A0A087Y9E4_POEFO Loading...

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087Y9E4, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 96 aa.

						>A0A087Y9E4_POEFO|A0A087Y9E4
FAFSMGGDHGHSKMSMPDWRQWKVEGTPLEFTQQRLAARGLKDPWARNEAWRYSGGFARAVTLSEVLFRGFKWGFAAFTVALAIEYTMFPPKKGGH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	33.3	Very low	47.8	Very low	270 Å²	270	144.5 Å²	144.5	100%	1.184	84%	0.843	S	S	*	*				0	98.8	0	-73.4	-88.1	0	0	0	108.6
2	A	39.3	Very low	49.5	Very low	107 Å²	107	142.1 Å²	142.1	88%	0.884	84%	0.84	S	S	*	*			trans	-110.7	111.9	171.2	0	0	0	0	0	107.1	S4	A2-S4 PolarHBondContact O-N 3.4Å
3	F	42.2	Very low	51.5	Low	195 Å²	195	146.9 Å²	146.9	86%	0.855	84%	0.844	S	S	*	*			trans	-73.7	112.4	175.7	-134.8	-96.1	0	0	0	107.2	M5	F3-M5 HydrophobicContact CD1-CG 4.43Å; F3-M5 PolarHBondContact O-N 3.35Å; F3-M5 VanDerWaalsContact O-N 3.1Å
4	S	40.7	Very low	53.4	Low	119 Å²	119	149.5 Å²	149.5	83%	0.832	85%	0.848	S	S	*	*			trans	-69.6	101.7	167	-178	0	0	0	0	107.2	A2	A2-S4 PolarHBondContact O-N 3.4Å
5	M	51.6	Low	55.4	Low	172 Å²	172	146.7 Å²	146.7	85%	0.847	84%	0.842	S	S	*	*			trans	-87.5	126	170.9	-81.9	-170.6	159.3	0	0	109.3	F3	F3-M5 HydrophobicContact CD1-CG 4.43Å; F3-M5 PolarHBondContact O-N 3.35Å; F3-M5 VanDerWaalsContact O-N 3.1Å
6	G	45.6	Very low	57.2	Low	72 Å²	72	148.4 Å²	148.4	74%	0.742	84%	0.843	S	S	*	*			trans	109.8	74	158.9	0	0	0	0	0	114.8	D8	G6-D8 PolarHBondContact O-N 3.19Å
7	G	51.3	Low	58.9	Low	62 Å²	62	143.5 Å²	143.5	64%	0.639	82%	0.818	S	S	*	*			trans	-65.3	120.6	165.1	0	0	0	0	0	111.1	H9	G7-H9 PolarHBondContact O-N 3.24Å; G7-H9 PolarHBondContact O-ND1 3.1Å
8	D	48.2	Very low	60.7	Low	170 Å²	170	140.4 Å²	140.4	91%	0.909	80%	0.799	S	S	*	*			trans	-42.1	114.7	168.2	-118.9	-51.8	0	0	0	111.1	G6 G10	G6-D8 PolarHBondContact O-N 3.19Å; D8-G10 PolarHBondContact O-N 3.28Å
9	H	55.3	Low	62	Low	170 Å²	170	140.6 Å²	140.6	79%	0.787	79%	0.786	S	S	*	*			trans	-77.9	88.4	175.3	-78	39.3	0	0	0	109.5	G7 H11	G7-H9 PolarHBondContact O-N 3.24Å; G7-H9 PolarHBondContact O-ND1 3.1Å; H9-H11 PolarHBondContact O-N 3.08Å
10	G	56.5	Low	63.4	Low	75 Å²	75	142 Å²	142	77%	0.773	78%	0.778	S	S	*	*	S	Bend	trans	33.2	16.9	136.7	0	0	0	0	0	123.3	D8	D8-G10 PolarHBondContact O-N 3.28Å
11	H	62.3	Low	64.7	Low	177 Å²	177	139.7 Å²	139.7	82%	0.819	76%	0.762	S	S	*	*			trans	-116.8	99.9	169.1	-68.7	-64.8	0	0	0	108.4	H9 K13	H9-H11 PolarHBondContact O-N 3.08Å; H11-K13 PolarHBondContact O-N 3.27Å
12	S	68.2	Low	67.4	Low	116 Å²	116	130.4 Å²	130.4	81%	0.811	72%	0.719	S	S	*	*			trans	-41.8	128.9	168.8	50.8	0	0	0	0	110.2	M14	S12-M14 PolarHBondContact O-N 3.41Å
13	K	75.5	Confident	69.8	Low	205 Å²	205	131.3 Å²	131.3	89%	0.891	70%	0.703	S	S	*	*			trans	-48.8	114.3	-179.4	-169.7	177	-174.7	177.7	0	109.7	H11 S15	H11-K13 PolarHBondContact O-N 3.27Å; K13-S15 PolarHBondContact O-N 3.35Å; K13-S15 VanDerWaalsContact O-N 3.08Å
14	M	78	Confident	72.1	Confident	183 Å²	183	123 Å²	123	90%	0.901	67%	0.668	S	S	*	*			trans	-59.5	115.8	-179.2	-142.2	-179.3	-71.7	0	0	108.4	S12 M16	S12-M14 PolarHBondContact O-N 3.41Å; M14-M16 PolarHBondContact O-N 3.1Å
15	S	83.4	Confident	74.3	Confident	108 Å²	108	124.2 Å²	124.2	76%	0.755	66%	0.661	S	S	*	*	P	Polyproline II helix	trans	-73.5	123	176.6	60.9	0	0	0	0	108.7	K13	K13-S15 PolarHBondContact O-N 3.35Å; K13-S15 VanDerWaalsContact O-N 3.08Å
16	M	84.3	Confident	75.9	Confident	173 Å²	173	119.6 Å²	119.6	85%	0.852	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-59.9	130.4	173.4	-166.9	68.9	68.4	0	0	109	M14	M14-M16 PolarHBondContact O-N 3.1Å
17	P	86.4	Confident	78.1	Confident	65 Å²	65	116.8 Å²	116.8	42%	0.422	63%	0.626	S	S	.	*	P	Polyproline II helix	trans	-66.7	158.2	176.4	29.7	-35.8	0	0	0	111	W19 W22	P17-W19 PolarHBondContact O-N 3.27Å; P17-W22 HydrophobicContact CG-CZ2 4.41Å
18	D	90.2	Very high	79.9	Confident	89 Å²	89	118 Å²	118	48%	0.476	62%	0.622	S	S	.	*	P	Polyproline II helix	trans	-59.7	127.3	-178.4	-175.2	2.2	0	0	0	110.5	R20 Q21	D18-R20 PolarHBondContact O-N 3.4Å; D18-R20 PolarHBondContact OD1-N 3.4Å; D18-R20 VanDerWaalsContact OD1-N 3.1Å; D18-Q21 WeakPolarHBondContact O-CG 3.11Å; D18-Q21 PolarHBondContact O-N 3.07Å
19	W	86.4	Confident	82	Confident	144 Å²	144	110.7 Å²	110.7	55%	0.545	58%	0.583	S	S	.	*	G	3₁₀ helix	trans	-62.9	-24	-179.5	65	-90.1	0	0	0	112.8	P17 Q21	P17-W19 PolarHBondContact O-N 3.27Å; W19-Q21 PolarHBondContact O-N 2.88Å
20	R	89.4	Confident	83.8	Confident	167 Å²	167	106 Å²	106	63%	0.63	56%	0.562	S	S	*	*	G	3₁₀ helix	trans	-70.8	-16.8	-179.2	-64.9	179.3	175.4	-176.5	0.5	113.6	D18 W22	D18-R20 PolarHBondContact O-N 3.4Å; D18-R20 PolarHBondContact OD1-N 3.4Å; D18-R20 VanDerWaalsContact OD1-N 3.1Å; R20-W22 PolarHBondContact O-N 2.85Å
21	Q	90.4	Very high	85.5	Confident	95 Å²	95	107.7 Å²	107.7	44%	0.444	55%	0.548	S	S	.	.	G	3₁₀ helix	trans	-70.8	-22.5	-179	81.5	-169.8	5.3	0	0	112.6	D18 W19 K23	D18-Q21 WeakPolarHBondContact O-CG 3.11Å; D18-Q21 PolarHBondContact O-N 3.07Å; W19-Q21 PolarHBondContact O-N 2.88Å; Q21-K23 PolarHBondContact O-N 3.01Å
22	W	89.9	Confident	87	Confident	74 Å²	74	102.3 Å²	102.3	28%	0.28	53%	0.527	S	S	.	.			trans	-82.2	105.4	-178.4	-53.1	122.3	0	0	0	110.4	P17 R20 R47 W51	P17-W22 HydrophobicContact CG-CZ2 4.41Å; R20-W22 PolarHBondContact O-N 2.85Å; W22-R47 VanDerWaalsContact O-CG 3.28Å; W22-R47 WeakPolarHBondContact O-CG 3.32Å; W22-W51 HydrophobicContact CD2-CB 3.53Å; W22-W51 HydrophobicContact CE3-CB 3.59Å; W22-W51 HydrophobicContact CG-CB 4.15Å; W22-W51 HydrophobicContact CH2-CB 3.89Å; W22-W51 HydrophobicContact CZ2-CB 3.83Å; W22-W51 HydrophobicContact CZ3-CB 3.78Å
23	K	91	Very high	88.2	Confident	126 Å²	126	100.4 Å²	100.4	55%	0.548	51%	0.506	S	S	.	.			trans	-113.5	147	177.2	-61.9	-176	-179.3	-175.9	0	110.3	Q21 A50	Q21-K23 PolarHBondContact O-N 3.01Å; K23-A50 WeakPolarHBondContact O-CB 3.28Å
24	V	89.5	Confident	89.1	Confident	21 Å²	21	95.8 Å²	95.8	13%	0.127	49%	0.487	C	S	.	.	S	Bend	trans	-78.7	-27.8	178.1	-179.8	0	0	0	0	111.2	G26 T27 L29 E30 A46 R47 A50	V24-G26 PolarHBondContact O-N 3.02Å; V24-T27 WeakPolarHBondContact O-CB 3.48Å; V24-T27 PolarHBondContact O-N 2.68Å; V24-T27 VanDerWaalsContact O-N 3.13Å; V24-T27 PolarHBondContact O-OG1 2.85Å; V24-L29 HydrophobicContact CG1-CB 3.87Å; V24-E30 HydrophobicContact CG1-CB 4.41Å; V24-A46 HydrophobicContact CG1-CB 4.44Å; V24-A46 HydrophobicContact CG2-CB 3.92Å; V24-R47 HydrophobicContact CG2-CB 4.33Å; V24-A50 HydrophobicContact CG2-CB 4.47Å
25	E	87	Confident	89.9	Confident	144 Å²	144	94.3 Å²	94.3	67%	0.673	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.7	131.2	178	-64.5	161.3	-169.2	0	0	111.7	T27	E25-T27 PolarHBondContact O-N 3.36Å
26	G	85.9	Confident	90.4	Very high	75 Å²	75	91.2 Å²	91.2	77%	0.773	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.9	0.5	179.5	0	0	0	0	0	114.9	V24 E30	V24-G26 PolarHBondContact O-N 3.02Å; G26-E30 PolarHBondContact N-OE2 3.34Å
27	T	90.7	Very high	90.9	Very high	13 Å²	13	86 Å²	86	8%	0.08	43%	0.431	C	S	.	.	S	Bend	trans	-98.9	160.2	171.9	73.9	0	0	0	0	111	V24 E25 L29 E30	V24-T27 WeakPolarHBondContact O-CB 3.48Å; V24-T27 PolarHBondContact O-N 2.68Å; V24-T27 VanDerWaalsContact O-N 3.13Å; V24-T27 PolarHBondContact O-OG1 2.85Å; E25-T27 PolarHBondContact O-N 3.36Å; T27-L29 PolarHBondContact O-N 2.97Å; T27-L29 WeakPolarHBondContact OG1-CB 3.41Å; T27-L29 PolarHBondContact OG1-N 3.31Å; T27-E30 WeakPolarHBondContact O-CB 3.35Å; T27-E30 PolarHBondContact O-N 3.21Å
28	P	89.9	Confident	91.4	Very high	87 Å²	87	87.2 Å²	87.2	57%	0.565	45%	0.447	S	S	*	.	H	α-helix	trans	-57.5	-20.9	173.5	-25.3	35.3	0	0	0	114.2	E30 F31 T32 Y53	P28-E30 VanDerWaalsContact C-N 3.25Å; P28-E30 PolarHBondContact O-N 2.93Å; P28-F31 PolarHBondContact O-N 2.86Å; P28-T32 PolarHBondContact O-N 3.13Å; P28-Y53 HydrophobicContact CG-CD1 4.48Å
29	L	92.1	Very high	91.7	Very high	17 Å²	17	92.5 Å²	92.5	9%	0.089	46%	0.46	C	S	.	.	H	α-helix	trans	-68	-24.9	177.8	-65.6	174.7	0	0	0	112.6	V24 T27 F31 T32 Q33 A46 E49 Y53	V24-L29 HydrophobicContact CG1-CB 3.87Å; T27-L29 PolarHBondContact O-N 2.97Å; T27-L29 WeakPolarHBondContact OG1-CB 3.41Å; T27-L29 PolarHBondContact OG1-N 3.31Å; L29-F31 VanDerWaalsContact C-N 3.27Å; L29-F31 PolarHBondContact O-N 2.96Å; L29-T32 WeakPolarHBondContact O-CB 3.48Å; L29-T32 PolarHBondContact O-N 3.47Å; L29-Q33 WeakPolarHBondContact O-CB 3.35Å; L29-Q33 PolarHBondContact O-N 3.24Å; L29-A46 VanDerWaalsContact CD1-O 3.3Å; L29-A46 WeakPolarHBondContact CD1-O 3.39Å; L29-E49 HydrophobicContact CD1-CB 3.71Å; L29-Y53 HydrophobicContact CD1-CD2 3.87Å; L29-Y53 HydrophobicContact CD1-CE2 4.06Å; L29-Y53 HydrophobicContact CD2-CE2 4.11Å; L29-Y53 HydrophobicContact CG-CD2 3.9Å; L29-Y53 HydrophobicContact CG-CE2 3.94Å
30	E	92.8	Very high	92.1	Very high	73 Å²	73	89.1 Å²	89.1	34%	0.341	47%	0.469	S	S	.	.	H	α-helix	trans	-59	-42.3	174.5	-173.2	177.8	169.8	0	0	111	V24 G26 T27 P28 Q33 Q34	V24-E30 HydrophobicContact CG1-CB 4.41Å; G26-E30 PolarHBondContact N-OE2 3.34Å; T27-E30 WeakPolarHBondContact O-CB 3.35Å; T27-E30 PolarHBondContact O-N 3.21Å; P28-E30 VanDerWaalsContact C-N 3.25Å; P28-E30 PolarHBondContact O-N 2.93Å; E30-Q33 WeakPolarHBondContact O-CB 3.3Å; E30-Q33 PolarHBondContact O-N 3.43Å; E30-Q34 WeakPolarHBondContact O-CG 3.4Å; E30-Q34 PolarHBondContact O-N 3.48Å
31	F	92.8	Very high	92.4	Very high	110 Å²	110	86 Å²	86	48%	0.482	47%	0.465	S	S	.	.	H	α-helix	trans	-68.5	-37.6	178.2	-173.1	-118.2	0	0	0	112.4	P28 L29 Q33 Q34 R35	P28-F31 PolarHBondContact O-N 2.86Å; L29-F31 VanDerWaalsContact C-N 3.27Å; L29-F31 PolarHBondContact O-N 2.96Å; F31-Q33 VanDerWaalsContact C-N 3.34Å; F31-Q34 PolarHBondContact O-N 3.18Å; F31-R35 VanDerWaalsContact CZ-NE 3.34Å; F31-R35 VanDerWaalsContact CZ-NH2 3.32Å; F31-R35 WeakPolarHBondContact O-CG 3.39Å; F31-R35 PolarHBondContact O-N 3.25Å
32	T	92.4	Very high	92.6	Very high	63 Å²	63	90 Å²	90	39%	0.387	48%	0.481	S	S	.	.	H	α-helix	trans	-62.4	-42.8	171.7	-58.1	0	0	0	0	111	P28 L29 R35 L36	P28-T32 PolarHBondContact O-N 3.13Å; L29-T32 WeakPolarHBondContact O-CB 3.48Å; L29-T32 PolarHBondContact O-N 3.47Å; T32-R35 PolarHBondContact O-N 2.89Å; T32-L36 HydrophobicContact CG2-CD1 4.21Å; T32-L36 WeakPolarHBondContact O-CG 3.46Å; T32-L36 PolarHBondContact O-N 3.35Å
33	Q	93.8	Very high	92.7	Very high	76 Å²	76	88.7 Å²	88.7	36%	0.355	48%	0.479	S	S	.	.	H	α-helix	trans	-63.1	-42.6	177.5	-174.1	176.9	-16.7	0	0	111.7	L29 E30 F31 R35 L36 A37	L29-Q33 WeakPolarHBondContact O-CB 3.35Å; L29-Q33 PolarHBondContact O-N 3.24Å; E30-Q33 WeakPolarHBondContact O-CB 3.3Å; E30-Q33 PolarHBondContact O-N 3.43Å; F31-Q33 VanDerWaalsContact C-N 3.34Å; Q33-R35 PolarHBondContact O-N 2.9Å; Q33-L36 PolarHBondContact O-N 3.11Å; Q33-A37 VanDerWaalsContact O-CB 3.3Å; Q33-A37 WeakPolarHBondContact O-CB 3.38Å; Q33-A37 PolarHBondContact O-N 3.35Å
34	Q	94.2	Very high	92.8	Very high	109 Å²	109	87.8 Å²	87.8	51%	0.509	49%	0.486	S	S	.	.	H	α-helix	trans	-60.8	-42.9	174.6	-71.2	172.3	5.9	0	0	111.9	E30 F31 A37 A38	E30-Q34 WeakPolarHBondContact O-CG 3.4Å; E30-Q34 PolarHBondContact O-N 3.48Å; F31-Q34 PolarHBondContact O-N 3.18Å; Q34-A37 PolarHBondContact O-N 2.66Å; Q34-A38 PolarHBondContact O-N 2.86Å
35	R	94.9	Very high	93	Very high	152 Å²	152	94.6 Å²	94.6	57%	0.574	51%	0.51	S	S	*	.	H	α-helix	trans	-65.3	-37.8	177.2	-74.6	171.8	166.8	-166	-6.5	113.1	F31 T32 Q33	F31-R35 VanDerWaalsContact CZ-NE 3.34Å; F31-R35 VanDerWaalsContact CZ-NH2 3.32Å; F31-R35 WeakPolarHBondContact O-CG 3.39Å; F31-R35 PolarHBondContact O-N 3.25Å; T32-R35 PolarHBondContact O-N 2.89Å; Q33-R35 PolarHBondContact O-N 2.9Å
36	L	95.4	Very high	93.2	Very high	43 Å²	43	88 Å²	88	23%	0.225	48%	0.48	C	S	.	.	H	α-helix	trans	-69.6	-43.2	174.6	-71.9	172.8	0	0	0	110.9	T32 Q33 A38 R39 G40 L41 D43	T32-L36 HydrophobicContact CG2-CD1 4.21Å; T32-L36 WeakPolarHBondContact O-CG 3.46Å; T32-L36 PolarHBondContact O-N 3.35Å; Q33-L36 PolarHBondContact O-N 3.11Å; L36-A38 VanDerWaalsContact C-N 3.28Å; L36-A38 PolarHBondContact O-N 2.89Å; L36-R39 CarbonylContact O-C 3.39Å; L36-R39 WeakPolarHBondContact O-CA 3.5Å; L36-R39 WeakPolarHBondContact O-CB 3.49Å; L36-R39 PolarHBondContact O-N 3.22Å; L36-G40 PolarHBondContact O-N 3.05Å; L36-L41 CarbonylContact C-O 3.49Å; L36-L41 HydrophobicContact CB-CB 4.14Å; L36-L41 HydrophobicContact CD2-CB 4.16Å; L36-L41 HydrophobicContact CD2-CD2 4.44Å; L36-L41 PolarHBondContact O-N 2.72Å; L36-L41 VanDerWaalsContact O-O 3.13Å; L36-D43 HydrophobicContact CD1-CB 3.71Å
37	A	94.8	Very high	93.5	Very high	63 Å²	63	91.3 Å²	91.3	52%	0.521	47%	0.469	S	S	.	.	H	α-helix	trans	-60.8	-38.3	177.9	0	0	0	0	0	111.9	Q33 Q34 R39 G40 L41	Q33-A37 VanDerWaalsContact O-CB 3.3Å; Q33-A37 WeakPolarHBondContact O-CB 3.38Å; Q33-A37 PolarHBondContact O-N 3.35Å; Q34-A37 PolarHBondContact O-N 2.66Å; A37-R39 PolarHBondContact O-N 3.4Å; A37-R39 VanDerWaalsContact O-N 3.11Å; A37-G40 PolarHBondContact O-N 3.22Å; A37-L41 WeakPolarHBondContact CA-O 3.42Å; A37-L41 PolarHBondContact N-O 3.39Å
38	A	95.9	Very high	93.6	Very high	91 Å²	91	95 Å²	95	75%	0.752	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60	-20.2	173	0	0	0	0	0	113.5	Q34 L36	Q34-A38 PolarHBondContact O-N 2.86Å; L36-A38 VanDerWaalsContact C-N 3.28Å; L36-A38 PolarHBondContact O-N 2.89Å
39	R	96.1	Very high	93.6	Very high	200 Å²	200	93.9 Å²	93.9	76%	0.755	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.3	3.7	175.2	-59.7	176.4	-177.1	-168.8	-1.2	112.8	L36 A37 L41	L36-R39 CarbonylContact O-C 3.39Å; L36-R39 WeakPolarHBondContact O-CA 3.5Å; L36-R39 WeakPolarHBondContact O-CB 3.49Å; L36-R39 PolarHBondContact O-N 3.22Å; A37-R39 PolarHBondContact O-N 3.4Å; A37-R39 VanDerWaalsContact O-N 3.11Å; R39-L41 VanDerWaalsContact C-N 3.29Å; R39-L41 HydrophobicContact CB-CD1 3.99Å; R39-L41 VanDerWaalsContact O-CD1 3.25Å; R39-L41 WeakPolarHBondContact O-CD1 3.47Å
40	G	95.8	Very high	93.5	Very high	72 Å²	72	93 Å²	93	74%	0.742	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.2	14.3	-173.5	0	0	0	0	0	114.3	L36 A37	L36-G40 PolarHBondContact O-N 3.05Å; A37-G40 PolarHBondContact O-N 3.22Å
41	L	95.6	Very high	93.3	Very high	103 Å²	103	95.2 Å²	95.2	54%	0.539	48%	0.476	S	S	.	.			trans	-102.5	152	178.4	-80.9	78.1	0	0	0	111.4	L36 A37 R39	L36-L41 CarbonylContact C-O 3.49Å; L36-L41 HydrophobicContact CB-CB 4.14Å; L36-L41 HydrophobicContact CD2-CB 4.16Å; L36-L41 HydrophobicContact CD2-CD2 4.44Å; L36-L41 PolarHBondContact O-N 2.72Å; L36-L41 VanDerWaalsContact O-O 3.13Å; A37-L41 WeakPolarHBondContact CA-O 3.42Å; A37-L41 PolarHBondContact N-O 3.39Å; R39-L41 VanDerWaalsContact C-N 3.29Å; R39-L41 HydrophobicContact CB-CD1 3.99Å; R39-L41 VanDerWaalsContact O-CD1 3.25Å; R39-L41 WeakPolarHBondContact O-CD1 3.47Å
42	K	93.5	Very high	93.1	Very high	179 Å²	179	95.6 Å²	95.6	78%	0.778	47%	0.474	S	S	*	.			trans	-132.6	127.8	173.9	-176.7	178.2	179.8	179.7	0	109.7	P44	K42-P44 WeakPolarHBondContact O-CD 3.4Å
43	D	92.9	Very high	92.9	Very high	46 Å²	46	97.2 Å²	97.2	25%	0.246	47%	0.474	C	S	.	.			trans	-83.7	118.6	174	176.2	21.2	0	0	0	110.8	L36 W45 A46	L36-D43 HydrophobicContact CD1-CB 3.71Å; D43-W45 VanDerWaalsContact C-N 3.32Å; D43-W45 PolarHBondContact OD1-N 3.37Å; D43-A46 PolarHBondContact OD2-N 3.35Å; D43-A46 VanDerWaalsContact OD2-N 3.14Å
44	P	93.8	Very high	92.4	Very high	107 Å²	107	94.8 Å²	94.8	70%	0.695	47%	0.466	S	S	*	.	S	Bend	trans	-75.7	-16.9	176.4	30.9	-34.3	0	0	0	113.7	K42	K42-P44 WeakPolarHBondContact O-CD 3.4Å
45	W	93.6	Very high	91.8	Very high	164 Å²	164	92.7 Å²	92.7	62%	0.621	47%	0.473	S	S	*	.	S	Bend	trans	-97.3	-6.8	-173.5	-69	103.4	0	0	0	114.6	D43 R47 N48 E49	D43-W45 VanDerWaalsContact C-N 3.32Å; D43-W45 PolarHBondContact OD1-N 3.37Å; W45-R47 PolarHBondContact O-N 3.14Å; W45-N48 HydrophobicContact CE3-CB 3.76Å; W45-N48 HydrophobicContact CZ3-CB 4.37Å; W45-N48 WeakPolarHBondContact O-CA 3.41Å; W45-N48 VanDerWaalsContact O-CB 3.32Å; W45-N48 WeakPolarHBondContact O-CB 3.25Å; W45-N48 PolarHBondContact O-N 3.08Å; W45-E49 PolarHBondContact O-N 3.32Å
46	A	90.9	Very high	91	Very high	5 Å²	5	89.2 Å²	89.2	4%	0.041	49%	0.485	C	S	.	.	H	α-helix	trans	-50	-40.1	-178.1	0	0	0	0	0	113.6	V24 L29 D43 E49 A50	V24-A46 HydrophobicContact CG1-CB 4.44Å; V24-A46 HydrophobicContact CG2-CB 3.92Å; L29-A46 VanDerWaalsContact CD1-O 3.3Å; L29-A46 WeakPolarHBondContact CD1-O 3.39Å; D43-A46 PolarHBondContact OD2-N 3.35Å; D43-A46 VanDerWaalsContact OD2-N 3.14Å; A46-E49 PolarHBondContact O-N 3.21Å; A46-A50 PolarHBondContact O-N 3.14Å; A46-A50 VanDerWaalsContact O-N 3.08Å
47	R	91	Very high	90.1	Very high	144 Å²	144	95.2 Å²	95.2	54%	0.543	51%	0.509	S	S	.	.	H	α-helix	trans	-69.7	-34.5	177.6	-171.2	174.2	63.5	-174.3	0.5	113	W22 V24 W45 E49 A50	W22-R47 VanDerWaalsContact O-CG 3.28Å; W22-R47 WeakPolarHBondContact O-CG 3.32Å; V24-R47 HydrophobicContact CG2-CB 4.33Å; W45-R47 PolarHBondContact O-N 3.14Å; R47-E49 PolarHBondContact O-N 3.17Å; R47-A50 WeakPolarHBondContact O-CB 3.3Å; R47-A50 PolarHBondContact O-N 3.13Å
48	N	92.4	Very high	89.2	Confident	92 Å²	92	95.2 Å²	95.2	49%	0.492	51%	0.509	S	S	.	.	H	α-helix	trans	-68.6	-24	177.2	-173.4	55.1	0	0	0	112	W45 W51	W45-N48 HydrophobicContact CE3-CB 3.76Å; W45-N48 HydrophobicContact CZ3-CB 4.37Å; W45-N48 WeakPolarHBondContact O-CA 3.41Å; W45-N48 VanDerWaalsContact O-CB 3.32Å; W45-N48 WeakPolarHBondContact O-CB 3.25Å; W45-N48 PolarHBondContact O-N 3.08Å; N48-W51 PolarHBondContact O-NE1 3.04Å
49	E	90.3	Very high	88.5	Confident	62 Å²	62	99 Å²	99	29%	0.29	50%	0.504	S	S	.	.	H	α-helix	trans	-96.2	-14.6	177.4	-58.3	-154	138.5	0	0	113.5	L29 W45 A46 R47 W51 R52	L29-E49 HydrophobicContact CD1-CB 3.71Å; W45-E49 PolarHBondContact O-N 3.32Å; A46-E49 PolarHBondContact O-N 3.21Å; R47-E49 PolarHBondContact O-N 3.17Å; E49-W51 PolarHBondContact O-N 3.05Å; E49-W51 VanDerWaalsContact O-N 3.14Å; E49-R52 WeakPolarHBondContact O-CB 3.43Å; E49-R52 PolarHBondContact O-N 3.26Å; E49-R52 IonicContact OE1-CZ 3.94Å; E49-R52 IonicContact OE1-NH1 3.89Å; E49-R52 PolarHBondContact OE1-NH1 3.11Å; E49-R52 IonicContact OE2-NH1 3.25Å
50	A	91.4	Very high	87.6	Confident	0 Å²	0	93.3 Å²	93.3	0%	0	50%	0.5	C	S	.	.	G	3₁₀ helix	trans	-56.6	-32.3	-177.1	0	0	0	0	0	113.7	K23 V24 A46 R47 R52 Y53 S54	K23-A50 WeakPolarHBondContact O-CB 3.28Å; V24-A50 HydrophobicContact CG2-CB 4.47Å; A46-A50 PolarHBondContact O-N 3.14Å; A46-A50 VanDerWaalsContact O-N 3.08Å; R47-A50 WeakPolarHBondContact O-CB 3.3Å; R47-A50 PolarHBondContact O-N 3.13Å; A50-R52 PolarHBondContact O-N 3.05Å; A50-Y53 PolarHBondContact O-N 3.03Å; A50-Y53 VanDerWaalsContact O-N 3.13Å; A50-S54 WeakPolarHBondContact O-CB 3.33Å; A50-S54 PolarHBondContact O-N 3.04Å; A50-S54 PolarHBondContact O-OG 3.5Å
51	W	88.1	Confident	87	Confident	119 Å²	119	95 Å²	95	45%	0.451	50%	0.496	S	S	.	.	G	3₁₀ helix	trans	-60.6	-29.7	178.7	71.6	-94.7	0	0	0	113.1	W22 N48 E49 Y53 S54	W22-W51 HydrophobicContact CD2-CB 3.53Å; W22-W51 HydrophobicContact CE3-CB 3.59Å; W22-W51 HydrophobicContact CG-CB 4.15Å; W22-W51 HydrophobicContact CH2-CB 3.89Å; W22-W51 HydrophobicContact CZ2-CB 3.83Å; W22-W51 HydrophobicContact CZ3-CB 3.78Å; N48-W51 PolarHBondContact O-NE1 3.04Å; E49-W51 PolarHBondContact O-N 3.05Å; E49-W51 VanDerWaalsContact O-N 3.14Å; W51-Y53 PolarHBondContact O-N 3.32Å; W51-S54 PolarHBondContact O-N 3.39Å
52	R	87.9	Confident	86.6	Confident	117 Å²	117	93.3 Å²	93.3	44%	0.442	49%	0.49	S	S	.	.	G	3₁₀ helix	trans	-65.6	-30.3	179.3	-65.8	-179.3	177.2	147.7	0.7	112.3	E49 A50	E49-R52 WeakPolarHBondContact O-CB 3.43Å; E49-R52 PolarHBondContact O-N 3.26Å; E49-R52 IonicContact OE1-CZ 3.94Å; E49-R52 IonicContact OE1-NH1 3.89Å; E49-R52 PolarHBondContact OE1-NH1 3.11Å; E49-R52 IonicContact OE2-NH1 3.25Å; A50-R52 PolarHBondContact O-N 3.05Å
53	Y	87.9	Confident	86.3	Confident	97 Å²	97	92.4 Å²	92.4	38%	0.38	49%	0.493	S	S	.	.	G	3₁₀ helix	trans	-107.7	8.3	-176	-54.4	-66.5	0	0	0	112.5	P28 L29 A50 W51 A58	P28-Y53 HydrophobicContact CG-CD1 4.48Å; L29-Y53 HydrophobicContact CD1-CD2 3.87Å; L29-Y53 HydrophobicContact CD1-CE2 4.06Å; L29-Y53 HydrophobicContact CD2-CE2 4.11Å; L29-Y53 HydrophobicContact CG-CD2 3.9Å; L29-Y53 HydrophobicContact CG-CE2 3.94Å; A50-Y53 PolarHBondContact O-N 3.03Å; A50-Y53 VanDerWaalsContact O-N 3.13Å; W51-Y53 PolarHBondContact O-N 3.32Å; Y53-A58 WeakPolarHBondContact O-CA 3.29Å; Y53-A58 VanDerWaalsContact O-CB 3.29Å; Y53-A58 WeakPolarHBondContact O-CB 3.42Å
54	S	82.9	Confident	86	Confident	26 Å²	26	93.4 Å²	93.4	18%	0.182	50%	0.503	C	S	.	.	S	Bend	trans	-107.7	156.7	-179.6	-62.8	0	0	0	0	111	A50 W51	A50-S54 WeakPolarHBondContact O-CB 3.33Å; A50-S54 PolarHBondContact O-N 3.04Å; A50-S54 PolarHBondContact O-OG 3.5Å; W51-S54 PolarHBondContact O-N 3.39Å
55	G	82.4	Confident	85.7	Confident	64 Å²	64	92 Å²	92	66%	0.66	49%	0.488	S	S	*	.	G	3₁₀ helix	trans	67.6	-139.8	175.1	0	0	0	0	0	113.7	F57 A58	G55-F57 PolarHBondContact O-N 2.94Å; G55-F57 VanDerWaalsContact O-N 3.11Å; G55-A58 VanDerWaalsContact O-CB 3.23Å; G55-A58 WeakPolarHBondContact O-CB 3.23Å; G55-A58 PolarHBondContact O-N 2.86Å
56	G	78.9	Confident	85.5	Confident	80 Å²	80	88.4 Å²	88.4	83%	0.825	48%	0.483	S	S	*	.	G	3₁₀ helix	trans	-63.3	-16.7	-173.6	0	0	0	0	0	115.4
57	F	76.6	Confident	85.5	Confident	169 Å²	169	94.3 Å²	94.3	74%	0.741	51%	0.513	S	S	*	.	G	3₁₀ helix	trans	-99.4	2.4	177.6	-59.2	-68.7	0	0	0	113.5	G55 R59	G55-F57 PolarHBondContact O-N 2.94Å; G55-F57 VanDerWaalsContact O-N 3.11Å; F57-R59 PolarHBondContact O-N 3.24Å
58	A	75.9	Confident	85.5	Confident	63 Å²	63	92.9 Å²	92.9	52%	0.521	51%	0.511	S	S	.	.			trans	-66.3	-24.5	179.1	0	0	0	0	0	112.9	Y53 G55 A60	Y53-A58 WeakPolarHBondContact O-CA 3.29Å; Y53-A58 VanDerWaalsContact O-CB 3.29Å; Y53-A58 WeakPolarHBondContact O-CB 3.42Å; G55-A58 VanDerWaalsContact O-CB 3.23Å; G55-A58 WeakPolarHBondContact O-CB 3.23Å; G55-A58 PolarHBondContact O-N 2.86Å; A58-A60 PolarHBondContact O-N 3.25Å
59	R	79.5	Confident	85.5	Confident	169 Å²	169	99 Å²	99	64%	0.638	53%	0.528	S	S	*	.	S	Bend	trans	-81.7	111.8	178.6	-173.5	-179.6	173	91.7	4.5	109.8	F57 V61 E65	F57-R59 PolarHBondContact O-N 3.24Å; R59-V61 PolarHBondContact O-N 3.3Å; R59-E65 IonicContact CZ-OE1 3.47Å; R59-E65 IonicContact CZ-OE2 2.86Å; R59-E65 IonicContact NE-OE1 3.19Å; R59-E65 PolarHBondContact NE-OE1 3.37Å; R59-E65 IonicContact NE-OE2 3.38Å; R59-E65 PolarHBondContact NE-OE2 2.84Å; R59-E65 IonicContact NH2-OE1 2.84Å; R59-E65 PolarHBondContact NH2-OE1 3.38Å; R59-E65 IonicContact NH2-OE2 3.71Å; R59-E65 PolarHBondContact NH2-OE2 3.19Å
60	A	78.8	Confident	85.5	Confident	82 Å²	82	98.3 Å²	98.3	68%	0.678	54%	0.537	S	S	*	.	P	Polyproline II helix	trans	-62.3	121.8	168	0	0	0	0	0	109.6	A58 T62	A58-A60 PolarHBondContact O-N 3.25Å; A60-T62 PolarHBondContact O-N 3.27Å
61	V	81.9	Confident	85.6	Confident	108 Å²	108	103.9 Å²	103.9	66%	0.655	56%	0.562	S	S	*	*	P	Polyproline II helix	trans	-68.9	119.7	175	177.6	0	0	0	0	108.3	R59 V66	R59-V61 PolarHBondContact O-N 3.3Å; V61-V66 HydrophobicContact CG1-CG2 3.33Å
62	T	88	Confident	85.9	Confident	67 Å²	67	106.7 Å²	106.7	41%	0.411	58%	0.577	S	S	.	*	P	Polyproline II helix	trans	-85.3	147.2	175.5	60.8	0	0	0	0	110.5	A60 S64 E65 V66	A60-T62 PolarHBondContact O-N 3.27Å; T62-S64 VanDerWaalsContact C-N 3.25Å; T62-S64 PolarHBondContact O-N 3.43Å; T62-S64 PolarHBondContact OG1-OG 3.12Å; T62-E65 WeakPolarHBondContact O-CB 3.35Å; T62-E65 PolarHBondContact O-N 3.32Å; T62-E65 VanDerWaalsContact O-N 3.08Å; T62-E65 WeakPolarHBondContact OG1-CB 3.21Å; T62-E65 PolarHBondContact OG1-N 3.42Å; T62-V66 PolarHBondContact O-N 3.42Å
63	L	87.2	Confident	86.2	Confident	159 Å²	159	111.3 Å²	111.3	83%	0.832	60%	0.595	S	S	*	*	H	α-helix	trans	-59.2	-37.3	179.8	-72.9	173.5	0	0	0	112.3	E65 V66 L67	L63-E65 VanDerWaalsContact C-N 3.35Å; L63-V66 PolarHBondContact O-N 3.29Å; L63-L67 WeakPolarHBondContact O-CB 3.22Å; L63-L67 PolarHBondContact O-N 3.3Å
64	S	86.6	Confident	86.6	Confident	67 Å²	67	108.9 Å²	108.9	47%	0.469	60%	0.599	S	S	.	*	H	α-helix	trans	-65.2	-37.4	175.9	52.4	0	0	0	0	112.2	T62 V66 L67 F68	T62-S64 VanDerWaalsContact C-N 3.25Å; T62-S64 PolarHBondContact O-N 3.43Å; T62-S64 PolarHBondContact OG1-OG 3.12Å; S64-V66 VanDerWaalsContact C-N 3.27Å; S64-V66 PolarHBondContact O-N 3.08Å; S64-L67 PolarHBondContact O-N 3.18Å; S64-F68 WeakPolarHBondContact O-CB 3.43Å; S64-F68 WeakPolarHBondContact O-CD2 3.27Å; S64-F68 PolarHBondContact O-N 3.42Å
65	E	88.1	Confident	87.2	Confident	79 Å²	79	113.1 Å²	113.1	37%	0.369	61%	0.614	S	S	.	*	H	α-helix	trans	-65	-32.9	176.3	-174.5	168.2	-173.7	0	0	111.9	R59 T62 L63 R69	R59-E65 IonicContact CZ-OE1 3.47Å; R59-E65 IonicContact CZ-OE2 2.86Å; R59-E65 IonicContact NE-OE1 3.19Å; R59-E65 PolarHBondContact NE-OE1 3.37Å; R59-E65 IonicContact NE-OE2 3.38Å; R59-E65 PolarHBondContact NE-OE2 2.84Å; R59-E65 IonicContact NH2-OE1 2.84Å; R59-E65 PolarHBondContact NH2-OE1 3.38Å; R59-E65 IonicContact NH2-OE2 3.71Å; R59-E65 PolarHBondContact NH2-OE2 3.19Å; T62-E65 WeakPolarHBondContact O-CB 3.35Å; T62-E65 PolarHBondContact O-N 3.32Å; T62-E65 VanDerWaalsContact O-N 3.08Å; T62-E65 WeakPolarHBondContact OG1-CB 3.21Å; T62-E65 PolarHBondContact OG1-N 3.42Å; L63-E65 VanDerWaalsContact C-N 3.35Å; E65-R69 WeakPolarHBondContact O-CB 3.34Å; E65-R69 PolarHBondContact O-N 3.22Å
66	V	89	Confident	87.9	Confident	88 Å²	88	112.2 Å²	112.2	53%	0.533	60%	0.601	S	S	.	*	H	α-helix	trans	-73.1	-49.1	172.3	-178.8	0	0	0	0	111	V61 T62 L63 S64 R69	V61-V66 HydrophobicContact CG1-CG2 3.33Å; T62-V66 PolarHBondContact O-N 3.42Å; L63-V66 PolarHBondContact O-N 3.29Å; S64-V66 VanDerWaalsContact C-N 3.27Å; S64-V66 PolarHBondContact O-N 3.08Å; V66-R69 WeakPolarHBondContact O-CB 3.37Å; V66-R69 PolarHBondContact O-N 3.12Å
67	L	89.6	Confident	88.8	Confident	128 Å²	128	111.3 Å²	111.3	67%	0.67	59%	0.586	S	S	*	*	H	α-helix	trans	-66.9	-40.2	-174.7	-174.6	142.5	0	0	0	112.5	L63 S64 R69	L63-L67 WeakPolarHBondContact O-CB 3.22Å; L63-L67 PolarHBondContact O-N 3.3Å; S64-L67 PolarHBondContact O-N 3.18Å; L67-R69 VanDerWaalsContact C-N 3.31Å
68	F	92.8	Very high	89.7	Confident	114 Å²	114	108.9 Å²	108.9	50%	0.5	58%	0.575	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.9	12.2	178	-65.2	-70.7	0	0	0	113	S64 G70 F71	S64-F68 WeakPolarHBondContact O-CB 3.43Å; S64-F68 WeakPolarHBondContact O-CD2 3.27Å; S64-F68 PolarHBondContact O-N 3.42Å; F68-G70 PolarHBondContact O-N 3.23Å; F68-G70 VanDerWaalsContact O-N 3.12Å; F68-F71 HydrophobicContact CB-CB 4.14Å; F68-F71 HydrophobicContact CD1-CB 4.05Å; F68-F71 HydrophobicContact CD1-CD1 4.16Å; F68-F71 HydrophobicContact CD1-CD2 4.22Å; F68-F71 AromaticContact CD1-CG 3.88Å; F68-F71 HydrophobicContact CD1-CG 3.88Å; F68-F71 WeakPolarHBondContact O-CB 3.34Å; F68-F71 PolarHBondContact O-N 2.81Å
69	R	91.1	Very high	90.7	Very high	221 Å²	221	109 Å²	109	83%	0.834	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63	116.9	175	-169.5	171.8	168.8	178.2	-4.2	109.4	E65 V66 L67 F71	E65-R69 WeakPolarHBondContact O-CB 3.34Å; E65-R69 PolarHBondContact O-N 3.22Å; V66-R69 WeakPolarHBondContact O-CB 3.37Å; V66-R69 PolarHBondContact O-N 3.12Å; L67-R69 VanDerWaalsContact C-N 3.31Å; R69-F71 VanDerWaalsContact C-N 3.28Å; R69-F71 PolarHBondContact O-N 3.37Å
70	G	90.9	Very high	91.5	Very high	48 Å²	48	105.2 Å²	105.2	50%	0.495	56%	0.564	S	S	.	*	T	Hydrogen-bonded Turn	trans	83.4	-5.4	-178.2	0	0	0	0	0	115	F68 K72 W73 G74	F68-G70 PolarHBondContact O-N 3.23Å; F68-G70 VanDerWaalsContact O-N 3.12Å; G70-K72 VanDerWaalsContact C-N 3.25Å; G70-K72 PolarHBondContact O-N 3.06Å; G70-W73 PolarHBondContact O-N 2.84Å; G70-G74 PolarHBondContact O-N 2.9Å
71	F	94.3	Very high	92.3	Very high	116 Å²	116	103.8 Å²	103.8	51%	0.509	55%	0.553	S	S	.	*	H	α-helix	trans	-58.1	-36.6	179.4	-175.4	-98.4	0	0	0	112.6	F68 R69 W73 G74 F75	F68-F71 HydrophobicContact CB-CB 4.14Å; F68-F71 HydrophobicContact CD1-CB 4.05Å; F68-F71 HydrophobicContact CD1-CD1 4.16Å; F68-F71 HydrophobicContact CD1-CD2 4.22Å; F68-F71 AromaticContact CD1-CG 3.88Å; F68-F71 HydrophobicContact CD1-CG 3.88Å; F68-F71 WeakPolarHBondContact O-CB 3.34Å; F68-F71 PolarHBondContact O-N 2.81Å; R69-F71 VanDerWaalsContact C-N 3.28Å; R69-F71 PolarHBondContact O-N 3.37Å; F71-W73 PolarHBondContact O-N 3.35Å; F71-G74 PolarHBondContact O-N 2.99Å; F71-F75 HydrophobicContact CE1-CB 4.36Å; F71-F75 HydrophobicContact CZ-CD2 4.31Å; F71-F75 VanDerWaalsContact O-CB 3.27Å; F71-F75 WeakPolarHBondContact O-CB 3.39Å; F71-F75 PolarHBondContact O-N 3.44Å
72	K	93.1	Very high	92.9	Very high	179 Å²	179	102.4 Å²	102.4	78%	0.778	54%	0.542	S	S	*	.	H	α-helix	trans	-58.3	-46.5	178.1	-60.6	-175.9	-174.9	-177.2	0	112.4	G70 A76	G70-K72 VanDerWaalsContact C-N 3.25Å; G70-K72 PolarHBondContact O-N 3.06Å; K72-A76 PolarHBondContact O-N 3.25Å; K72-A76 VanDerWaalsContact O-N 3.12Å
73	W	95.6	Very high	93.2	Very high	214 Å²	214	101.9 Å²	101.9	81%	0.811	54%	0.544	S	S	*	.	H	α-helix	trans	-75.1	-38.7	180	-65.8	114.7	0	0	0	111.7	G70 F71 F75 A76 A77	G70-W73 PolarHBondContact O-N 2.84Å; F71-W73 PolarHBondContact O-N 3.35Å; W73-F75 VanDerWaalsContact C-N 3.35Å; W73-F75 PolarHBondContact O-N 3.07Å; W73-A76 PolarHBondContact O-N 3.47Å; W73-A77 PolarHBondContact O-N 3.34Å
74	G	95.1	Very high	93.5	Very high	45 Å²	45	98.9 Å²	98.9	46%	0.464	53%	0.528	S	S	.	.	H	α-helix	trans	-59.7	-44.6	173.6	0	0	0	0	0	112.2	G70 F71 A77 F78	G70-G74 PolarHBondContact O-N 2.9Å; F71-G74 PolarHBondContact O-N 2.99Å; G74-A77 PolarHBondContact O-N 2.91Å; G74-F78 WeakPolarHBondContact O-CB 3.46Å; G74-F78 PolarHBondContact O-N 2.98Å
75	F	96.3	Very high	93.6	Very high	115 Å²	115	101.3 Å²	101.3	50%	0.504	53%	0.532	S	S	.	.	H	α-helix	trans	-65.5	-41.8	177.4	-171	-97.9	0	0	0	112.1	F71 W73 A77 F78 T79	F71-F75 HydrophobicContact CE1-CB 4.36Å; F71-F75 HydrophobicContact CZ-CD2 4.31Å; F71-F75 VanDerWaalsContact O-CB 3.27Å; F71-F75 WeakPolarHBondContact O-CB 3.39Å; F71-F75 PolarHBondContact O-N 3.44Å; W73-F75 VanDerWaalsContact C-N 3.35Å; W73-F75 PolarHBondContact O-N 3.07Å; F75-A77 PolarHBondContact O-N 3.4Å; F75-F78 WeakPolarHBondContact O-CB 3.34Å; F75-F78 PolarHBondContact O-N 3.06Å; F75-T79 PolarHBondContact O-N 3.49Å; F75-T79 PolarHBondContact O-OG1 3.34Å; F75-T79 VanDerWaalsContact O-OG1 3.07Å
76	A	97.1	Very high	93.6	Very high	46 Å²	46	105.2 Å²	105.2	38%	0.38	54%	0.544	S	S	.	.	H	α-helix	trans	-59.7	-47.3	175.1	0	0	0	0	0	112	K72 W73 F78 T79 V80	K72-A76 PolarHBondContact O-N 3.25Å; K72-A76 VanDerWaalsContact O-N 3.12Å; W73-A76 PolarHBondContact O-N 3.47Å; A76-F78 VanDerWaalsContact C-N 3.32Å; A76-F78 PolarHBondContact O-N 3.37Å; A76-T79 PolarHBondContact O-N 3.45Å; A76-V80 WeakPolarHBondContact O-CG2 3.43Å; A76-V80 PolarHBondContact O-N 3.26Å
77	A	97.3	Very high	93.6	Very high	61 Å²	61	105.9 Å²	105.9	50%	0.504	55%	0.549	S	S	.	.	H	α-helix	trans	-62	-40.4	176.4	0	0	0	0	0	111.8	W73 G74 F75 V80 A81	W73-A77 PolarHBondContact O-N 3.34Å; G74-A77 PolarHBondContact O-N 2.91Å; F75-A77 PolarHBondContact O-N 3.4Å; A77-V80 PolarHBondContact O-N 3.49Å; A77-A81 WeakPolarHBondContact O-CB 3.38Å; A77-A81 PolarHBondContact O-N 2.81Å
78	F	96.4	Very high	93.3	Very high	117 Å²	117	106.3 Å²	106.3	51%	0.513	55%	0.549	S	S	.	.	H	α-helix	trans	-61.5	-45.6	175.9	175.7	-107.6	0	0	0	112.4	G74 F75 A76 V80 A81 L82	G74-F78 WeakPolarHBondContact O-CB 3.46Å; G74-F78 PolarHBondContact O-N 2.98Å; F75-F78 WeakPolarHBondContact O-CB 3.34Å; F75-F78 PolarHBondContact O-N 3.06Å; A76-F78 VanDerWaalsContact C-N 3.32Å; A76-F78 PolarHBondContact O-N 3.37Å; F78-V80 PolarHBondContact O-N 2.91Å; F78-A81 PolarHBondContact O-N 3.24Å; F78-L82 HydrophobicContact CD1-CD1 4.11Å; F78-L82 HydrophobicContact CE1-CD1 3.48Å; F78-L82 VanDerWaalsContact CE1-CD1 3.48Å; F78-L82 HydrophobicContact CE1-CG 4.23Å; F78-L82 HydrophobicContact CE2-CD1 4.3Å; F78-L82 HydrophobicContact CE2-CD2 4.42Å; F78-L82 HydrophobicContact CE2-CG 4.24Å; F78-L82 HydrophobicContact CZ-CD1 3.6Å; F78-L82 HydrophobicContact CZ-CD2 4.29Å; F78-L82 HydrophobicContact CZ-CG 4.02Å; F78-L82 WeakPolarHBondContact O-CG 3.42Å; F78-L82 PolarHBondContact O-N 3.49Å
79	T	96.6	Very high	92.6	Very high	67 Å²	67	108.3 Å²	108.3	41%	0.411	56%	0.558	S	S	.	*	H	α-helix	trans	-63.6	-40.7	176.8	-53	0	0	0	0	112	F75 A76 A81 L82 A83	F75-T79 PolarHBondContact O-N 3.49Å; F75-T79 PolarHBondContact O-OG1 3.34Å; F75-T79 VanDerWaalsContact O-OG1 3.07Å; A76-T79 PolarHBondContact O-N 3.45Å; T79-A81 VanDerWaalsContact C-N 3.34Å; T79-L82 PolarHBondContact O-N 3.07Å; T79-A83 PolarHBondContact O-N 3.43Å
80	V	96.5	Very high	91.8	Very high	88 Å²	88	102 Å²	102	53%	0.533	55%	0.545	S	S	.	.	H	α-helix	trans	-62.6	-43.2	175.3	171.7	0	0	0	0	110.9	A76 A77 F78 L82 A83 I84	A76-V80 WeakPolarHBondContact O-CG2 3.43Å; A76-V80 PolarHBondContact O-N 3.26Å; A77-V80 PolarHBondContact O-N 3.49Å; F78-V80 PolarHBondContact O-N 2.91Å; V80-L82 PolarHBondContact O-N 2.94Å; V80-A83 PolarHBondContact O-N 3.25Å; V80-I84 HydrophobicContact CG1-CD1 3.94Å; V80-I84 WeakPolarHBondContact O-CG1 3.36Å; V80-I84 PolarHBondContact O-N 3.5Å
81	A	95.2	Very high	90.8	Very high	53 Å²	53	103.2 Å²	103.2	44%	0.438	54%	0.544	S	S	.	.	H	α-helix	trans	-60.4	-46	176.4	0	0	0	0	0	111.7	A77 F78 T79 A83 I84 E85	A77-A81 WeakPolarHBondContact O-CB 3.38Å; A77-A81 PolarHBondContact O-N 2.81Å; F78-A81 PolarHBondContact O-N 3.24Å; T79-A81 VanDerWaalsContact C-N 3.34Å; A81-A83 VanDerWaalsContact C-N 3.34Å; A81-A83 PolarHBondContact O-N 2.96Å; A81-I84 PolarHBondContact O-N 3.36Å; A81-E85 WeakPolarHBondContact O-CB 3.18Å; A81-E85 PolarHBondContact O-N 3Å
82	L	94.5	Very high	89.5	Confident	79 Å²	79	107.5 Å²	107.5	41%	0.414	56%	0.563	S	S	.	*	H	α-helix	trans	-60.7	-41	175.2	-73.5	-179.5	0	0	0	112.4	F78 T79 V80 I84 E85 Y86	F78-L82 HydrophobicContact CD1-CD1 4.11Å; F78-L82 HydrophobicContact CE1-CD1 3.48Å; F78-L82 VanDerWaalsContact CE1-CD1 3.48Å; F78-L82 HydrophobicContact CE1-CG 4.23Å; F78-L82 HydrophobicContact CE2-CD1 4.3Å; F78-L82 HydrophobicContact CE2-CD2 4.42Å; F78-L82 HydrophobicContact CE2-CG 4.24Å; F78-L82 HydrophobicContact CZ-CD1 3.6Å; F78-L82 HydrophobicContact CZ-CD2 4.29Å; F78-L82 HydrophobicContact CZ-CG 4.02Å; F78-L82 WeakPolarHBondContact O-CG 3.42Å; F78-L82 PolarHBondContact O-N 3.49Å; T79-L82 PolarHBondContact O-N 3.07Å; V80-L82 PolarHBondContact O-N 2.94Å; L82-I84 VanDerWaalsContact C-N 3.34Å; L82-I84 PolarHBondContact O-N 2.95Å; L82-E85 PolarHBondContact O-N 3.27Å; L82-Y86 VanDerWaalsContact O-CB 3.31Å; L82-Y86 WeakPolarHBondContact O-CB 3.4Å; L82-Y86 PolarHBondContact O-N 3.46Å
83	A	93.3	Very high	87.9	Confident	56 Å²	56	108.9 Å²	108.9	46%	0.463	57%	0.569	S	S	.	*	H	α-helix	trans	-63.2	-41	177.3	0	0	0	0	0	111.7	T79 V80 A81 T87	T79-A83 PolarHBondContact O-N 3.43Å; V80-A83 PolarHBondContact O-N 3.25Å; A81-A83 VanDerWaalsContact C-N 3.34Å; A81-A83 PolarHBondContact O-N 2.96Å; A83-T87 WeakPolarHBondContact O-CB 3.31Å; A83-T87 WeakPolarHBondContact O-CG2 3.33Å; A83-T87 PolarHBondContact O-N 2.86Å; A83-T87 PolarHBondContact O-OG1 3.45Å
84	I	93.7	Very high	86.1	Confident	96 Å²	96	102 Å²	102	49%	0.492	57%	0.565	S	S	.	*	H	α-helix	trans	-65.6	-46.3	175.1	-66.2	166.5	0	0	0	110.4	V80 A81 L82 Y86 T87 M88	V80-I84 HydrophobicContact CG1-CD1 3.94Å; V80-I84 WeakPolarHBondContact O-CG1 3.36Å; V80-I84 PolarHBondContact O-N 3.5Å; A81-I84 PolarHBondContact O-N 3.36Å; L82-I84 VanDerWaalsContact C-N 3.34Å; L82-I84 PolarHBondContact O-N 2.95Å; I84-Y86 PolarHBondContact O-N 2.93Å; I84-T87 WeakPolarHBondContact CA-OG1 3.32Å; I84-T87 PolarHBondContact O-N 3.43Å; I84-T87 PolarHBondContact O-OG1 2.86Å; I84-M88 HydrophobicContact CG2-CG 4.22Å; I84-M88 WeakPolarHBondContact O-CB 3.43Å; I84-M88 WeakPolarHBondContact O-CG 3.31Å; I84-M88 PolarHBondContact O-N 2.76Å
85	E	88.8	Confident	84	Confident	118 Å²	118	103.6 Å²	103.6	55%	0.551	58%	0.581	S	S	*	*	H	α-helix	trans	-61.1	-44.8	179.4	-172.3	177.6	174.2	0	0	111.2	A81 L82 T87 M88 F89	A81-E85 WeakPolarHBondContact O-CB 3.18Å; A81-E85 PolarHBondContact O-N 3Å; L82-E85 PolarHBondContact O-N 3.27Å; E85-T87 VanDerWaalsContact C-N 3.34Å; E85-T87 PolarHBondContact O-N 3.33Å; E85-M88 PolarHBondContact O-N 3.35Å; E85-F89 CarbonylContact O-C 3.05Å; E85-F89 VanDerWaalsContact O-CA 3.31Å; E85-F89 WeakPolarHBondContact O-CA 3.45Å; E85-F89 WeakPolarHBondContact O-CB 3.5Å; E85-F89 PolarHBondContact O-N 2.92Å
86	Y	89.4	Confident	81.4	Confident	160 Å²	160	110.9 Å²	110.9	63%	0.627	62%	0.616	S	S	*	*	H	α-helix	trans	-69.9	-30.7	-179	-148.4	-90.2	0	0	0	113.2	L82 I84 P91	L82-Y86 VanDerWaalsContact O-CB 3.31Å; L82-Y86 WeakPolarHBondContact O-CB 3.4Å; L82-Y86 PolarHBondContact O-N 3.46Å; I84-Y86 PolarHBondContact O-N 2.93Å; Y86-P91 HydrophobicContact CD2-CG 4.45Å; Y86-P91 HydrophobicContact CE2-CG 3.63Å
87	T	89	Confident	80.6	Confident	103 Å²	103	114.2 Å²	114.2	63%	0.632	63%	0.628	S	S	*	*	H	α-helix	trans	-78.2	-36.7	177	51.5	0	0	0	0	112.4	A83 I84 E85	A83-T87 WeakPolarHBondContact O-CB 3.31Å; A83-T87 WeakPolarHBondContact O-CG2 3.33Å; A83-T87 PolarHBondContact O-N 2.86Å; A83-T87 PolarHBondContact O-OG1 3.45Å; I84-T87 WeakPolarHBondContact CA-OG1 3.32Å; I84-T87 PolarHBondContact O-N 3.43Å; I84-T87 PolarHBondContact O-OG1 2.86Å; E85-T87 VanDerWaalsContact C-N 3.34Å; E85-T87 PolarHBondContact O-N 3.33Å
88	M	82.9	Confident	79.8	Confident	136 Å²	136	116.9 Å²	116.9	67%	0.67	63%	0.634	S	S	*	*	H	α-helix	trans	-90.3	-31.6	-177	-65.2	-68.5	170.6	0	0	113.2	I84 E85	I84-M88 HydrophobicContact CG2-CG 4.22Å; I84-M88 WeakPolarHBondContact O-CB 3.43Å; I84-M88 WeakPolarHBondContact O-CG 3.31Å; I84-M88 PolarHBondContact O-N 2.76Å; E85-M88 PolarHBondContact O-N 3.35Å
89	F	78.7	Confident	78.8	Confident	156 Å²	156	116.9 Å²	116.9	68%	0.684	64%	0.641	S	S	*	*	S	Bend	trans	-128.8	69.8	179.8	-56.8	-75.7	0	0	0	109.8	E85	E85-F89 CarbonylContact O-C 3.05Å; E85-F89 VanDerWaalsContact O-CA 3.31Å; E85-F89 WeakPolarHBondContact O-CA 3.45Å; E85-F89 WeakPolarHBondContact O-CB 3.5Å; E85-F89 PolarHBondContact O-N 2.92Å
90	P	73.8	Confident	77.8	Confident	88 Å²	88	119.9 Å²	119.9	57%	0.571	66%	0.655	S	S	*	*			trans	-57.4	132	177.3	23.2	-32.1	0	0	0	109.2	K92	P90-K92 PolarHBondContact O-N 2.98Å
91	P	70.2	Confident	76.6	Confident	74 Å²	74	121.9 Å²	121.9	48%	0.481	66%	0.662	S	S	.	*			trans	-59.2	129.3	-179	23.1	-32.1	0	0	0	108.8	Y86 K93	Y86-P91 HydrophobicContact CD2-CG 4.45Å; Y86-P91 HydrophobicContact CE2-CG 3.63Å; P91-K93 PolarHBondContact O-N 3.22Å
92	K	66.8	Low	75.4	Confident	207 Å²	207	126.5 Å²	126.5	90%	0.9	68%	0.677	S	S	*	*			trans	-55.6	115	170.7	-86.3	177	175.2	163.9	0	107.3	P90 G94	P90-K92 PolarHBondContact O-N 2.98Å; K92-G94 PolarHBondContact O-N 2.93Å
93	K	59.9	Low	74	Confident	207 Å²	207	129.9 Å²	129.9	90%	0.9	70%	0.696	S	S	*	*			trans	-54.7	109.1	163.3	-92.5	-178.4	173.6	176.5	0	106.1	P91 G95	P91-K93 PolarHBondContact O-N 3.22Å; K93-G95 PolarHBondContact O-N 3.09Å; K93-G95 VanDerWaalsContact O-N 3.09Å
94	G	57.9	Low	72.5	Confident	71 Å²	71	135.5 Å²	135.5	73%	0.732	71%	0.714	S	S	*	*			trans	-54.9	117.5	171.2	0	0	0	0	0	107.8	K92 H96	K92-G94 PolarHBondContact O-N 2.93Å; G94-H96 PolarHBondContact O-N 3.43Å
95	G	49.9	Very low	70.8	Confident	77 Å²	77	138.8 Å²	138.8	79%	0.794	73%	0.732	S	S	*	*			trans	-61	128.4	163.2	0	0	0	0	0	107.9	K93	K93-G95 PolarHBondContact O-N 3.09Å; K93-G95 VanDerWaalsContact O-N 3.09Å
96	H	42.3	Very low	69.2	Low	269 Å²	269	140.7 Å²	140.7	100%	1.245	75%	0.749	S	S	*	*			trans	-67.3	0	151.2	-89.3	-83.2	0	0	0	109.2	G94	G94-H96 PolarHBondContact O-N 3.43Å

Retrieved 96 of 96 residues in 49.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).