPolarHBondContact O-CB 3.47Å; E63-T67 PolarHBondContact O-N 3.03Å; E63-T67 PolarHBondContact O-OG1 3.27Å
64	S	95.4	Very high	95.2	Very high	56 Å²	56	59 Å²	59	39%	0.392	31%	0.307	S	S	.	.	H	α-helix	trans	-61.8	-50.9	177.3	-178.5	0	0	0	0	112.2	D60 F61 I62 T67 A68	D60-S64 VanDerWaalsContact O-CB 3.31Å; D60-S64 WeakPolarHBondContact O-CB 3.46Å; D60-S64 PolarHBondContact O-N 2.9Å; F61-S64 PolarHBondContact O-N 2.99Å; I62-S64 VanDerWaalsContact C-N 3.32Å; I62-S64 PolarHBondContact O-N 2.77Å; S64-T67 PolarHBondContact O-N 2.97Å; S64-A68 WeakPolarHBondContact O-CB 3.27Å; S64-A68 PolarHBondContact O-N 3.3Å
65	V	96.4	Very high	95.3	Very high	11 Å²	11	63.8 Å²	63.8	7%	0.067	33%	0.327	C	S	.	.	H	α-helix	trans	-63.7	-45.9	-178.4	171.3	0	0	0	0	111.2	F61 I62 A68 A69 V86 L90	F61-V65 HydrophobicContact CD1-CG2 4.44Å; F61-V65 HydrophobicContact CD2-CG2 4.02Å; F61-V65 HydrophobicContact CE1-CG2 4.1Å; F61-V65 HydrophobicContact CE2-CG2 3.64Å; F61-V65 HydrophobicContact CG-CG2 4.41Å; F61-V65 HydrophobicContact CZ-CG2 3.7Å; F61-V65 WeakPolarHBondContact O-CB 3.28Å; F61-V65 VanDerWaalsContact O-CG2 3.28Å; F61-V65 WeakPolarHBondContact O-CG2 3.28Å; F61-V65 PolarHBondContact O-N 2.93Å; I62-V65 PolarHBondContact O-N 3.37Å; V65-A68 PolarHBondContact O-N 2.91Å; V65-A69 VanDerWaalsContact O-CB 3.26Å; V65-A69 WeakPolarHBondContact O-CB 3.34Å; V65-A69 PolarHBondContact O-N 3.48Å; V65-V86 HydrophobicContact CG1-CG1 3.88Å; V65-L90 HydrophobicContact CG1-CD2 4.25Å; V65-L90 HydrophobicContact CG2-CD2 3.97Å
66	V	95.9	Very high	95.3	Very high	73 Å²	73	68.2 Å²	68.2	44%	0.442	34%	0.343	S	S	.	.	H	α-helix	trans	-65.6	-41.8	-179.7	172.4	0	0	0	0	110.7	I62 A69 C70	I62-V66 HydrophobicContact CG2-CG2 4.09Å; I62-V66 WeakPolarHBondContact O-CB 3.3Å; I62-V66 VanDerWaalsContact O-CG2 3.23Å; I62-V66 WeakPolarHBondContact O-CG2 3.44Å; I62-V66 PolarHBondContact O-N 2.72Å; V66-A69 PolarHBondContact O-N 3.24Å; V66-C70 WeakPolarHBondContact O-CB 3.38Å; V66-C70 PolarHBondContact O-N 3.14Å; V66-C70 PolarHBondContact O-SG 3.11Å
67	T	96.8	Very high	95.3	Very high	68 Å²	68	74 Å²	74	42%	0.417	37%	0.367	S	S	.	.	H	α-helix	trans	-61.2	-47.5	177.4	-64.1	0	0	0	0	111.2	E63 S64 C70 Q71	E63-T67 WeakPolarHBondContact O-CB 3.47Å; E63-T67 PolarHBondContact O-N 3.03Å; E63-T67 PolarHBondContact O-OG1 3.27Å; S64-T67 PolarHBondContact O-N 2.97Å; T67-C70 PolarHBondContact O-N 3.09Å; T67-Q71 WeakPolarHBondContact O-CG 3.39Å; T67-Q71 PolarHBondContact O-N 3.49Å
68	A	96.7	Very high	95.3	Very high	16 Å²	16	70.7 Å²	70.7	13%	0.132	35%	0.352	C	S	.	.	H	α-helix	trans	-65.7	-42	178.5	0	0	0	0	0	112.3	S64 V65 C70 Q71 L72 H89	S64-A68 WeakPolarHBondContact O-CB 3.27Å; S64-A68 PolarHBondContact O-N 3.3Å; V65-A68 PolarHBondContact O-N 2.91Å; A68-C70 PolarHBondContact O-N 3.04Å; A68-Q71 WeakPolarHBondContact O-CB 3.45Å; A68-Q71 PolarHBondContact O-N 3.1Å; A68-Q71 VanDerWaalsContact O-N 3.17Å; A68-L72 WeakPolarHBondContact O-CG 3.26Å; A68-L72 PolarHBondContact O-N 3.13Å; A68-H89 HydrophobicContact CB-CB 4.46Å; A68-H89 WeakPolarHBondContact CB-CE1 3.4Å; A68-H89 VanDerWaalsContact CB-ND1 3.33Å; A68-H89 WeakPolarHBondContact CB-ND1 3.18Å
69	A	96.5	Very high	95.3	Very high	0 Å²	0	77.5 Å²	77.5	0%	0	39%	0.386	C	S	.	.	H	α-helix	trans	-62.7	-41.6	176.3	0	0	0	0	0	111.8	V65 V66 Q71 L72 A73 L81 D85 V86	V65-A69 VanDerWaalsContact O-CB 3.26Å; V65-A69 WeakPolarHBondContact O-CB 3.34Å; V65-A69 PolarHBondContact O-N 3.48Å; V66-A69 PolarHBondContact O-N 3.24Å; A69-Q71 VanDerWaalsContact C-N 3.31Å; A69-Q71 PolarHBondContact O-N 2.91Å; A69-L72 WeakPolarHBondContact O-CB 3.28Å; A69-L72 PolarHBondContact O-N 2.89Å; A69-A73 PolarHBondContact O-N 3.14Å; A69-L81 HydrophobicContact CB-CD1 3.77Å; A69-D85 HydrophobicContact CB-CB 4.12Å; A69-D85 WeakPolarHBondContact O-CB 3.32Å; A69-V86 HydrophobicContact CB-CB 4.37Å; A69-V86 HydrophobicContact CB-CG2 3.64Å
70	C	97.1	Very high	95.4	Very high	56 Å²	56	80 Å²	80	38%	0.378	40%	0.402	S	S	.	.	H	α-helix	trans	-61.1	-39.1	173	-76.8	0	0	0	0	112.2	V66 T67 A68 L72 A73 R74 L81	V66-C70 WeakPolarHBondContact O-CB 3.38Å; V66-C70 PolarHBondContact O-N 3.14Å; V66-C70 PolarHBondContact O-SG 3.11Å; T67-C70 PolarHBondContact O-N 3.09Å; A68-C70 PolarHBondContact O-N 3.04Å; C70-L72 VanDerWaalsContact C-N 3.35Å; C70-A73 PolarHBondContact O-N 3.3Å; C70-R74 WeakPolarHBondContact O-CG 3.35Å; C70-R74 PolarHBondContact O-N 3.48Å; C70-L81 HydrophobicContact CB-CD1 4.47Å; C70-L81 VanDerWaalsContact SG-CD1 3.58Å
71	Q	96.9	Very high	95.5	Very high	120 Å²	120	80.9 Å²	80.9	56%	0.561	41%	0.407	S	S	*	.	H	α-helix	trans	-64.7	-39.1	174.7	-69.8	174.1	20.1	0	0	111.9	T67 A68 A69 R74 H75	T67-Q71 WeakPolarHBondContact O-CG 3.39Å; T67-Q71 PolarHBondContact O-N 3.49Å; A68-Q71 WeakPolarHBondContact O-CB 3.45Å; A68-Q71 PolarHBondContact O-N 3.1Å; A68-Q71 VanDerWaalsContact O-N 3.17Å; A69-Q71 VanDerWaalsContact C-N 3.31Å; A69-Q71 PolarHBondContact O-N 2.91Å; Q71-R74 PolarHBondContact O-N 3.41Å; Q71-H75 WeakPolarHBondContact O-CB 3.46Å; Q71-H75 PolarHBondContact O-N 2.97Å
72	L	95.3	Very high	95.4	Very high	49 Å²	49	81.7 Å²	81.7	26%	0.257	41%	0.411	S	S	.	.	H	α-helix	trans	-65.9	-43.1	175.4	-70.4	170	0	0	0	112.2	A68 A69 C70 R74 H75 R76 D85 L88 H89	A68-L72 WeakPolarHBondContact O-CG 3.26Å; A68-L72 PolarHBondContact O-N 3.13Å; A69-L72 WeakPolarHBondContact O-CB 3.28Å; A69-L72 PolarHBondContact O-N 2.89Å; C70-L72 VanDerWaalsContact C-N 3.35Å; L72-R74 VanDerWaalsContact C-N 3.32Å; L72-R74 PolarHBondContact O-N 2.76Å; L72-H75 WeakPolarHBondContact O-CB 3.35Å; L72-H75 PolarHBondContact O-N 3.47Å; L72-H75 VanDerWaalsContact O-N 3.13Å; L72-R76 PolarHBondContact O-N 2.97Å; L72-D85 HydrophobicContact CB-CB 4.07Å; L72-D85 WeakPolarHBondContact CD1-O 3.43Å; L72-L88 HydrophobicContact CD1-CB 4.31Å; L72-L88 HydrophobicContact CD1-CD2 4.07Å; L72-L88 HydrophobicContact CD1-CG 4.36Å; L72-L88 HydrophobicContact CD2-CD2 4.03Å; L72-H89 HydrophobicContact CD1-CB 4.2Å
73	A	96.3	Very high	95.3	Very high	4 Å²	4	83 Å²	83	3%	0.033	42%	0.422	C	S	.	.	H	α-helix	trans	-58	-45.9	174.4	0	0	0	0	0	111.4	A69 C70 H75 R76 S78 D85	A69-A73 PolarHBondContact O-N 3.14Å; C70-A73 PolarHBondContact O-N 3.3Å; A73-H75 PolarHBondContact O-N 2.88Å; A73-R76 WeakPolarHBondContact O-CG 3.31Å; A73-R76 PolarHBondContact O-N 3.4Å; A73-S78 CarbonylContact C-O 3.56Å; A73-S78 WeakPolarHBondContact O-CB 3.5Å; A73-S78 PolarHBondContact O-N 2.98Å; A73-D85 WeakPolarHBondContact CB-OD2 3.42Å; A73-D85 PolarHBondContact N-OD1 3.23Å
74	R	96.6	Very high	95.1	Very high	184 Å²	184	84.2 Å²	84.2	69%	0.694	43%	0.425	S	S	*	.	H	α-helix	trans	-64.8	-36.8	175.4	-71.8	178.8	67.5	-125.4	-0.8	112.6	C70 Q71 L72 R76 K77	C70-R74 WeakPolarHBondContact O-CG 3.35Å; C70-R74 PolarHBondContact O-N 3.48Å; Q71-R74 PolarHBondContact O-N 3.41Å; L72-R74 VanDerWaalsContact C-N 3.32Å; L72-R74 PolarHBondContact O-N 2.76Å; R74-R76 VanDerWaalsContact C-N 3.28Å; R74-R76 PolarHBondContact O-N 3.4Å; R74-K77 WeakPolarHBondContact O-CA 3.2Å; R74-K77 PolarHBondContact O-N 3Å
75	H	95.8	Very high	95	Very high	162 Å²	162	81.9 Å²	81.9	75%	0.75	41%	0.409	S	S	*	.	H	α-helix	trans	-61.1	-36.3	179	176.7	-94.3	0	0	0	112.4	Q71 L72 A73 K77	Q71-H75 WeakPolarHBondContact O-CB 3.46Å; Q71-H75 PolarHBondContact O-N 2.97Å; L72-H75 WeakPolarHBondContact O-CB 3.35Å; L72-H75 PolarHBondContact O-N 3.47Å; L72-H75 VanDerWaalsContact O-N 3.13Å; A73-H75 PolarHBondContact O-N 2.88Å; H75-K77 PolarHBondContact O-N 2.75Å
76	R	93.5	Very high	94.9	Very high	96 Å²	96	83.3 Å²	83.3	36%	0.362	42%	0.417	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83	9.1	172.6	61.8	-174.5	177.9	117.7	12.1	114.1	L72 A73 R74 S78 T80 E82 D85	L72-R76 PolarHBondContact O-N 2.97Å; A73-R76 WeakPolarHBondContact O-CG 3.31Å; A73-R76 PolarHBondContact O-N 3.4Å; R74-R76 VanDerWaalsContact C-N 3.28Å; R74-R76 PolarHBondContact O-N 3.4Å; R76-S78 PolarHBondContact O-N 2.88Å; R76-T80 PolarHBondContact NH2-O 3.39Å; R76-T80 VanDerWaalsContact NH2-O 3.13Å; R76-E82 IonicContact CZ-OE1 2.76Å; R76-E82 IonicContact CZ-OE2 3.49Å; R76-E82 IonicContact NH1-OE1 3.58Å; R76-E82 PolarHBondContact NH1-OE1 3.39Å; R76-E82 VanDerWaalsContact NH1-OE1 3.1Å; R76-E82 IonicContact NH1-OE2 3.46Å; R76-E82 PolarHBondContact NH1-OE2 3.43Å; R76-E82 VanDerWaalsContact NH2-CB 3.27Å; R76-E82 IonicContact NH2-OE1 3.47Å; R76-E82 PolarHBondContact NH2-OE1 3.15Å; R76-E82 IonicContact NH2-OE2 3.1Å; R76-E82 PolarHBondContact NH2-OE2 3.49Å; R76-D85 IonicContact CZ-OD1 2.86Å; R76-D85 IonicContact CZ-OD2 3.66Å; R76-D85 IonicContact NE-OD1 3.87Å; R76-D85 PolarHBondContact NE-OD1 3.42Å; R76-D85 IonicContact NE-OD2 2.72Å; R76-D85 PolarHBondContact NE-OD2 3.48Å; R76-D85 IonicContact NH2-OD1 2.95Å; R76-D85 IonicContact NH2-OD2 2.91Å; R76-D85 PolarHBondContact NH2-OD2 2.93Å
77	K	94.3	Very high	94.7	Very high	197 Å²	197	81.3 Å²	81.3	86%	0.857	40%	0.403	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.3	26.9	-178.1	-48.6	172.1	-176.2	176.9	0	113.3	R74 H75	R74-K77 WeakPolarHBondContact O-CA 3.2Å; R74-K77 PolarHBondContact O-N 3Å; H75-K77 PolarHBondContact O-N 2.75Å
78	S	94.2	Very high	94.4	Very high	24 Å²	24	80.1 Å²	80.1	17%	0.168	39%	0.394	C	S	.	.			trans	-93.1	142.6	172.3	-176.1	0	0	0	0	110	A73 R76 T80	A73-S78 CarbonylContact C-O 3.56Å; A73-S78 WeakPolarHBondContact O-CB 3.5Å; A73-S78 PolarHBondContact O-N 2.98Å; R76-S78 PolarHBondContact O-N 2.88Å; S78-T80 PolarHBondContact OG-N 3.42Å; S78-T80 PolarHBondContact OG-O 3.1Å
79	N	94.4	Very high	94.3	Very high	168 Å²	168	80.7 Å²	80.7	90%	0.898	39%	0.394	S	S	*	.	S	Bend	trans	-96.8	2.5	168.4	-69.7	-15.5	0	0	0	112.1
80	T	94.9	Very high	94.1	Very high	93 Å²	93	81.4 Å²	81.4	57%	0.571	40%	0.397	S	S	*	.	S	Bend	trans	-114.6	124.5	-179.8	-50.6	0	0	0	0	108.9	R76 S78	R76-T80 PolarHBondContact NH2-O 3.39Å; R76-T80 VanDerWaalsContact NH2-O 3.13Å; S78-T80 PolarHBondContact OG-N 3.42Å; S78-T80 PolarHBondContact OG-O 3.1Å
81	L	95.3	Very high	93.8	Very high	85 Å²	85	80.9 Å²	80.9	45%	0.445	39%	0.39	S	S	.	.			trans	-71.7	125.2	171.9	-174.8	117.2	0	0	0	109.1	A69 C70 V86	A69-L81 HydrophobicContact CB-CD1 3.77Å; C70-L81 HydrophobicContact CB-CD1 4.47Å; C70-L81 VanDerWaalsContact SG-CD1 3.58Å; L81-V86 HydrophobicContact CD2-CG2 4.18Å
82	E	92.1	Very high	93.5	Very high	78 Å²	78	83.6 Å²	83.6	36%	0.364	40%	0.395	S	S	.	.			trans	-114.5	161.6	175.6	-69.6	172.8	-159.6	0	0	111.3	R76 K84 D85	R76-E82 IonicContact CZ-OE1 2.76Å; R76-E82 IonicContact CZ-OE2 3.49Å; R76-E82 IonicContact NH1-OE1 3.58Å; R76-E82 PolarHBondContact NH1-OE1 3.39Å; R76-E82 VanDerWaalsContact NH1-OE1 3.1Å; R76-E82 IonicContact NH1-OE2 3.46Å; R76-E82 PolarHBondContact NH1-OE2 3.43Å; R76-E82 VanDerWaalsContact NH2-CB 3.27Å; R76-E82 IonicContact NH2-OE1 3.47Å; R76-E82 PolarHBondContact NH2-OE1 3.15Å; R76-E82 IonicContact NH2-OE2 3.1Å; R76-E82 PolarHBondContact NH2-OE2 3.49Å; E82-K84 PolarHBondContact O-N 3.13Å; E82-K84 VanDerWaalsContact O-N 3.13Å; E82-D85 PolarHBondContact N-OD2 2.98Å; E82-D85 WeakPolarHBondContact O-CB 3.35Å; E82-D85 PolarHBondContact O-N 3.42Å
83	V	92.4	Very high	93.4	Very high	88 Å²	88	87.9 Å²	87.9	53%	0.533	41%	0.413	S	S	.	.	H	α-helix	trans	-53.6	-35.6	177.5	-179.7	0	0	0	0	112.1	D85 V86 Q87 Y101	V83-D85 PolarHBondContact O-N 3.04Å; V83-V86 PolarHBondContact O-N 2.91Å; V83-Q87 VanDerWaalsContact O-CB 3.3Å; V83-Q87 WeakPolarHBondContact O-CB 3.28Å; V83-Q87 PolarHBondContact O-N 3.42Å; V83-Y101 HydrophobicContact CG1-CD1 3.89Å; V83-Y101 HydrophobicContact CG1-CE1 4.5Å
84	K	90.4	Very high	93.2	Very high	140 Å²	140	93.2 Å²	93.2	61%	0.609	43%	0.433	S	S	*	.	H	α-helix	trans	-61.8	-31.3	179	-62.1	-177.2	177.5	-176.9	0	112.9	E82 L88	E82-K84 PolarHBondContact O-N 3.13Å; E82-K84 VanDerWaalsContact O-N 3.13Å; K84-L88 VanDerWaalsContact O-CB 3.28Å; K84-L88 WeakPolarHBondContact O-CB 3.1Å; K84-L88 PolarHBondContact O-N 2.91Å; K84-L88 VanDerWaalsContact O-N 3.1Å
85	D	93.1	Very high	93	Very high	8 Å²	8	91.7 Å²	91.7	4%	0.043	44%	0.438	C	S	.	.	H	α-helix	trans	-70.4	-44.9	-180	-57.1	-50.6	0	0	0	110.5	A69 L72 A73 R76 E82 V83 H89	A69-D85 HydrophobicContact CB-CB 4.12Å; A69-D85 WeakPolarHBondContact O-CB 3.32Å; L72-D85 HydrophobicContact CB-CB 4.07Å; L72-D85 WeakPolarHBondContact CD1-O 3.43Å; A73-D85 WeakPolarHBondContact CB-OD2 3.42Å; A73-D85 PolarHBondContact N-OD1 3.23Å; R76-D85 IonicContact CZ-OD1 2.86Å; R76-D85 IonicContact CZ-OD2 3.66Å; R76-D85 IonicContact NE-OD1 3.87Å; R76-D85 PolarHBondContact NE-OD1 3.42Å; R76-D85 IonicContact NE-OD2 2.72Å; R76-D85 PolarHBondContact NE-OD2 3.48Å; R76-D85 IonicContact NH2-OD1 2.95Å; R76-D85 IonicContact NH2-OD2 2.91Å; R76-D85 PolarHBondContact NH2-OD2 2.93Å; E82-D85 PolarHBondContact N-OD2 2.98Å; E82-D85 WeakPolarHBondContact O-CB 3.35Å; E82-D85 PolarHBondContact O-N 3.42Å; V83-D85 PolarHBondContact O-N 3.04Å; D85-H89 PolarHBondContact O-N 2.96Å
86	V	94.6	Very high	92.8	Very high	41 Å²	41	88.3 Å²	88.3	25%	0.248	42%	0.424	C	S	.	.	H	α-helix	trans	-67.6	-48.1	177	179.6	0	0	0	0	110.7	V65 A69 L81 V83 L88 H89 L90	V65-V86 HydrophobicContact CG1-CG1 3.88Å; A69-V86 HydrophobicContact CB-CB 4.37Å; A69-V86 HydrophobicContact CB-CG2 3.64Å; L81-V86 HydrophobicContact CD2-CG2 4.18Å; V83-V86 PolarHBondContact O-N 2.91Å; V86-L88 PolarHBondContact O-N 3.17Å; V86-H89 PolarHBondContact O-N 3.47Å; V86-H89 VanDerWaalsContact O-N 3.14Å; V86-L90 HydrophobicContact CG1-CD1 3.94Å; V86-L90 HydrophobicContact CG1-CG 4.31Å; V86-L90 WeakPolarHBondContact O-CG 3.32Å; V86-L90 PolarHBondContact O-N 3.17Å
87	Q	91.7	Very high	92.6	Very high	30 Å²	30	91.9 Å²	91.9	14%	0.14	44%	0.438	C	S	.	.	H	α-helix	trans	-57.3	-47.5	-178.6	-173.2	-166.7	-23.6	0	0	111.7	V83 H89 L90 E91	V83-Q87 VanDerWaalsContact O-CB 3.3Å; V83-Q87 WeakPolarHBondContact O-CB 3.28Å; V83-Q87 PolarHBondContact O-N 3.42Å; Q87-H89 PolarHBondContact O-N 3.05Å; Q87-L90 PolarHBondContact O-N 3.04Å; Q87-E91 HydrophobicContact CG-CG 4.5Å; Q87-E91 PolarHBondContact NE2-OE1 3.46Å; Q87-E91 WeakPolarHBondContact O-CG 3.33Å; Q87-E91 PolarHBondContact O-N 3.43Å
88	L	90	Very high	92.2	Very high	43 Å²	43	85.9 Å²	85.9	23%	0.225	41%	0.414	C	S	.	.	H	α-helix	trans	-58.8	-37.6	179.6	179.7	65.6	0	0	0	112.1	L72 K84 V86 R92 I106	L72-L88 HydrophobicContact CD1-CB 4.31Å; L72-L88 HydrophobicContact CD1-CD2 4.07Å; L72-L88 HydrophobicContact CD1-CG 4.36Å; L72-L88 HydrophobicContact CD2-CD2 4.03Å; K84-L88 VanDerWaalsContact O-CB 3.28Å; K84-L88 WeakPolarHBondContact O-CB 3.1Å; K84-L88 PolarHBondContact O-N 2.91Å; K84-L88 VanDerWaalsContact O-N 3.1Å; V86-L88 PolarHBondContact O-N 3.17Å; L88-R92 HydrophobicContact CD1-CG 4.14Å; L88-R92 VanDerWaalsContact CD1-NE 3.32Å; L88-R92 WeakPolarHBondContact O-CB 3.34Å; L88-R92 WeakPolarHBondContact O-CG 3.4Å; L88-R92 PolarHBondContact O-N 3.16Å; L88-R92 VanDerWaalsContact O-N 3.15Å; L88-I106 HydrophobicContact CD1-CD1 3.6Å; L88-I106 HydrophobicContact CD1-CG1 4.47Å
89	H	93.9	Very high	91.8	Very high	29 Å²	29	89 Å²	89	13%	0.134	43%	0.434	C	S	.	.	H	α-helix	trans	-72.1	-42.6	178.8	-172.9	67.6	0	0	0	112.1	A68 L72 D85 V86 Q87 R92 Q93 W94	A68-H89 HydrophobicContact CB-CB 4.46Å; A68-H89 WeakPolarHBondContact CB-CE1 3.4Å; A68-H89 VanDerWaalsContact CB-ND1 3.33Å; A68-H89 WeakPolarHBondContact CB-ND1 3.18Å; L72-H89 HydrophobicContact CD1-CB 4.2Å; D85-H89 PolarHBondContact O-N 2.96Å; V86-H89 PolarHBondContact O-N 3.47Å; V86-H89 VanDerWaalsContact O-N 3.14Å; Q87-H89 PolarHBondContact O-N 3.05Å; H89-R92 PolarHBondContact O-N 3.49Å; H89-Q93 PolarHBondContact O-N 3.41Å; H89-W94 AromaticContact CD2-NE1 3.95Å; H89-W94 AromaticContact NE2-NE1 3.58Å
90	L	94.3	Very high	91.1	Very high	14 Å²	14	85 Å²	85	7%	0.073	43%	0.432	C	S	.	.	H	α-helix	trans	-61.6	-44.1	176.4	-68.9	177.4	0	0	0	112.2	F61 V65 V86 Q87 W94 N95 M96 I98	F61-L90 HydrophobicContact CE2-CD2 4.27Å; F61-L90 HydrophobicContact CZ-CD2 3.73Å; V65-L90 HydrophobicContact CG1-CD2 4.25Å; V65-L90 HydrophobicContact CG2-CD2 3.97Å; V86-L90 HydrophobicContact CG1-CD1 3.94Å; V86-L90 HydrophobicContact CG1-CG 4.31Å; V86-L90 WeakPolarHBondContact O-CG 3.32Å; V86-L90 PolarHBondContact O-N 3.17Å; Q87-L90 PolarHBondContact O-N 3.04Å; L90-W94 HydrophobicContact CD2-CG 4.45Å; L90-W94 CarbonylContact O-C 3.47Å; L90-W94 WeakPolarHBondContact O-CA 3.43Å; L90-W94 WeakPolarHBondContact O-CB 3.48Å; L90-W94 PolarHBondContact O-N 3.25Å; L90-W94 VanDerWaalsContact O-N 3.11Å; L90-N95 PolarHBondContact O-N 3.46Å; L90-M96 CarbonylContact C-O 3.58Å; L90-M96 HydrophobicContact CB-CB 4.37Å; L90-M96 HydrophobicContact CD2-SD 4.41Å; L90-M96 PolarHBondContact O-N 3.06Å; L90-M96 VanDerWaalsContact O-N 3.09Å; L90-I98 HydrophobicContact CD1-CD1 3.84Å
91	E	90.7	Very high	90.1	Very high	46 Å²	46	87.1 Å²	87.1	22%	0.215	43%	0.43	C	S	.	.	H	α-helix	trans	-67.4	-42.1	178.7	-72.1	178.7	-175.1	0	0	112.1	Q87 N95 M96	Q87-E91 HydrophobicContact CG-CG 4.5Å; Q87-E91 PolarHBondContact NE2-OE1 3.46Å; Q87-E91 WeakPolarHBondContact O-CG 3.33Å; Q87-E91 PolarHBondContact O-N 3.43Å; E91-N95 WeakPolarHBondContact O-CA 3.33Å; E91-N95 PolarHBondContact O-N 2.91Å; E91-M96 WeakPolarHBondContact CA-O 3.12Å; E91-M96 PolarHBondContact N-O 3.36Å
92	R	89.5	Confident	88.6	Confident	177 Å²	177	85 Å²	85	67%	0.668	43%	0.43	S	S	*	.	H	α-helix	trans	-85.1	-33	-172.3	-71.2	-170.6	173.9	-143	2.9	115	L88 H89	L88-R92 HydrophobicContact CD1-CG 4.14Å; L88-R92 VanDerWaalsContact CD1-NE 3.32Å; L88-R92 WeakPolarHBondContact O-CB 3.34Å; L88-R92 WeakPolarHBondContact O-CG 3.4Å; L88-R92 PolarHBondContact O-N 3.16Å; L88-R92 VanDerWaalsContact O-N 3.15Å; H89-R92 PolarHBondContact O-N 3.49Å
93	Q	92.6	Very high	86.8	Confident	139 Å²	139	86.7 Å²	86.7	65%	0.65	45%	0.45	S	S	*	.	H	α-helix	trans	-104	-34.9	-178.4	-75.3	-49.3	-70.4	0	0	113.3	H89	H89-Q93 PolarHBondContact O-N 3.41Å
94	W	93.8	Very high	85	Confident	116 Å²	116	88.8 Å²	88.8	44%	0.439	46%	0.458	S	S	.	.	S	Bend	trans	-101.1	-7.7	-176.9	-62.7	92.2	0	0	0	112.9	F61 H89 L90 M96	F61-W94 HydrophobicContact CD2-CD2 4.02Å; F61-W94 AromaticContact CD2-CE2 3.68Å; F61-W94 HydrophobicContact CD2-CE3 4.12Å; F61-W94 AromaticContact CD2-CH2 3.6Å; F61-W94 HydrophobicContact CD2-CH2 3.6Å; F61-W94 AromaticContact CD2-CZ2 3.48Å; F61-W94 HydrophobicContact CD2-CZ2 3.48Å; F61-W94 VanDerWaalsContact CD2-CZ2 3.48Å; F61-W94 AromaticContact CD2-CZ3 3.92Å; F61-W94 HydrophobicContact CD2-CZ3 3.92Å; F61-W94 AromaticContact CE2-CD2 3.56Å; F61-W94 HydrophobicContact CE2-CD2 3.56Å; F61-W94 AromaticContact CE2-CE2 3.53Å; F61-W94 AromaticContact CE2-CE3 3.88Å; F61-W94 HydrophobicContact CE2-CE3 3.88Å; F61-W94 AromaticContact CE2-CG 4Å; F61-W94 HydrophobicContact CE2-CG 4Å; F61-W94 HydrophobicContact CE2-CH2 4.17Å; F61-W94 AromaticContact CE2-CZ2 3.86Å; F61-W94 HydrophobicContact CE2-CZ2 3.86Å; F61-W94 HydrophobicContact CE2-CZ3 4.17Å; F61-W94 AromaticContact CE2-NE1 3.91Å; H89-W94 AromaticContact CD2-NE1 3.95Å; H89-W94 AromaticContact NE2-NE1 3.58Å; L90-W94 HydrophobicContact CD2-CG 4.45Å; L90-W94 CarbonylContact O-C 3.47Å; L90-W94 WeakPolarHBondContact O-CA 3.43Å; L90-W94 WeakPolarHBondContact O-CB 3.48Å; L90-W94 PolarHBondContact O-N 3.25Å; L90-W94 VanDerWaalsContact O-N 3.11Å; W94-M96 HydrophobicContact CB-CB 4.37Å; W94-M96 HydrophobicContact CB-CG 3.88Å; W94-M96 HydrophobicContact CB-SD 4.02Å; W94-M96 PolarHBondContact O-N 3.41Å; W94-M96 VanDerWaalsContact O-N 3.14Å
95	N	91	Very high	83.2	Confident	152 Å²	152	90.1 Å²	90.1	81%	0.813	47%	0.467	S	S	*	.			trans	51.9	32.2	-173.7	-166	56.7	0	0	0	112	L90 E91	L90-N95 PolarHBondContact O-N 3.46Å; E91-N95 WeakPolarHBondContact O-CA 3.33Å; E91-N95 PolarHBondContact O-N 2.91Å
96	M	92.4	Very high	81.3	Confident	91 Å²	91	93.4 Å²	93.4	45%	0.448	48%	0.483	S	S	.	.			trans	-96.9	128	177.5	-69	179.2	76.2	0	0	109.2	F61 L90 E91 W94	F61-M96 HydrophobicContact CZ-SD 4.38Å; L90-M96 CarbonylContact C-O 3.58Å; L90-M96 HydrophobicContact CB-CB 4.37Å; L90-M96 HydrophobicContact CD2-SD 4.41Å; L90-M96 PolarHBondContact O-N 3.06Å; L90-M96 VanDerWaalsContact O-N 3.09Å; E91-M96 WeakPolarHBondContact CA-O 3.12Å; E91-M96 PolarHBondContact N-O 3.36Å; W94-M96 HydrophobicContact CB-CB 4.37Å; W94-M96 HydrophobicContact CB-CG 3.88Å; W94-M96 HydrophobicContact CB-SD 4.02Å; W94-M96 PolarHBondContact O-N 3.41Å; W94-M96 VanDerWaalsContact O-N 3.14Å
97	W	88.2	Confident	79.5	Confident	171 Å²	171	100.7 Å²	100.7	65%	0.648	51%	0.506	S	S	*	.			trans	-114.9	121.3	174.3	-175.4	76.5	0	0	0	109.3	P99	W97-P99 HydrophobicContact CE3-CB 4.47Å; W97-P99 HydrophobicContact CE3-CG 3.98Å; W97-P99 HydrophobicContact CH2-CB 4.13Å; W97-P99 HydrophobicContact CH2-CG 4.46Å; W97-P99 HydrophobicContact CZ3-CB 3.76Å; W97-P99 HydrophobicContact CZ3-CG 3.62Å; W97-P99 WeakPolarHBondContact O-CD 3.4Å
98	I	86.6	Confident	77.9	Confident	70 Å²	70	105.1 Å²	105.1	36%	0.359	54%	0.538	S	S	.	.			trans	-97.9	112.5	-178.1	-54.1	-170.2	0	0	0	109.1	L90 Y101	L90-I98 HydrophobicContact CD1-CD1 3.84Å; I98-Y101 HydrophobicContact CB-CD2 4.46Å; I98-Y101 HydrophobicContact CG2-CD2 3.57Å; I98-Y101 HydrophobicContact CG2-CE2 4.3Å; I98-Y101 HydrophobicContact CG2-CG 4.26Å; I98-Y101 PolarHBondContact O-N 3.39Å; I98-Y101 VanDerWaalsContact O-O 3.11Å
99	P	84.8	Confident	76	Confident	90 Å²	90	110.3 Å²	110.3	58%	0.584	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	141.7	176.9	-18.7	29	0	0	0	111.8	W97 Y101	W97-P99 HydrophobicContact CE3-CB 4.47Å; W97-P99 HydrophobicContact CE3-CG 3.98Å; W97-P99 HydrophobicContact CH2-CB 4.13Å; W97-P99 HydrophobicContact CH2-CG 4.46Å; W97-P99 HydrophobicContact CZ3-CB 3.76Å; W97-P99 HydrophobicContact CZ3-CG 3.62Å; W97-P99 WeakPolarHBondContact O-CD 3.4Å; P99-Y101 PolarHBondContact O-N 3.37Å
100	G	81.4	Confident	74.1	Confident	83 Å²	83	118.4 Å²	118.4	86%	0.856	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	79.9	-7.8	-179.9	0	0	0	0	0	114.7
101	Y	73.1	Confident	72.3	Confident	138 Å²	138	125.9 Å²	125.9	54%	0.541	63%	0.625	S	S	.	*	S	Bend	trans	-113.5	119.4	171.8	-68.8	-91.9	0	0	0	108.8	V83 I98 P99	V83-Y101 HydrophobicContact CG1-CD1 3.89Å; V83-Y101 HydrophobicContact CG1-CE1 4.5Å; I98-Y101 HydrophobicContact CB-CD2 4.46Å; I98-Y101 HydrophobicContact CG2-CD2 3.57Å; I98-Y101 HydrophobicContact CG2-CE2 4.3Å; I98-Y101 HydrophobicContact CG2-CG 4.26Å; I98-Y101 PolarHBondContact O-N 3.39Å; I98-Y101 VanDerWaalsContact O-O 3.11Å; P99-Y101 PolarHBondContact O-N 3.37Å
102	G	63.1	Low	70.9	Confident	42 Å²	42	127.7 Å²	127.7	43%	0.433	65%	0.648	S	S	.	*			trans	92.5	85.3	178.9	0	0	0	0	0	114.9
103	S	54.6	Low	69.5	Low	113 Å²	113	124.9 Å²	124.9	79%	0.79	66%	0.655	S	S	*	*			trans	-110.8	6.7	166.6	68.2	0	0	0	0	114.1
104	D	56.2	Low	68.3	Low	132 Å²	132	121.4 Å²	121.4	71%	0.706	64%	0.643	S	S	*	*	S	Bend	trans	-135.2	118	179.6	-83.9	-43.3	0	0	0	114
105	E	51.6	Low	67.8	Low	168 Å²	168	120.1 Å²	120.1	79%	0.785	65%	0.648	S	S	*	*			trans	84.5	12.4	147.7	-66.2	-157.8	130.8	0	0	122.9	R107	E105-R107 PolarHBondContact O-N 2.91Å
106	I	53.3	Low	67.5	Low	76 Å²	76	118.5 Å²	118.5	39%	0.39	64%	0.636	S	S	.	*			trans	-86.8	71.1	155.4	-57.8	164.2	0	0	0	107.7	L88 P108	L88-I106 HydrophobicContact CD1-CD1 3.6Å; L88-I106 HydrophobicContact CD1-CG1 4.47Å; I106-P108 WeakPolarHBondContact O-CD 3.41Å
107	R	56.9	Low	67.1	Low	195 Å²	195	117.3 Å²	117.3	74%	0.736	64%	0.64	S	S	*	*			trans	-66	113.6	160.5	-121.2	-179.1	-70.9	-138.7	-1.7	105.4	E105 F109	E105-R107 PolarHBondContact O-N 2.91Å; R107-F109 PolarHBondContact O-N 2.89Å
108	P	58.8	Low	67	Low	123 Å²	123	112.9 Å²	112.9	80%	0.799	63%	0.627	S	S	*	*	S	Bend	trans	-62.3	-10.8	179.7	-20.1	33.8	0	0	0	112.4	I106	I106-P108 WeakPolarHBondContact O-CD 3.41Å
109	F	49.8	Very low	67.1	Low	151 Å²	151	114.1 Å²	114.1	66%	0.662	63%	0.629	S	S	*	*			trans	-133.6	73.9	-168.8	-127	-103.4	0	0	0	111.5	R107 K111	R107-F109 PolarHBondContact O-N 2.89Å; F109-K111 HydrophobicContact CD1-CG 3.57Å; F109-K111 HydrophobicContact CE1-CD 4.37Å; F109-K111 HydrophobicContact CE1-CG 3.52Å; F109-K111 PolarHBondContact O-N 3.43Å
110	K	53.4	Low	67.3	Low	199 Å²	199	115.9 Å²	115.9	87%	0.865	63%	0.63	S	S	*	*			trans	-75.6	106.3	136.5	-85.6	-172.6	170.1	177.4	0	104.9	A112	K110-A112 PolarHBondContact O-N 3.08Å
111	K	55.8	Low	67.6	Low	171 Å²	171	119.3 Å²	119.3	74%	0.743	62%	0.617	S	S	*	*			trans	-46.7	118.1	167.4	-75.3	-174.6	179.7	179	0	106	F109 C113	F109-K111 HydrophobicContact CD1-CG 3.57Å; F109-K111 HydrophobicContact CE1-CD 4.37Å; F109-K111 HydrophobicContact CE1-CG 3.52Å; F109-K111 PolarHBondContact O-N 3.43Å; K111-C113 PolarHBondContact O-N 2.96Å; K111-C113 VanDerWaalsContact O-N 3.08Å
112	A	61.4	Low	68.4	Low	85 Å²	85	115.6 Å²	115.6	70%	0.702	61%	0.605	S	S	*	*			trans	-47.1	126.4	173.7	0	0	0	0	0	106.5	K110 T114	K110-A112 PolarHBondContact O-N 3.08Å; A112-T114 PolarHBondContact O-N 3.06Å
113	C	60.1	Low	69.5	Low	118 Å²	118	115.8 Å²	115.8	80%	0.797	60%	0.602	S	S	*	*			trans	-55.5	111.1	175	-174.2	0	0	0	0	105.6	K111 T115	K111-C113 PolarHBondContact O-N 2.96Å; K111-C113 VanDerWaalsContact O-N 3.08Å; C113-T115 PolarHBondContact O-N 2.85Å
114	T	67.5	Low	71.1	Confident	65 Å²	65	115.9 Å²	115.9	40%	0.399	59%	0.594	S	S	.	*			trans	-63.4	119	-177.4	42.7	0	0	0	0	106.5	A112 K119	A112-T114 PolarHBondContact O-N 3.06Å; T114-K119 WeakPolarHBondContact O-CE 3.45Å; T114-K119 WeakPolarHBondContact OG1-CE 3.4Å
115	T	84	Confident	72.6	Confident	90 Å²	90	112.8 Å²	112.8	55%	0.552	58%	0.576	S	S	*	*			trans	-58.7	147.5	178.5	60.6	0	0	0	0	108.8	C113 A117 H118 K119	C113-T115 PolarHBondContact O-N 2.85Å; T115-A117 PolarHBondContact O-N 2.72Å; T115-A117 VanDerWaalsContact O-N 3.15Å; T115-H118 WeakPolarHBondContact O-CA 3.18Å; T115-H118 WeakPolarHBondContact O-CB 3.33Å; T115-H118 PolarHBondContact O-N 3.23Å; T115-H118 WeakPolarHBondContact OG1-CB 3.49Å; T115-H118 PolarHBondContact OG1-N 3.15Å; T115-K119 PolarHBondContact O-N 2.66Å
116	E	84.1	Confident	74.2	Confident	118 Å²	118	113.5 Å²	113.5	55%	0.551	57%	0.572	S	S	*	*	H	α-helix	trans	-53.5	-37.1	177.1	-72.3	-63.6	115.5	0	0	111.2	H118 K119 Q120	E116-H118 PolarHBondContact O-N 2.87Å; E116-K119 PolarHBondContact O-N 3.05Å; E116-K119 WeakPolarHBondContact OE1-CD 3.41Å; E116-K119 IonicContact OE1-NZ 3.39Å; E116-K119 PolarHBondContact OE1-NZ 2.95Å; E116-Q120 VanDerWaalsContact O-CG 3.31Å; E116-Q120 WeakPolarHBondContact O-CG 3.32Å; E116-Q120 PolarHBondContact O-N 3.47Å
117	A	85.1	Confident	75.7	Confident	66 Å²	66	117.6 Å²	117.6	55%	0.545	59%	0.587	S	S	.	*	H	α-helix	trans	-59.7	-42.6	172.4	0	0	0	0	0	113.2	T115 Q120 R121	T115-A117 PolarHBondContact O-N 2.72Å; T115-A117 VanDerWaalsContact O-N 3.15Å; A117-Q120 PolarHBondContact O-N 3.26Å; A117-R121 WeakPolarHBondContact O-CB 3.29Å; A117-R121 PolarHBondContact O-N 3.22Å
118	H	85.9	Confident	76.8	Confident	78 Å²	78	113 Å²	113	36%	0.361	58%	0.58	S	S	.	*	H	α-helix	trans	-65.9	-40	176.5	-175.1	78.7	0	0	0	111.7	T115 E116 R121 M122	T115-H118 WeakPolarHBondContact O-CA 3.18Å; T115-H118 WeakPolarHBondContact O-CB 3.33Å; T115-H118 PolarHBondContact O-N 3.23Å; T115-H118 WeakPolarHBondContact OG1-CB 3.49Å; T115-H118 PolarHBondContact OG1-N 3.15Å; E116-H118 PolarHBondContact O-N 2.87Å; H118-R121 PolarHBondContact O-N 3.41Å; H118-M122 VanDerWaalsContact O-CG 3.32Å; H118-M122 WeakPolarHBondContact O-CG 3.31Å; H118-M122 PolarHBondContact O-N 3.38Å
119	K	88.8	Confident	77.4	Confident	96 Å²	96	112 Å²	112	42%	0.417	57%	0.573	S	S	.	*	H	α-helix	trans	-62.5	-44.9	175.6	-64.3	178.5	-170.7	165	0	111.7	T114 T115 E116 M122 A123	T114-K119 WeakPolarHBondContact O-CE 3.45Å; T114-K119 WeakPolarHBondContact OG1-CE 3.4Å; T115-K119 PolarHBondContact O-N 2.66Å; E116-K119 PolarHBondContact O-N 3.05Å; E116-K119 WeakPolarHBondContact OE1-CD 3.41Å; E116-K119 IonicContact OE1-NZ 3.39Å; E116-K119 PolarHBondContact OE1-NZ 2.95Å; K119-M122 PolarHBondContact O-N 3.46Å; K119-A123 WeakPolarHBondContact O-CB 3.37Å; K119-A123 PolarHBondContact O-N 3.32Å
120	Q	88.8	Confident	78	Confident	126 Å²	126	114 Å²	114	59%	0.589	58%	0.581	S	S	*	*	H	α-helix	trans	-61.9	-44.5	176.8	-71.2	173.2	5.2	0	0	111.8	E116 A117 M122 A123 L124	E116-Q120 VanDerWaalsContact O-CG 3.31Å; E116-Q120 WeakPolarHBondContact O-CG 3.32Å; E116-Q120 PolarHBondContact O-N 3.47Å; A117-Q120 PolarHBondContact O-N 3.26Å; Q120-M122 PolarHBondContact O-N 3.44Å; Q120-A123 PolarHBondContact O-N 3.03Å; Q120-L124 PolarHBondContact O-N 2.93Å
121	R	88.3	Confident	77.9	Confident	156 Å²	156	116.6 Å²	116.6	59%	0.589	59%	0.592	S	S	*	*	H	α-helix	trans	-59	-47.2	174.5	-176.5	-178.7	176.7	-131.1	-0.8	111.7	A117 H118 A123 L124 I125	A117-R121 WeakPolarHBondContact O-CB 3.29Å; A117-R121 PolarHBondContact O-N 3.22Å; H118-R121 PolarHBondContact O-N 3.41Å; R121-A123 VanDerWaalsContact C-N 3.3Å; R121-A123 PolarHBondContact O-N 2.95Å; R121-L124 PolarHBondContact O-N 3.4Å; R121-I125 HydrophobicContact CG-CD1 4.02Å; R121-I125 WeakPolarHBondContact O-CG1 3.47Å; R121-I125 PolarHBondContact O-N 2.98Å
122	M	89.4	Confident	79	Confident	59 Å²	59	113.9 Å²	113.9	29%	0.291	58%	0.584	S	S	.	*	H	α-helix	trans	-62.1	-37.2	177.3	-71.7	-61.1	108	0	0	112.1	H118 K119 Q120 I125 R126	H118-M122 VanDerWaalsContact O-CG 3.32Å; H118-M122 WeakPolarHBondContact O-CG 3.31Å; H118-M122 PolarHBondContact O-N 3.38Å; K119-M122 PolarHBondContact O-N 3.46Å; Q120-M122 PolarHBondContact O-N 3.44Å; M122-I125 HydrophobicContact CE-CD1 3.64Å; M122-R126 VanDerWaalsContact O-CG 3.29Å; M122-R126 WeakPolarHBondContact O-CG 3.48Å; M122-R126 PolarHBondContact O-N 3.3Å
123	A	86.7	Confident	79.9	Confident	46 Å²	46	115.4 Å²	115.4	38%	0.38	58%	0.578	S	S	.	*	H	α-helix	trans	-66.5	-40.9	176.4	0	0	0	0	0	112.5	K119 Q120 R121 R126 K127	K119-A123 WeakPolarHBondContact O-CB 3.37Å; K119-A123 PolarHBondContact O-N 3.32Å; Q120-A123 PolarHBondContact O-N 3.03Å; R121-A123 VanDerWaalsContact C-N 3.3Å; R121-A123 PolarHBondContact O-N 2.95Å; A123-R126 PolarHBondContact O-N 3.13Å; A123-K127 WeakPolarHBondContact O-CG 3.47Å; A123-K127 PolarHBondContact O-N 3.41Å; A123-K127 VanDerWaalsContact O-N 3.13Å
124	L	87.6	Confident	81	Confident	116 Å²	116	115.2 Å²	115.2	61%	0.607	57%	0.566	S	S	*	*	H	α-helix	trans	-62.7	-47.1	174.5	-76	163.6	0	0	0	111.4	Q120 R121 R126 K127 T128	Q120-L124 PolarHBondContact O-N 2.93Å; R121-L124 PolarHBondContact O-N 3.4Å; L124-R126 VanDerWaalsContact C-N 3.33Å; L124-R126 PolarHBondContact O-N 3.09Å; L124-K127 WeakPolarHBondContact O-CB 3.42Å; L124-K127 PolarHBondContact O-N 3.03Å; L124-K127 VanDerWaalsContact O-N 3.09Å; L124-T128 PolarHBondContact O-N 3.04Å; L124-T128 PolarHBondContact O-OG1 3.48Å
125	I	87.8	Confident	81.8	Confident	67 Å²	67	118.2 Å²	118.2	34%	0.344	58%	0.576	S	S	.	*	H	α-helix	trans	-59.2	-43	177.8	-68.2	167.3	0	0	0	111.4	R121 M122 K127 T128 T129	R121-I125 HydrophobicContact CG-CD1 4.02Å; R121-I125 WeakPolarHBondContact O-CG1 3.47Å; R121-I125 PolarHBondContact O-N 2.98Å; M122-I125 HydrophobicContact CE-CD1 3.64Å; I125-K127 VanDerWaalsContact C-N 3.29Å; I125-K127 PolarHBondContact O-N 3.27Å; I125-T128 WeakPolarHBondContact CA-OG1 3.43Å; I125-T128 PolarHBondContact O-N 2.9Å; I125-T128 PolarHBondContact O-OG1 3.03Å; I125-T129 PolarHBondContact O-N 2.98Å; I125-T129 PolarHBondContact O-OG1 3.29Å
126	R	85.8	Confident	81.7	Confident	183 Å²	183	119.9 Å²	119.9	69%	0.691	58%	0.577	S	S	*	*	H	α-helix	trans	-64.1	-31.9	176.6	-74.2	173.6	-177.8	178.8	0.7	113.1	M122 A123 L124	M122-R126 VanDerWaalsContact O-CG 3.29Å; M122-R126 WeakPolarHBondContact O-CG 3.48Å; M122-R126 PolarHBondContact O-N 3.3Å; A123-R126 PolarHBondContact O-N 3.13Å; L124-R126 VanDerWaalsContact C-N 3.33Å; L124-R126 PolarHBondContact O-N 3.09Å
127	K	84.5	Confident	81.5	Confident	161 Å²	161	120.1 Å²	120.1	70%	0.7	58%	0.579	S	S	*	*	H	α-helix	trans	-73.3	-35.8	175.9	-75.9	179.9	177.3	-176.5	0	111.6	A123 L124 I125	A123-K127 WeakPolarHBondContact O-CG 3.47Å; A123-K127 PolarHBondContact O-N 3.41Å; A123-K127 VanDerWaalsContact O-N 3.13Å; L124-K127 WeakPolarHBondContact O-CB 3.42Å; L124-K127 PolarHBondContact O-N 3.03Å; L124-K127 VanDerWaalsContact O-N 3.09Å; I125-K127 VanDerWaalsContact C-N 3.29Å; I125-K127 PolarHBondContact O-N 3.27Å
128	T	78.9	Confident	81.3	Confident	98 Å²	98	123.9 Å²	123.9	60%	0.601	58%	0.582	S	S	*	*	H	α-helix	trans	-79.2	-27.1	-179.5	53.3	0	0	0	0	113.6	L124 I125 K130	L124-T128 PolarHBondContact O-N 3.04Å; L124-T128 PolarHBondContact O-OG1 3.48Å; I125-T128 WeakPolarHBondContact CA-OG1 3.43Å; I125-T128 PolarHBondContact O-N 2.9Å; I125-T128 PolarHBondContact O-OG1 3.03Å; T128-K130 VanDerWaalsContact C-N 3.34Å
129	T	71.8	Confident	80.9	Confident	104 Å²	104	127.5 Å²	127.5	64%	0.638	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-4	176.7	36.2	0	0	0	0	114.3	I125	I125-T129 PolarHBondContact O-N 2.98Å; I125-T129 PolarHBondContact O-OG1 3.29Å
130	K	62.8	Low	80.2	Confident	192 Å²	192	130.1 Å²	130.1	84%	0.835	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97	9	175.2	-91.1	-171.6	172.8	-171.5	0	114	T128	T128-K130 VanDerWaalsContact C-N 3.34Å
131	K	50.6	Low	79.5	Confident	253 Å²	253	130.5 Å²	130.5	100%	1.1	62%	0.616	S	S	*	*			trans	-102	0	166.9	-91.8	-174.7	171.6	-176.5	0	108.6

Retrieved 131 of 131 residues in 42.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).