A0A087Y9X3_POEFO Loading...

Mitochondrial import inner membrane translocase subunit TIM14

Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling. May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.

AlphaFold DB , UniProt , Accession A0A087Y9X3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 118 aa.

						>A0A087Y9X3_POEFO|A0A087Y9X3
MASSMVAVGLALAAAGFAGRYAMQAMKQMEPQVKQALQSFPKTAFGGGYYGGGFEPKMTKREAALILGVSPTANKNKIREAHRKLMVLNHPDRGGSPYIAAKINEAKDLMDGQARKQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.4	Low	75.5	Confident	211 Å²	211	96.8 Å²	96.8	100%	1.039	61%	0.61	S	S	*	*				0	-23.2	0	-58.6	-158.8	-156.4	0	0	113.9	S4	M1-S4 PolarHBondContact O-OG 3.33Å
2	A	61.7	Low	76.8	Confident	75 Å²	75	98.8 Å²	98.8	62%	0.62	61%	0.611	S	S	*	*	H	α-helix	trans	-74.8	-39.3	178.8	0	0	0	0	0	114.1	S4 M5 V6	A2-S4 VanDerWaalsContact C-N 3.3Å; A2-S4 PolarHBondContact O-N 3.15Å; A2-M5 PolarHBondContact O-N 3.4Å; A2-M5 VanDerWaalsContact O-N 3.15Å; A2-V6 PolarHBondContact O-N 2.88Å
3	S	60.5	Low	77.8	Confident	102 Å²	102	95.2 Å²	95.2	71%	0.713	60%	0.597	S	S	*	*	H	α-helix	trans	-65.4	-29.7	-176.7	-38.1	0	0	0	0	113.9	A7	S3-A7 PolarHBondContact O-N 2.87Å
4	S	67.6	Low	78.8	Confident	72 Å²	72	92.8 Å²	92.8	50%	0.503	59%	0.591	S	S	.	*	H	α-helix	trans	-72	-34	174.8	48.5	0	0	0	0	112.4	M1 A2 V8	M1-S4 PolarHBondContact O-OG 3.33Å; A2-S4 VanDerWaalsContact C-N 3.3Å; A2-S4 PolarHBondContact O-N 3.15Å; S4-V8 VanDerWaalsContact O-CG2 3.23Å; S4-V8 WeakPolarHBondContact O-CG2 3.41Å; S4-V8 PolarHBondContact O-N 3.07Å; S4-V8 VanDerWaalsContact O-N 3.12Å
5	M	74.6	Confident	79.6	Confident	148 Å²	148	90.9 Å²	90.9	73%	0.729	59%	0.588	S	S	*	*	H	α-helix	trans	-72	-36.1	177.7	-62.3	-167.3	106.2	0	0	112	A2 G9	A2-M5 PolarHBondContact O-N 3.4Å; A2-M5 VanDerWaalsContact O-N 3.15Å; M5-G9 PolarHBondContact O-N 3.5Å
6	V	79.4	Confident	80.3	Confident	92 Å²	92	88.2 Å²	88.2	56%	0.558	58%	0.581	S	S	*	*	H	α-helix	trans	-67.4	-42.5	175.8	178.9	0	0	0	0	111.2	A2 G9 L10	A2-V6 PolarHBondContact O-N 2.88Å; V6-G9 PolarHBondContact O-N 3.04Å; V6-L10 HydrophobicContact CG1-CD1 4.09Å; V6-L10 WeakPolarHBondContact O-CG 3.42Å; V6-L10 PolarHBondContact O-N 3.31Å
7	A	81.6	Confident	80.8	Confident	58 Å²	58	92.4 Å²	92.4	48%	0.479	59%	0.588	S	S	.	*	H	α-helix	trans	-63.4	-42.3	177.2	0	0	0	0	0	112.4	S3 L10 A11	S3-A7 PolarHBondContact O-N 2.87Å; A7-L10 PolarHBondContact O-N 3.47Å; A7-A11 WeakPolarHBondContact O-CB 3.26Å; A7-A11 PolarHBondContact O-N 3.27Å
8	V	86.8	Confident	81.3	Confident	87 Å²	87	90.7 Å²	90.7	53%	0.527	58%	0.584	S	S	.	*	H	α-helix	trans	-64.1	-42.4	175.3	172	0	0	0	0	111.1	S4 A11 L12	S4-V8 VanDerWaalsContact O-CG2 3.23Å; S4-V8 WeakPolarHBondContact O-CG2 3.41Å; S4-V8 PolarHBondContact O-N 3.07Å; S4-V8 VanDerWaalsContact O-N 3.12Å; V8-A11 PolarHBondContact O-N 3.09Å; V8-L12 HydrophobicContact CG1-CD1 3.95Å; V8-L12 HydrophobicContact CG1-CG 4.49Å; V8-L12 WeakPolarHBondContact O-CG 3.03Å; V8-L12 PolarHBondContact O-N 3.47Å
9	G	83.9	Confident	81.7	Confident	40 Å²	40	87.6 Å²	87.6	41%	0.412	57%	0.571	S	S	.	*	H	α-helix	trans	-60.9	-44.8	176.3	0	0	0	0	0	113.1	M5 V6 L12 A13	M5-G9 PolarHBondContact O-N 3.5Å; V6-G9 PolarHBondContact O-N 3.04Å; G9-L12 PolarHBondContact O-N 3.49Å; G9-A13 WeakPolarHBondContact O-CB 3.44Å; G9-A13 PolarHBondContact O-N 2.95Å
10	L	89.8	Confident	81.7	Confident	119 Å²	119	91.8 Å²	91.8	62%	0.623	58%	0.575	S	S	*	*	H	α-helix	trans	-66.9	-39.8	177.8	-73.2	172.1	0	0	0	112.5	V6 A7 A13 A14	V6-L10 HydrophobicContact CG1-CD1 4.09Å; V6-L10 WeakPolarHBondContact O-CG 3.42Å; V6-L10 PolarHBondContact O-N 3.31Å; A7-L10 PolarHBondContact O-N 3.47Å; L10-A13 PolarHBondContact O-N 3.37Å; L10-A14 WeakPolarHBondContact O-CB 3.44Å; L10-A14 PolarHBondContact O-N 3.21Å
11	A	83.8	Confident	81.9	Confident	61 Å²	61	96 Å²	96	50%	0.504	58%	0.581	S	S	.	*	H	α-helix	trans	-63.8	-44	177	0	0	0	0	0	112	A7 V8 A14 A15	A7-A11 WeakPolarHBondContact O-CB 3.26Å; A7-A11 PolarHBondContact O-N 3.27Å; V8-A11 PolarHBondContact O-N 3.09Å; A11-A14 PolarHBondContact O-N 3.49Å; A11-A15 WeakPolarHBondContact O-CB 3.3Å; A11-A15 PolarHBondContact O-N 3.31Å
12	L	91	Very high	83	Confident	120 Å²	120	88.1 Å²	88.1	63%	0.628	55%	0.549	S	S	*	.	H	α-helix	trans	-64.1	-40.6	176.3	-71.3	170.7	0	0	0	111.9	V8 G9 A15 G16	V8-L12 HydrophobicContact CG1-CD1 3.95Å; V8-L12 HydrophobicContact CG1-CG 4.49Å; V8-L12 WeakPolarHBondContact O-CG 3.03Å; V8-L12 PolarHBondContact O-N 3.47Å; G9-L12 PolarHBondContact O-N 3.49Å; L12-A15 PolarHBondContact O-N 3.45Å; L12-G16 PolarHBondContact O-N 2.97Å
13	A	89.1	Confident	83.8	Confident	52 Å²	52	90.6 Å²	90.6	43%	0.43	55%	0.55	S	S	.	.	H	α-helix	trans	-64.3	-43.9	176.3	0	0	0	0	0	112.2	G9 L10 G16 F17	G9-A13 WeakPolarHBondContact O-CB 3.44Å; G9-A13 PolarHBondContact O-N 2.95Å; L10-A13 PolarHBondContact O-N 3.37Å; A13-G16 PolarHBondContact O-N 3.21Å; A13-F17 PolarHBondContact O-N 3.14Å
14	A	91.4	Very high	84.6	Confident	62 Å²	62	91.7 Å²	91.7	51%	0.512	54%	0.544	S	S	.	.	H	α-helix	trans	-62.7	-44.1	177.2	0	0	0	0	0	112	L10 A11 F17 A18	L10-A14 WeakPolarHBondContact O-CB 3.44Å; L10-A14 PolarHBondContact O-N 3.21Å; A11-A14 PolarHBondContact O-N 3.49Å; A14-F17 PolarHBondContact O-N 3.37Å; A14-A18 WeakPolarHBondContact O-CB 3.46Å; A14-A18 PolarHBondContact O-N 3.32Å
15	A	91.9	Very high	85.2	Confident	65 Å²	65	90 Å²	90	54%	0.537	53%	0.534	S	S	.	.	H	α-helix	trans	-63	-42.5	175.8	0	0	0	0	0	112.1	A11 L12 G19	A11-A15 WeakPolarHBondContact O-CB 3.3Å; A11-A15 PolarHBondContact O-N 3.31Å; L12-A15 PolarHBondContact O-N 3.45Å; A15-G19 PolarHBondContact O-N 3.33Å
16	G	90.2	Very high	85	Confident	47 Å²	47	87.4 Å²	87.4	49%	0.485	52%	0.521	S	S	.	.	H	α-helix	trans	-62.3	-43.7	176.6	0	0	0	0	0	113	L12 A13 R20	L12-G16 PolarHBondContact O-N 2.97Å; A13-G16 PolarHBondContact O-N 3.21Å; G16-R20 WeakPolarHBondContact O-CB 3.4Å; G16-R20 PolarHBondContact O-N 3.42Å
17	F	89.5	Confident	84.4	Confident	159 Å²	159	90.4 Å²	90.4	70%	0.697	53%	0.527	S	S	*	.	H	α-helix	trans	-67.7	-45.3	177.5	-102.4	-87.9	0	0	0	112.7	A13 A14 G19 R20 Y21	A13-F17 PolarHBondContact O-N 3.14Å; A14-F17 PolarHBondContact O-N 3.37Å; F17-G19 VanDerWaalsContact C-N 3.34Å; F17-G19 PolarHBondContact O-N 3.02Å; F17-R20 PolarHBondContact O-N 3.22Å; F17-Y21 WeakPolarHBondContact O-CB 3.05Å; F17-Y21 PolarHBondContact O-N 3.33Å
18	A	89.3	Confident	83.8	Confident	62 Å²	62	96.1 Å²	96.1	51%	0.512	54%	0.544	S	S	.	.	H	α-helix	trans	-61	-43.7	176.4	0	0	0	0	0	111.5	A14 Y21 A22	A14-A18 WeakPolarHBondContact O-CB 3.46Å; A14-A18 PolarHBondContact O-N 3.32Å; A18-Y21 PolarHBondContact O-N 3.48Å; A18-A22 WeakPolarHBondContact O-CB 3.5Å; A18-A22 PolarHBondContact O-N 2.85Å
19	G	87.9	Confident	82.8	Confident	33 Å²	33	97.1 Å²	97.1	34%	0.34	54%	0.544	S	S	.	.	H	α-helix	trans	-62.2	-43.5	176.1	0	0	0	0	0	112.9	A15 F17 Y21 A22 M23	A15-G19 PolarHBondContact O-N 3.33Å; F17-G19 VanDerWaalsContact C-N 3.34Å; F17-G19 PolarHBondContact O-N 3.02Å; G19-Y21 PolarHBondContact O-N 3.49Å; G19-A22 PolarHBondContact O-N 2.89Å; G19-M23 WeakPolarHBondContact O-CG 3.49Å; G19-M23 PolarHBondContact O-N 3.49Å
20	R	82.8	Confident	81.9	Confident	171 Å²	171	99.7 Å²	99.7	65%	0.645	55%	0.545	S	S	*	.	H	α-helix	trans	-63.3	-41.7	176.5	-172.2	-178.8	178.8	161.2	1.4	112	G16 F17 M23 Q24	G16-R20 WeakPolarHBondContact O-CB 3.4Å; G16-R20 PolarHBondContact O-N 3.42Å; F17-R20 PolarHBondContact O-N 3.22Å; R20-M23 PolarHBondContact O-N 2.86Å; R20-Q24 PolarHBondContact O-N 3.06Å
21	Y	85.8	Confident	80.7	Confident	179 Å²	179	98.6 Å²	98.6	70%	0.702	55%	0.545	S	S	*	.	H	α-helix	trans	-67	-43.1	178.7	-162.4	-93	0	0	0	111.7	F17 A18 G19 M23 Q24 A25	F17-Y21 WeakPolarHBondContact O-CB 3.05Å; F17-Y21 PolarHBondContact O-N 3.33Å; A18-Y21 PolarHBondContact O-N 3.48Å; G19-Y21 PolarHBondContact O-N 3.49Å; Y21-M23 VanDerWaalsContact C-N 3.35Å; Y21-M23 PolarHBondContact O-N 3.4Å; Y21-Q24 PolarHBondContact O-N 3.36Å; Y21-A25 WeakPolarHBondContact O-CB 3.49Å; Y21-A25 PolarHBondContact O-N 3.1Å
22	A	84.3	Confident	79.8	Confident	46 Å²	46	102.5 Å²	102.5	38%	0.38	55%	0.553	S	S	.	*	H	α-helix	trans	-59.1	-44	173.9	0	0	0	0	0	111.9	A18 G19 Q24 A25 M26	A18-A22 WeakPolarHBondContact O-CB 3.5Å; A18-A22 PolarHBondContact O-N 2.85Å; G19-A22 PolarHBondContact O-N 2.89Å; A22-Q24 VanDerWaalsContact C-N 3.34Å; A22-Q24 PolarHBondContact O-N 2.97Å; A22-A25 PolarHBondContact O-N 3.42Å; A22-M26 WeakPolarHBondContact O-CB 3.21Å; A22-M26 VanDerWaalsContact O-CG 3.31Å; A22-M26 WeakPolarHBondContact O-CG 3.28Å; A22-M26 PolarHBondContact O-N 3.28Å
23	M	79.6	Confident	78.8	Confident	127 Å²	127	99.1 Å²	99.1	63%	0.626	54%	0.537	S	S	*	.	H	α-helix	trans	-62.6	-39.2	175.5	-77.6	-167.8	-76.7	0	0	112.8	G19 R20 Y21 M26 K27	G19-M23 WeakPolarHBondContact O-CG 3.49Å; G19-M23 PolarHBondContact O-N 3.49Å; R20-M23 PolarHBondContact O-N 2.86Å; Y21-M23 VanDerWaalsContact C-N 3.35Å; Y21-M23 PolarHBondContact O-N 3.4Å; M23-M26 HydrophobicContact CG-CE 4.22Å; M23-M26 PolarHBondContact O-N 2.88Å; M23-K27 PolarHBondContact O-N 3.11Å; M23-K27 VanDerWaalsContact O-N 3.12Å
24	Q	77.4	Confident	77.8	Confident	125 Å²	125	102 Å²	102	58%	0.584	54%	0.54	S	S	*	.	H	α-helix	trans	-70.7	-36.3	179.3	-163.7	162.8	-1.9	0	0	112.2	R20 Y21 A22 K27	R20-Q24 PolarHBondContact O-N 3.06Å; Y21-Q24 PolarHBondContact O-N 3.36Å; A22-Q24 VanDerWaalsContact C-N 3.34Å; A22-Q24 PolarHBondContact O-N 2.97Å; Q24-K27 PolarHBondContact O-N 3.08Å
25	A	79	Confident	76.6	Confident	37 Å²	37	105.6 Å²	105.6	31%	0.306	55%	0.546	S	S	.	.	H	α-helix	trans	-66.6	-41.4	172.1	0	0	0	0	0	112.1	Y21 A22 K27 Q28	Y21-A25 WeakPolarHBondContact O-CB 3.49Å; Y21-A25 PolarHBondContact O-N 3.1Å; A22-A25 PolarHBondContact O-N 3.42Å; A25-K27 VanDerWaalsContact C-N 3.27Å; A25-K27 PolarHBondContact O-N 3.39Å; A25-Q28 PolarHBondContact O-N 3.46Å; A25-Q28 VanDerWaalsContact O-N 3.14Å
26	M	70.1	Confident	75.7	Confident	93 Å²	93	104.6 Å²	104.6	46%	0.458	54%	0.538	S	S	.	.	H	α-helix	trans	-63.6	-30.6	176.1	-74.8	-170.4	-70.9	0	0	112.9	A22 M23 Q28 M29 E30 V33	A22-M26 WeakPolarHBondContact O-CB 3.21Å; A22-M26 VanDerWaalsContact O-CG 3.31Å; A22-M26 WeakPolarHBondContact O-CG 3.28Å; A22-M26 PolarHBondContact O-N 3.28Å; M23-M26 HydrophobicContact CG-CE 4.22Å; M23-M26 PolarHBondContact O-N 2.88Å; M26-Q28 PolarHBondContact O-N 3.15Å; M26-M29 CarbonylContact O-C 3.45Å; M26-M29 PolarHBondContact O-N 2.94Å; M26-E30 PolarHBondContact O-N 3.28Å; M26-V33 HydrophobicContact CB-CG2 4.46Å; M26-V33 HydrophobicContact CG-CG2 4.48Å
27	K	67.4	Low	74.8	Confident	156 Å²	156	108.4 Å²	108.4	68%	0.678	55%	0.547	S	S	*	.	H	α-helix	trans	-64.3	-25.4	175.5	-165.9	176.7	179.9	-178.8	0	113	M23 Q24 A25	M23-K27 PolarHBondContact O-N 3.11Å; M23-K27 VanDerWaalsContact O-N 3.12Å; Q24-K27 PolarHBondContact O-N 3.08Å; A25-K27 VanDerWaalsContact C-N 3.27Å; A25-K27 PolarHBondContact O-N 3.39Å
28	Q	68.1	Low	73.7	Confident	178 Å²	178	108.3 Å²	108.3	83%	0.832	55%	0.548	S	S	*	.	H	α-helix	trans	-83.6	-13.6	174.7	-64.6	-168.6	-25.7	0	0	113	A25 M26	A25-Q28 PolarHBondContact O-N 3.46Å; A25-Q28 VanDerWaalsContact O-N 3.14Å; M26-Q28 PolarHBondContact O-N 3.15Å
29	M	67.3	Low	72.7	Confident	107 Å²	107	109.8 Å²	109.8	53%	0.527	56%	0.555	S	S	.	*	T	Hydrogen-bonded Turn	trans	-109.5	30.2	177.9	-56.7	-178.9	-155.7	0	0	111.8	M26 P31 Q32 V33	M26-M29 CarbonylContact O-C 3.45Å; M26-M29 PolarHBondContact O-N 2.94Å; M29-P31 VanDerWaalsContact C-CD 3.49Å; M29-Q32 PolarHBondContact O-N 3.02Å; M29-V33 HydrophobicContact CB-CG2 4.01Å; M29-V33 WeakPolarHBondContact O-CB 3.36Å; M29-V33 VanDerWaalsContact O-CG2 3.3Å; M29-V33 WeakPolarHBondContact O-CG2 3.13Å; M29-V33 PolarHBondContact O-N 3.11Å
30	E	64	Low	71.9	Confident	94 Å²	94	113.7 Å²	113.7	44%	0.439	56%	0.563	S	S	.	*	H	α-helix	trans	-46.9	-49.1	-175.9	-95.4	-144.5	177.1	0	0	115.6	M26 Q32 K34	M26-E30 PolarHBondContact O-N 3.28Å; E30-Q32 PolarHBondContact O-N 3.44Å; E30-K34 WeakPolarHBondContact O-CB 3.4Å; E30-K34 VanDerWaalsContact O-CG 3.27Å; E30-K34 WeakPolarHBondContact O-CG 3.4Å; E30-K34 PolarHBondContact O-N 2.94Å; E30-K34 IonicContact OE2-NZ 3.14Å; E30-K34 PolarHBondContact OE2-NZ 3.12Å
31	P	64.3	Low	71.1	Confident	96 Å²	96	109 Å²	109	62%	0.623	56%	0.555	S	S	*	*	H	α-helix	trans	-69.3	-36.2	-174.3	23.9	-31.5	0	0	0	112.8	M29 Q35	M29-P31 VanDerWaalsContact C-CD 3.49Å; P31-Q35 PolarHBondContact O-N 2.83Å
32	Q	65	Low	69.9	Low	144 Å²	144	109.3 Å²	109.3	67%	0.673	56%	0.56	S	S	*	*	H	α-helix	trans	-77	-38.3	179.5	-65.1	-178.9	37.1	0	0	111.8	M29 E30 Q35 A36	M29-Q32 PolarHBondContact O-N 3.02Å; E30-Q32 PolarHBondContact O-N 3.44Å; Q32-Q35 PolarHBondContact O-N 3.38Å; Q32-A36 WeakPolarHBondContact O-CB 3.41Å; Q32-A36 PolarHBondContact O-N 3.48Å
33	V	71.1	Confident	68.9	Low	49 Å²	49	112 Å²	112	30%	0.297	57%	0.571	S	S	.	*	H	α-helix	trans	-65.8	-41.9	175.8	174.6	0	0	0	0	110.5	M26 M29 Q35 A36 L37	M26-V33 HydrophobicContact CB-CG2 4.46Å; M26-V33 HydrophobicContact CG-CG2 4.48Å; M29-V33 HydrophobicContact CB-CG2 4.01Å; M29-V33 WeakPolarHBondContact O-CB 3.36Å; M29-V33 VanDerWaalsContact O-CG2 3.3Å; M29-V33 WeakPolarHBondContact O-CG2 3.13Å; M29-V33 PolarHBondContact O-N 3.11Å; V33-Q35 VanDerWaalsContact C-N 3.33Å; V33-Q35 PolarHBondContact O-N 2.97Å; V33-A36 PolarHBondContact O-N 3.46Å; V33-L37 WeakPolarHBondContact O-CB 3.27Å; V33-L37 PolarHBondContact O-N 3.02Å
34	K	66.9	Low	68.2	Low	111 Å²	111	109.2 Å²	109.2	48%	0.483	57%	0.569	S	S	.	*	H	α-helix	trans	-60.3	-41.9	174.8	-78.2	171.2	174.3	165.9	0	111.9	E30 L37 Q38	E30-K34 WeakPolarHBondContact O-CB 3.4Å; E30-K34 VanDerWaalsContact O-CG 3.27Å; E30-K34 WeakPolarHBondContact O-CG 3.4Å; E30-K34 PolarHBondContact O-N 2.94Å; E30-K34 IonicContact OE2-NZ 3.14Å; E30-K34 PolarHBondContact OE2-NZ 3.12Å; K34-L37 PolarHBondContact O-N 2.94Å; K34-Q38 WeakPolarHBondContact O-CB 3.44Å; K34-Q38 WeakPolarHBondContact O-CG 3.41Å; K34-Q38 PolarHBondContact O-N 3.37Å
35	Q	68	Low	67.5	Low	138 Å²	138	111.9 Å²	111.9	65%	0.645	58%	0.579	S	S	*	*	H	α-helix	trans	-69.4	-39.9	178.8	-166.1	171.1	5.5	0	0	112.3	P31 Q32 V33 Q38 S39	P31-Q35 PolarHBondContact O-N 2.83Å; Q32-Q35 PolarHBondContact O-N 3.38Å; V33-Q35 VanDerWaalsContact C-N 3.33Å; V33-Q35 PolarHBondContact O-N 2.97Å; Q35-Q38 PolarHBondContact O-N 3.3Å; Q35-S39 PolarHBondContact O-N 2.97Å; Q35-S39 PolarHBondContact O-OG 3.03Å
36	A	72.1	Confident	66.5	Low	44 Å²	44	112.8 Å²	112.8	36%	0.364	59%	0.591	S	S	.	*	H	α-helix	trans	-63.8	-45.4	172.5	0	0	0	0	0	111.4	Q32 V33 Q38 S39 F40	Q32-A36 WeakPolarHBondContact O-CB 3.41Å; Q32-A36 PolarHBondContact O-N 3.48Å; V33-A36 PolarHBondContact O-N 3.46Å; A36-Q38 VanDerWaalsContact C-N 3.25Å; A36-Q38 PolarHBondContact O-N 3.21Å; A36-S39 PolarHBondContact O-N 2.93Å; A36-S39 VanDerWaalsContact O-N 3.17Å; A36-S39 PolarHBondContact O-OG 3.19Å; A36-F40 WeakPolarHBondContact O-CD2 3.36Å; A36-F40 PolarHBondContact O-N 2.98Å
37	L	71.3	Confident	66	Low	127 Å²	127	110.8 Å²	110.8	67%	0.665	59%	0.594	S	S	*	*	H	α-helix	trans	-61.4	-33.4	176.4	-133.7	81.9	0	0	0	112.8	V33 K34	V33-L37 WeakPolarHBondContact O-CB 3.27Å; V33-L37 PolarHBondContact O-N 3.02Å; K34-L37 PolarHBondContact O-N 2.94Å
38	Q	67.1	Low	66	Low	157 Å²	157	106.3 Å²	106.3	73%	0.734	59%	0.593	S	S	*	*	H	α-helix	trans	-76.8	-28.7	176.6	-74.6	172.4	8.4	0	0	113.3	K34 Q35 A36 F40	K34-Q38 WeakPolarHBondContact O-CB 3.44Å; K34-Q38 WeakPolarHBondContact O-CG 3.41Å; K34-Q38 PolarHBondContact O-N 3.37Å; Q35-Q38 PolarHBondContact O-N 3.3Å; A36-Q38 VanDerWaalsContact C-N 3.25Å; A36-Q38 PolarHBondContact O-N 3.21Å; Q38-F40 VanDerWaalsContact C-N 3.33Å
39	S	68.3	Low	66.5	Low	94 Å²	94	108.7 Å²	108.7	66%	0.657	60%	0.596	S	S	*	*	H	α-helix	trans	-80.7	-15.1	173.7	66.5	0	0	0	0	112.8	Q35 A36 P41	Q35-S39 PolarHBondContact O-N 2.97Å; Q35-S39 PolarHBondContact O-OG 3.03Å; A36-S39 PolarHBondContact O-N 2.93Å; A36-S39 VanDerWaalsContact O-N 3.17Å; A36-S39 PolarHBondContact O-OG 3.19Å; S39-P41 WeakPolarHBondContact O-CD 3.43Å
40	F	70	Confident	67.3	Low	115 Å²	115	112 Å²	112	50%	0.504	60%	0.603	S	S	.	*	S	Bend	trans	-63.7	121.2	166.7	-81.7	-77.3	0	0	0	109.4	A36 Q38 K42	A36-F40 WeakPolarHBondContact O-CD2 3.36Å; A36-F40 PolarHBondContact O-N 2.98Å; Q38-F40 VanDerWaalsContact C-N 3.33Å; F40-K42 PolarHBondContact O-N 2.94Å; F40-K42 VanDerWaalsContact O-N 3.13Å
41	P	65.9	Low	68.3	Low	73 Å²	73	111.4 Å²	111.4	47%	0.474	62%	0.623	S	S	.	*			trans	-62.2	123.2	-178.1	23.6	-30.7	0	0	0	108.6	S39 T43 A44	S39-P41 WeakPolarHBondContact O-CD 3.43Å; P41-T43 PolarHBondContact O-N 3.19Å; P41-A44 HydrophobicContact CG-CB 4.21Å; P41-A44 VanDerWaalsContact O-CB 3.27Å; P41-A44 WeakPolarHBondContact O-CB 3.41Å; P41-A44 PolarHBondContact O-N 3.31Å
42	K	61	Low	69.4	Low	185 Å²	185	110.5 Å²	110.5	80%	0.804	63%	0.631	S	S	*	*	G	3₁₀ helix	trans	-56	-17.7	177.5	-66.5	178.5	-179	172.5	0	112.9	F40 A44	F40-K42 PolarHBondContact O-N 2.94Å; F40-K42 VanDerWaalsContact O-N 3.13Å; K42-A44 VanDerWaalsContact C-N 3.32Å
43	T	62.4	Low	70.7	Confident	101 Å²	101	107.3 Å²	107.3	62%	0.62	64%	0.637	S	S	*	*	G	3₁₀ helix	trans	-72.2	-19.4	172.4	50.8	0	0	0	0	114.3	P41 F45 G46 G47	P41-T43 PolarHBondContact O-N 3.19Å; T43-F45 VanDerWaalsContact C-N 3.28Å; T43-F45 PolarHBondContact O-N 2.93Å; T43-G46 PolarHBondContact O-N 2.95Å; T43-G47 PolarHBondContact O-N 3.1Å
44	A	65.6	Low	71.8	Confident	70 Å²	70	108.3 Å²	108.3	58%	0.579	64%	0.638	S	S	*	*	G	3₁₀ helix	trans	-71.5	-21	176.7	0	0	0	0	0	113.2	P41 K42	P41-A44 HydrophobicContact CG-CB 4.21Å; P41-A44 VanDerWaalsContact O-CB 3.27Å; P41-A44 WeakPolarHBondContact O-CB 3.41Å; P41-A44 PolarHBondContact O-N 3.31Å; K42-A44 VanDerWaalsContact C-N 3.32Å
45	F	63.3	Low	73.1	Confident	181 Å²	181	107 Å²	107	79%	0.794	63%	0.633	S	S	*	*	G	3₁₀ helix	trans	-103.7	22.3	178.4	-68.9	-77.5	0	0	0	113.5	T43	T43-F45 VanDerWaalsContact C-N 3.28Å; T43-F45 PolarHBondContact O-N 2.93Å
46	G	58.4	Low	74.3	Confident	55 Å²	55	107.2 Å²	107.2	57%	0.567	65%	0.646	S	S	*	*	S	Bend	trans	108	105.2	-173.9	0	0	0	0	0	109.5	T43 G48	T43-G46 PolarHBondContact O-N 2.95Å; G46-G48 PolarHBondContact O-N 3.24Å
47	G	58.1	Low	75.4	Confident	51 Å²	51	113.2 Å²	113.2	53%	0.526	66%	0.664	S	S	.	*	P	Polyproline II helix	trans	-47.5	130.6	176.5	0	0	0	0	0	110.9	T43 Y49	T43-G47 PolarHBondContact O-N 3.1Å; G47-Y49 PolarHBondContact O-N 3.31Å
48	G	68.9	Low	76.6	Confident	62 Å²	62	107.8 Å²	107.8	64%	0.639	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-50.5	137.9	177.7	0	0	0	0	0	110.8	G46	G46-G48 PolarHBondContact O-N 3.24Å
49	Y	77.4	Confident	78	Confident	228 Å²	228	102.7 Å²	102.7	89%	0.894	62%	0.616	S	S	*	*	P	Polyproline II helix	trans	-54.1	143.3	175.2	-59.8	-85.1	0	0	0	110.3	G47 G51	G47-Y49 PolarHBondContact O-N 3.31Å; Y49-G51 PolarHBondContact O-N 2.89Å
50	Y	83.9	Confident	79.2	Confident	176 Å²	176	101 Å²	101	69%	0.69	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-62.6	122	169.4	-64.8	-75.8	0	0	0	108.3	L65	Y50-L65 HydrophobicContact CE1-CD1 4.44Å; Y50-L65 HydrophobicContact CE2-CD1 4.45Å; Y50-L65 HydrophobicContact CE2-CD2 4.27Å; Y50-L65 WeakPolarHBondContact OH-CD2 3.46Å
51	G	84.6	Confident	80.4	Confident	82 Å²	82	104.2 Å²	104.2	85%	0.845	61%	0.605	S	S	*	*	S	Bend	trans	-70.2	135.8	177.6	0	0	0	0	0	110.9	Y49	Y49-G51 PolarHBondContact O-N 2.89Å
52	G	89.1	Confident	81.8	Confident	78 Å²	78	101.6 Å²	101.6	80%	0.804	59%	0.587	S	S	*	*	S	Bend	trans	105.6	-172.9	179.7	0	0	0	0	0	113.7
53	G	91.8	Very high	83.5	Confident	77 Å²	77	92.8 Å²	92.8	79%	0.794	55%	0.548	S	S	*	.			trans	-100.8	-169.6	173.9	0	0	0	0	0	112.2
54	F	94.7	Very high	85.1	Confident	70 Å²	70	88.2 Å²	88.2	31%	0.307	52%	0.521	S	S	.	.			trans	-63.5	150.1	170	-65.4	-76	0	0	0	111.1	E62 I66 Y98 I99 K102	F54-E62 WeakPolarHBondContact CA-OE1 2.83Å; F54-E62 VanDerWaalsContact CB-OE1 3.31Å; F54-E62 WeakPolarHBondContact CB-OE1 3.22Å; F54-E62 VanDerWaalsContact CD1-OE1 3.27Å; F54-E62 WeakPolarHBondContact CD1-OE1 3.16Å; F54-I66 HydrophobicContact CD1-CD1 3.88Å; F54-I66 HydrophobicContact CE1-CD1 3.62Å; F54-I66 HydrophobicContact CE1-CG1 3.95Å; F54-Y98 AromaticContact CD2-CE1 3.6Å; F54-Y98 HydrophobicContact CD2-CE1 3.6Å; F54-Y98 AromaticContact CD2-CZ 3.96Å; F54-Y98 HydrophobicContact CE2-CD1 4.44Å; F54-Y98 AromaticContact CE2-CE1 3.83Å; F54-Y98 HydrophobicContact CE2-CE1 3.83Å; F54-I99 HydrophobicContact CE2-CD1 3.75Å; F54-I99 HydrophobicContact CZ-CD1 3.91Å; F54-K102 HydrophobicContact CB-CD 4.1Å; F54-K102 HydrophobicContact CD1-CB 4.48Å; F54-K102 HydrophobicContact CD1-CD 3.93Å; F54-K102 HydrophobicContact CD1-CG 4.16Å; F54-K102 HydrophobicContact CD2-CD 4.17Å; F54-K102 HydrophobicContact CD2-CG 3.93Å; F54-K102 HydrophobicContact CE1-CB 4.13Å; F54-K102 HydrophobicContact CE1-CD 4.41Å; F54-K102 HydrophobicContact CE1-CG 4.2Å; F54-K102 HydrophobicContact CE2-CB 4.44Å; F54-K102 HydrophobicContact CE2-CG 3.96Å; F54-K102 HydrophobicContact CG-CD 3.79Å; F54-K102 HydrophobicContact CG-CG 4.03Å; F54-K102 HydrophobicContact CZ-CB 4.1Å; F54-K102 HydrophobicContact CZ-CG 4.1Å
55	E	92.9	Very high	86.5	Confident	82 Å²	82	88.6 Å²	88.6	38%	0.383	51%	0.512	S	S	.	.			trans	-64.8	147	173.4	-61.8	-176.1	171.5	0	0	109.8	K57 T59 E62	E55-K57 PolarHBondContact O-N 3.25Å; E55-K57 VanDerWaalsContact O-N 3.13Å; E55-T59 WeakPolarHBondContact OE2-CB 3.37Å; E55-T59 WeakPolarHBondContact OE2-CG2 3.41Å; E55-T59 PolarHBondContact OE2-OG1 2.95Å; E55-E62 WeakPolarHBondContact CB-OE2 3.41Å; E55-E62 PolarHBondContact N-OE1 3.27Å
56	P	93.9	Very high	88.1	Confident	143 Å²	143	81.7 Å²	81.7	93%	0.929	48%	0.484	S	S	*	.	S	Bend	trans	-58.3	-27.9	179.1	-25.6	33.9	0	0	0	113.5
57	K	95	Very high	89.9	Confident	171 Å²	171	79.4 Å²	79.4	74%	0.743	46%	0.458	S	S	*	.	S	Bend	trans	-132	126.1	177.3	-179.3	178.7	-177.8	177.2	0	108.3	E55 T59	E55-K57 PolarHBondContact O-N 3.25Å; E55-K57 VanDerWaalsContact O-N 3.13Å; K57-T59 PolarHBondContact O-N 2.94Å
58	M	95.9	Very high	91.7	Very high	12 Å²	12	80.2 Å²	80.2	6%	0.059	47%	0.466	C	S	.	.			trans	-57.6	125.1	-179.4	-173.7	65.4	61.8	0	0	111.6	E62 A63 I66 K102 E105 A106 L109	M58-E62 HydrophobicContact SD-CB 4.05Å; M58-E62 HydrophobicContact SD-CG 3.84Å; M58-E62 VanDerWaalsContact SD-OE2 3.41Å; M58-A63 HydrophobicContact CG-CB 4.15Å; M58-A63 HydrophobicContact SD-CB 3.94Å; M58-I66 HydrophobicContact CE-CD1 3.59Å; M58-I66 HydrophobicContact SD-CD1 3.89Å; M58-K102 HydrophobicContact CE-CD 3.78Å; M58-E105 VanDerWaalsContact CB-CD 3.45Å; M58-E105 HydrophobicContact CB-CG 3.66Å; M58-E105 WeakPolarHBondContact CB-OE1 3.43Å; M58-E105 HydrophobicContact CE-CB 3.96Å; M58-E105 HydrophobicContact CE-CG 3.95Å; M58-E105 WeakPolarHBondContact CE-OE2 3.4Å; M58-E105 HydrophobicContact CG-CG 3.98Å; M58-A106 HydrophobicContact CE-CB 4.34Å; M58-A106 HydrophobicContact SD-CB 4.25Å; M58-L109 HydrophobicContact CB-CD1 4.13Å; M58-L109 HydrophobicContact CG-CB 4.42Å; M58-L109 HydrophobicContact CG-CD1 3.78Å; M58-L109 WeakPolarHBondContact O-CD1 3.48Å
59	T	95.9	Very high	93	Very high	51 Å²	51	78 Å²	78	31%	0.313	44%	0.44	S	S	.	.			trans	-104.8	162.5	174.1	62.3	0	0	0	0	111.6	E55 K57 R61 E62 A63	E55-T59 WeakPolarHBondContact OE2-CB 3.37Å; E55-T59 WeakPolarHBondContact OE2-CG2 3.41Å; E55-T59 PolarHBondContact OE2-OG1 2.95Å; K57-T59 PolarHBondContact O-N 2.94Å; T59-R61 PolarHBondContact O-N 3.18Å; T59-E62 PolarHBondContact O-N 3.02Å; T59-E62 WeakPolarHBondContact OG1-CB 3.32Å; T59-E62 PolarHBondContact OG1-N 3.13Å; T59-A63 VanDerWaalsContact O-CB 3.3Å; T59-A63 WeakPolarHBondContact O-CB 3.35Å; T59-A63 PolarHBondContact O-N 2.87Å
60	K	94.7	Very high	93.7	Very high	58 Å²	58	69.7 Å²	69.7	25%	0.252	42%	0.416	S	S	.	.	H	α-helix	trans	-57	-40.1	175.8	-171.9	-171.1	-172.9	139.4	0	111.9	A64 P71 L109 M110 Q113	K60-A64 WeakPolarHBondContact O-CB 3.48Å; K60-A64 PolarHBondContact O-N 2.72Å; K60-P71 HydrophobicContact CD-CB 4.35Å; K60-P71 WeakPolarHBondContact CE-O 3.48Å; K60-P71 PolarHBondContact NZ-O 2.83Å; K60-L109 HydrophobicContact CB-CD2 4.22Å; K60-M110 HydrophobicContact CG-SD 4.11Å; K60-Q113 VanDerWaalsContact CG-OE1 3.29Å
61	R	94.3	Very high	94.1	Very high	183 Å²	183	64.5 Å²	64.5	69%	0.691	40%	0.403	S	S	*	.	H	α-helix	trans	-65.3	-51.4	-179.5	179.8	-179.6	174.2	155.9	-1.4	110.2	T59 A63 A64 L65	T59-R61 PolarHBondContact O-N 3.18Å; R61-A63 PolarHBondContact O-N 3.24Å; R61-A64 PolarHBondContact O-N 2.96Å; R61-L65 HydrophobicContact CG-CD1 4.18Å; R61-L65 VanDerWaalsContact O-CG 3.31Å; R61-L65 WeakPolarHBondContact O-CG 3.35Å; R61-L65 PolarHBondContact O-N 3.14Å
62	E	95.8	Very high	94.4	Very high	18 Å²	18	65.5 Å²	65.5	8%	0.084	39%	0.393	C	S	.	.	H	α-helix	trans	-60.3	-45.7	178	-175.5	-179.7	-144.4	0	0	111.6	F54 E55 M58 T59 A64 L65 I66	F54-E62 WeakPolarHBondContact CA-OE1 2.83Å; F54-E62 VanDerWaalsContact CB-OE1 3.31Å; F54-E62 WeakPolarHBondContact CB-OE1 3.22Å; F54-E62 VanDerWaalsContact CD1-OE1 3.27Å; F54-E62 WeakPolarHBondContact CD1-OE1 3.16Å; E55-E62 WeakPolarHBondContact CB-OE2 3.41Å; E55-E62 PolarHBondContact N-OE1 3.27Å; M58-E62 HydrophobicContact SD-CB 4.05Å; M58-E62 HydrophobicContact SD-CG 3.84Å; M58-E62 VanDerWaalsContact SD-OE2 3.41Å; T59-E62 PolarHBondContact O-N 3.02Å; T59-E62 WeakPolarHBondContact OG1-CB 3.32Å; T59-E62 PolarHBondContact OG1-N 3.13Å; E62-A64 VanDerWaalsContact C-N 3.33Å; E62-A64 PolarHBondContact O-N 3.48Å; E62-L65 WeakPolarHBondContact O-CB 3.44Å; E62-L65 PolarHBondContact O-N 3Å; E62-L65 VanDerWaalsContact O-N 3.09Å; E62-I66 HydrophobicContact CG-CD1 3.8Å; E62-I66 HydrophobicContact CG-CG1 4.29Å; E62-I66 WeakPolarHBondContact O-CG1 3.36Å; E62-I66 PolarHBondContact O-N 3.46Å
63	A	97.1	Very high	94.6	Very high	0 Å²	0	62.4 Å²	62.4	0%	0	36%	0.36	C	S	.	.	H	α-helix	trans	-59.2	-42.6	178.3	0	0	0	0	0	112.7	M58 T59 R61 L65 L67 A106 L109 M110	M58-A63 HydrophobicContact CG-CB 4.15Å; M58-A63 HydrophobicContact SD-CB 3.94Å; T59-A63 VanDerWaalsContact O-CB 3.3Å; T59-A63 WeakPolarHBondContact O-CB 3.35Å; T59-A63 PolarHBondContact O-N 2.87Å; R61-A63 PolarHBondContact O-N 3.24Å; A63-L65 VanDerWaalsContact C-N 3.34Å; A63-L67 WeakPolarHBondContact O-CB 3.35Å; A63-L67 WeakPolarHBondContact O-CG 2.92Å; A63-L67 PolarHBondContact O-N 3.48Å; A63-A106 HydrophobicContact CB-CB 3.83Å; A63-L109 HydrophobicContact CB-CD2 4.25Å; A63-M110 HydrophobicContact CB-CG 3.72Å; A63-M110 HydrophobicContact CB-SD 4.21Å
64	A	96	Very high	94.6	Very high	5 Å²	5	63.5 Å²	63.5	4%	0.041	35%	0.348	C	S	.	.	H	α-helix	trans	-64.2	-39.2	175.8	0	0	0	0	0	112	K60 R61 E62 G68 V69 P71 M110	K60-A64 WeakPolarHBondContact O-CB 3.48Å; K60-A64 PolarHBondContact O-N 2.72Å; R61-A64 PolarHBondContact O-N 2.96Å; E62-A64 VanDerWaalsContact C-N 3.33Å; E62-A64 PolarHBondContact O-N 3.48Å; A64-G68 PolarHBondContact O-N 3.09Å; A64-V69 WeakPolarHBondContact CB-O 3.34Å; A64-V69 PolarHBondContact O-N 3.03Å; A64-P71 HydrophobicContact CB-CB 4.41Å; A64-P71 HydrophobicContact CB-CG 4.05Å; A64-M110 HydrophobicContact CB-CE 4.23Å
65	L	95.4	Very high	94.5	Very high	77 Å²	77	63.1 Å²	63.1	40%	0.403	35%	0.346	S	S	.	.	H	α-helix	trans	-67.4	-45.8	176.3	-70.2	173.2	0	0	0	112.1	Y50 R61 E62 A63 L67 G68	Y50-L65 HydrophobicContact CE1-CD1 4.44Å; Y50-L65 HydrophobicContact CE2-CD1 4.45Å; Y50-L65 HydrophobicContact CE2-CD2 4.27Å; Y50-L65 WeakPolarHBondContact OH-CD2 3.46Å; R61-L65 HydrophobicContact CG-CD1 4.18Å; R61-L65 VanDerWaalsContact O-CG 3.31Å; R61-L65 WeakPolarHBondContact O-CG 3.35Å; R61-L65 PolarHBondContact O-N 3.14Å; E62-L65 WeakPolarHBondContact O-CB 3.44Å; E62-L65 PolarHBondContact O-N 3Å; E62-L65 VanDerWaalsContact O-N 3.09Å; A63-L65 VanDerWaalsContact C-N 3.34Å; L65-L67 VanDerWaalsContact C-N 3.32Å; L65-L67 PolarHBondContact O-N 3.42Å; L65-G68 PolarHBondContact O-N 3.03Å; L65-G68 VanDerWaalsContact O-N 3.14Å
66	I	96.1	Very high	94.6	Very high	37 Å²	37	64.8 Å²	64.8	19%	0.19	36%	0.358	C	S	.	.	H	α-helix	trans	-58.7	-45.5	177.4	-70.4	170.4	0	0	0	110.7	F54 M58 E62 G68 L85 I103 A106	F54-I66 HydrophobicContact CD1-CD1 3.88Å; F54-I66 HydrophobicContact CE1-CD1 3.62Å; F54-I66 HydrophobicContact CE1-CG1 3.95Å; M58-I66 HydrophobicContact CE-CD1 3.59Å; M58-I66 HydrophobicContact SD-CD1 3.89Å; E62-I66 HydrophobicContact CG-CD1 3.8Å; E62-I66 HydrophobicContact CG-CG1 4.29Å; E62-I66 WeakPolarHBondContact O-CG1 3.36Å; E62-I66 PolarHBondContact O-N 3.46Å; I66-G68 VanDerWaalsContact C-N 3.29Å; I66-G68 PolarHBondContact O-N 3.35Å; I66-L85 VanDerWaalsContact O-CD1 3.24Å; I66-L85 WeakPolarHBondContact O-CD1 3.42Å; I66-I103 HydrophobicContact CG2-CG1 4.09Å; I66-A106 HydrophobicContact CB-CB 4.09Å; I66-A106 HydrophobicContact CD1-CB 4.25Å; I66-A106 HydrophobicContact CG2-CB 3.95Å
67	L	96.6	Very high	94.6	Very high	7 Å²	7	63.4 Å²	63.4	4%	0.037	34%	0.337	C	S	.	.	H	α-helix	trans	-78.7	-12	-179.5	-65.6	177.3	0	0	0	113.2	A63 L65 V69 I78 A81 H82 L85 A106 M110	A63-L67 WeakPolarHBondContact O-CB 3.35Å; A63-L67 WeakPolarHBondContact O-CG 2.92Å; A63-L67 PolarHBondContact O-N 3.48Å; L65-L67 VanDerWaalsContact C-N 3.32Å; L65-L67 PolarHBondContact O-N 3.42Å; L67-V69 VanDerWaalsContact C-N 3.32Å; L67-V69 HydrophobicContact CB-CG1 4.34Å; L67-V69 HydrophobicContact CB-CG2 3.87Å; L67-V69 PolarHBondContact O-N 3.07Å; L67-I78 HydrophobicContact CD1-CG2 4.07Å; L67-A81 HydrophobicContact CB-CB 4.38Å; L67-A81 WeakPolarHBondContact O-CB 3.48Å; L67-H82 HydrophobicContact CD2-CB 4.29Å; L67-L85 HydrophobicContact CD2-CD1 4.01Å; L67-A106 HydrophobicContact CD1-CB 4.37Å; L67-A106 HydrophobicContact CD2-CB 4.45Å; L67-A106 HydrophobicContact CG-CB 4.07Å; L67-M110 HydrophobicContact CD1-CB 4.35Å; L67-M110 HydrophobicContact CD1-CG 4.11Å
68	G	95.1	Very high	94.7	Very high	67 Å²	67	55.3 Å²	55.3	69%	0.691	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.6	35.8	-175.3	0	0	0	0	0	113.1	A64 L65 I66	A64-G68 PolarHBondContact O-N 3.09Å; L65-G68 PolarHBondContact O-N 3.03Å; L65-G68 VanDerWaalsContact O-N 3.14Å; I66-G68 VanDerWaalsContact C-N 3.29Å; I66-G68 PolarHBondContact O-N 3.35Å
69	V	96.1	Very high	94.7	Very high	16 Å²	16	60.6 Å²	60.6	10%	0.097	32%	0.321	C	S	.	.	S	Bend	trans	-124	163	-178.1	-59.2	0	0	0	0	111.7	A64 L67 A73 K77 A81 M110	A64-V69 WeakPolarHBondContact CB-O 3.34Å; A64-V69 PolarHBondContact O-N 3.03Å; L67-V69 VanDerWaalsContact C-N 3.32Å; L67-V69 HydrophobicContact CB-CG1 4.34Å; L67-V69 HydrophobicContact CB-CG2 3.87Å; L67-V69 PolarHBondContact O-N 3.07Å; V69-A73 HydrophobicContact CB-CB 3.87Å; V69-A73 HydrophobicContact CG2-CB 4.01Å; V69-K77 HydrophobicContact CG1-CG 4.1Å; V69-A81 HydrophobicContact CG1-CB 3.74Å; V69-M110 HydrophobicContact CG2-CE 4.11Å
70	S	93.5	Very high	94.8	Very high	54 Å²	54	62 Å²	62	38%	0.378	32%	0.324	S	S	.	.			trans	-62	144.9	170.8	177.1	0	0	0	0	110.6	T72 A73	S70-T72 PolarHBondContact O-N 3.5Å; S70-T72 PolarHBondContact OG-N 2.88Å; S70-T72 PolarHBondContact OG-OG1 3.34Å; S70-A73 WeakPolarHBondContact O-CB 3.43Å; S70-A73 PolarHBondContact O-N 3.34Å
71	P	92	Very high	94.9	Very high	66 Å²	66	60 Å²	60	43%	0.429	32%	0.318	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56	-19	169	-23.8	33.6	0	0	0	113.9	K60 A64	K60-P71 HydrophobicContact CD-CB 4.35Å; K60-P71 WeakPolarHBondContact CE-O 3.48Å; K60-P71 PolarHBondContact NZ-O 2.83Å; A64-P71 HydrophobicContact CB-CB 4.41Å; A64-P71 HydrophobicContact CB-CG 4.05Å
72	T	91.1	Very high	95.1	Very high	103 Å²	103	53 Å²	53	63%	0.632	29%	0.294	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107.3	16.8	177.5	57.6	0	0	0	0	112.9	S70	S70-T72 PolarHBondContact O-N 3.5Å; S70-T72 PolarHBondContact OG-N 2.88Å; S70-T72 PolarHBondContact OG-OG1 3.34Å
73	A	92.1	Very high	95.2	Very high	14 Å²	14	58.8 Å²	58.8	12%	0.116	32%	0.315	C	S	.	.			trans	-61.1	145.1	-179.2	0	0	0	0	0	112.4	V69 S70 K77 I78	V69-A73 HydrophobicContact CB-CB 3.87Å; V69-A73 HydrophobicContact CG2-CB 4.01Å; S70-A73 WeakPolarHBondContact O-CB 3.43Å; S70-A73 PolarHBondContact O-N 3.34Å; A73-K77 HydrophobicContact CB-CD 4.46Å; A73-I78 HydrophobicContact CB-CG1 4.2Å; A73-I78 WeakPolarHBondContact O-CD1 3.3Å
74	N	92.9	Very high	95.2	Very high	99 Å²	99	64.3 Å²	64.3	53%	0.529	34%	0.339	S	S	.	.			trans	-70.5	160.8	175.2	68.2	30.5	0	0	0	112	N76 K77 I78	N74-N76 PolarHBondContact O-N 2.66Å; N74-N76 PolarHBondContact OD1-N 2.99Å; N74-K77 PolarHBondContact O-N 2.94Å; N74-K77 WeakPolarHBondContact OD1-CB 3.38Å; N74-K77 PolarHBondContact OD1-N 3.45Å; N74-I78 WeakPolarHBondContact O-CG1 3.45Å; N74-I78 PolarHBondContact O-N 2.79Å; N74-I78 VanDerWaalsContact O-N 3.12Å
75	K	92.9	Very high	95.3	Very high	63 Å²	63	66.1 Å²	66.1	27%	0.274	35%	0.347	S	S	.	.	H	α-helix	trans	-56.4	-36.3	-178.8	-68.1	177.8	-175.9	159.9	0	113.1	I78 R79 A114	K75-I78 PolarHBondContact O-N 3.36Å; K75-R79 VanDerWaalsContact O-CG 3.3Å; K75-R79 WeakPolarHBondContact O-CG 3.46Å; K75-R79 PolarHBondContact O-N 3.3Å; K75-A114 HydrophobicContact CD-CB 4.36Å; K75-A114 VanDerWaalsContact CE-C 3.46Å; K75-A114 VanDerWaalsContact CE-O 3.26Å; K75-A114 WeakPolarHBondContact CE-O 3.24Å; K75-A114 HydrophobicContact CG-CB 3.57Å
76	N	94.3	Very high	95.4	Very high	117 Å²	117	63.7 Å²	63.7	63%	0.626	33%	0.334	S	S	*	.	H	α-helix	trans	-66.3	-44.5	-178.4	-67.1	-13.3	0	0	0	111.3	N74 R79 E80	N74-N76 PolarHBondContact O-N 2.66Å; N74-N76 PolarHBondContact OD1-N 2.99Å; N76-R79 PolarHBondContact O-N 3.32Å; N76-E80 WeakPolarHBondContact O-CB 3.49Å; N76-E80 PolarHBondContact O-N 3.49Å
77	K	95.1	Very high	95.4	Very high	114 Å²	114	65.5 Å²	65.5	50%	0.496	35%	0.347	S	S	.	.	H	α-helix	trans	-66.9	-38.6	178.1	-169.2	168.7	-175.2	171.2	0	111.9	V69 A73 N74 E80 A81	V69-K77 HydrophobicContact CG1-CG 4.1Å; A73-K77 HydrophobicContact CB-CD 4.46Å; N74-K77 PolarHBondContact O-N 2.94Å; N74-K77 WeakPolarHBondContact OD1-CB 3.38Å; N74-K77 PolarHBondContact OD1-N 3.45Å; K77-E80 PolarHBondContact O-N 3.49Å; K77-A81 WeakPolarHBondContact O-CB 3.4Å; K77-A81 PolarHBondContact O-N 3.45Å
78	I	95.9	Very high	95.4	Very high	1 Å²	1	71.5 Å²	71.5	1%	0.005	38%	0.378	C	S	.	.	H	α-helix	trans	-59.3	-50.4	174	-68	161.5	0	0	0	110.5	L67 A73 N74 K75 E80 A81 H82 K107 M110 A114	L67-I78 HydrophobicContact CD1-CG2 4.07Å; A73-I78 HydrophobicContact CB-CG1 4.2Å; A73-I78 WeakPolarHBondContact O-CD1 3.3Å; N74-I78 WeakPolarHBondContact O-CG1 3.45Å; N74-I78 PolarHBondContact O-N 2.79Å; N74-I78 VanDerWaalsContact O-N 3.12Å; K75-I78 PolarHBondContact O-N 3.36Å; I78-E80 PolarHBondContact O-N 3.21Å; I78-A81 PolarHBondContact O-N 3.41Å; I78-H82 WeakPolarHBondContact O-CB 3.22Å; I78-H82 PolarHBondContact O-N 2.82Å; I78-K107 HydrophobicContact CG2-CG 4.47Å; I78-M110 HydrophobicContact CD1-CB 3.88Å; I78-M110 HydrophobicContact CD1-CE 4.4Å; I78-M110 HydrophobicContact CG1-CB 4.25Å; I78-M110 HydrophobicContact CG2-CB 4.04Å; I78-A114 HydrophobicContact CD1-CB 4.29Å
79	R	96.1	Very high	95.5	Very high	122 Å²	122	70.5 Å²	70.5	46%	0.46	36%	0.357	S	S	.	.	H	α-helix	trans	-65.4	-38	179.9	-71.6	171	178.1	175.6	-6.7	113.1	K75 N76 R83	K75-R79 VanDerWaalsContact O-CG 3.3Å; K75-R79 WeakPolarHBondContact O-CG 3.46Å; K75-R79 PolarHBondContact O-N 3.3Å; N76-R79 PolarHBondContact O-N 3.32Å; R79-R83 WeakPolarHBondContact O-CB 3.49Å; R79-R83 PolarHBondContact O-N 3.06Å
80	E	97.4	Very high	95.5	Very high	81 Å²	81	72.6 Å²	72.6	38%	0.379	37%	0.366	S	S	.	.	H	α-helix	trans	-64.4	-47.5	175.7	-176.3	-176.4	169.4	0	0	111.6	N76 K77 I78 R83 K84	N76-E80 WeakPolarHBondContact O-CB 3.49Å; N76-E80 PolarHBondContact O-N 3.49Å; K77-E80 PolarHBondContact O-N 3.49Å; I78-E80 PolarHBondContact O-N 3.21Å; E80-R83 PolarHBondContact O-N 3.31Å; E80-K84 HydrophobicContact CG-CD 4.43Å; E80-K84 WeakPolarHBondContact O-CG 3.31Å; E80-K84 PolarHBondContact O-N 3.31Å; E80-K84 VanDerWaalsContact O-N 3.08Å; E80-K84 WeakPolarHBondContact OE1-CE 3.15Å; E80-K84 IonicContact OE1-NZ 2.88Å; E80-K84 PolarHBondContact OE1-NZ 3.03Å
81	A	97.7	Very high	95.7	Very high	16 Å²	16	72.3 Å²	72.3	13%	0.132	36%	0.362	C	S	.	.	H	α-helix	trans	-61.4	-46.4	177.5	0	0	0	0	0	111.7	L67 V69 K77 I78 R83 K84 L85	L67-A81 HydrophobicContact CB-CB 4.38Å; L67-A81 WeakPolarHBondContact O-CB 3.48Å; V69-A81 HydrophobicContact CG1-CB 3.74Å; K77-A81 WeakPolarHBondContact O-CB 3.4Å; K77-A81 PolarHBondContact O-N 3.45Å; I78-A81 PolarHBondContact O-N 3.41Å; A81-R83 PolarHBondContact O-N 3.24Å; A81-K84 PolarHBondContact O-N 3.4Å; A81-L85 WeakPolarHBondContact O-CG 3.27Å; A81-L85 PolarHBondContact O-N 3.24Å
82	H	97.9	Very high	95.9	Very high	37 Å²	37	75.8 Å²	75.8	17%	0.171	38%	0.378	C	S	.	.	H	α-helix	trans	-56.1	-49.4	175.6	170.7	-100.4	0	0	0	112	L67 I78 K84 L85 M86 N104 K107	L67-H82 HydrophobicContact CD2-CB 4.29Å; I78-H82 WeakPolarHBondContact O-CB 3.22Å; I78-H82 PolarHBondContact O-N 2.82Å; H82-K84 PolarHBondContact O-N 2.95Å; H82-L85 PolarHBondContact O-N 2.97Å; H82-M86 WeakPolarHBondContact O-CB 3.27Å; H82-M86 PolarHBondContact O-N 3.13Å; H82-N104 PolarHBondContact NE2-OD1 3.42Å; H82-K107 HydrophobicContact CB-CB 4.13Å; H82-K107 HydrophobicContact CB-CG 3.93Å
83	R	97.9	Very high	96.2	Very high	139 Å²	139	79.2 Å²	79.2	53%	0.525	38%	0.379	S	S	.	.	H	α-helix	trans	-58.9	-45.7	178.8	-177.4	179.4	62.7	-101.7	3.4	111.8	R79 E80 A81 M86 V87	R79-R83 WeakPolarHBondContact O-CB 3.49Å; R79-R83 PolarHBondContact O-N 3.06Å; E80-R83 PolarHBondContact O-N 3.31Å; A81-R83 PolarHBondContact O-N 3.24Å; R83-M86 PolarHBondContact O-N 3.15Å; R83-V87 WeakPolarHBondContact O-CB 3.32Å; R83-V87 VanDerWaalsContact O-CG2 3.28Å; R83-V87 WeakPolarHBondContact O-CG2 3.33Å; R83-V87 PolarHBondContact O-N 2.98Å
84	K	97.8	Very high	96.3	Very high	116 Å²	116	82.1 Å²	82.1	50%	0.504	41%	0.41	S	S	.	.	H	α-helix	trans	-60.8	-47.1	178.4	-72.3	176.8	-175.5	173.4	0	111.3	E80 A81 H82 L88	E80-K84 HydrophobicContact CG-CD 4.43Å; E80-K84 WeakPolarHBondContact O-CG 3.31Å; E80-K84 PolarHBondContact O-N 3.31Å; E80-K84 VanDerWaalsContact O-N 3.08Å; E80-K84 WeakPolarHBondContact OE1-CE 3.15Å; E80-K84 IonicContact OE1-NZ 2.88Å; E80-K84 PolarHBondContact OE1-NZ 3.03Å; A81-K84 PolarHBondContact O-N 3.4Å; H82-K84 PolarHBondContact O-N 2.95Å; K84-L88 WeakPolarHBondContact O-CG 3.31Å; K84-L88 PolarHBondContact O-N 2.99Å
85	L	97.4	Very high	96.4	Very high	43 Å²	43	78.2 Å²	78.2	23%	0.225	39%	0.394	C	S	.	.	H	α-helix	trans	-66.8	-40.9	-179.6	-73.5	171	0	0	0	112.3	I66 L67 A81 H82 L88 N89 I103	I66-L85 VanDerWaalsContact O-CD1 3.24Å; I66-L85 WeakPolarHBondContact O-CD1 3.42Å; L67-L85 HydrophobicContact CD2-CD1 4.01Å; A81-L85 WeakPolarHBondContact O-CG 3.27Å; A81-L85 PolarHBondContact O-N 3.24Å; H82-L85 PolarHBondContact O-N 2.97Å; L85-L88 PolarHBondContact O-N 2.81Å; L85-N89 WeakPolarHBondContact O-CB 3.35Å; L85-N89 PolarHBondContact O-N 2.89Å; L85-N89 PolarHBondContact O-ND2 3.12Å; L85-I103 HydrophobicContact CB-CD1 4.08Å; L85-I103 HydrophobicContact CB-CG1 4.46Å; L85-I103 HydrophobicContact CB-CG2 4.08Å
86	M	97.6	Very high	96.7	Very high	26 Å²	26	77.8 Å²	77.8	13%	0.128	40%	0.398	C	S	.	.	H	α-helix	trans	-67.5	-38.7	179.9	-170.7	57	64.2	0	0	111.9	H82 R83 L88 N89 H90 A100 I103 N104	H82-M86 WeakPolarHBondContact O-CB 3.27Å; H82-M86 PolarHBondContact O-N 3.13Å; R83-M86 PolarHBondContact O-N 3.15Å; M86-L88 PolarHBondContact O-N 2.99Å; M86-N89 PolarHBondContact O-N 3.44Å; M86-H90 WeakPolarHBondContact O-CA 3.23Å; M86-H90 VanDerWaalsContact O-CB 3.32Å; M86-H90 WeakPolarHBondContact O-CB 3.17Å; M86-H90 PolarHBondContact O-N 3.4Å; M86-A100 HydrophobicContact CE-CB 4.28Å; M86-A100 HydrophobicContact SD-CB 4.09Å; M86-I103 HydrophobicContact CE-CB 4.27Å; M86-I103 HydrophobicContact CE-CG2 3.97Å; M86-N104 WeakPolarHBondContact CE-OD1 3.43Å
87	V	97.1	Very high	96.8	Very high	75 Å²	75	76.6 Å²	76.6	46%	0.455	40%	0.397	S	S	.	.	H	α-helix	trans	-56.8	-36.6	175.3	161.1	0	0	0	0	112.1	R83 R93	R83-V87 WeakPolarHBondContact O-CB 3.32Å; R83-V87 VanDerWaalsContact O-CG2 3.28Å; R83-V87 WeakPolarHBondContact O-CG2 3.33Å; R83-V87 PolarHBondContact O-N 2.98Å; V87-R93 PolarHBondContact O-NH1 3.02Å
88	L	95.9	Very high	96.9	Very high	132 Å²	132	77.4 Å²	77.4	69%	0.691	40%	0.398	S	S	*	.	H	α-helix	trans	-82.7	-33.1	-179.9	-64.9	171.4	0	0	0	113.1	K84 L85 M86	K84-L88 WeakPolarHBondContact O-CG 3.31Å; K84-L88 PolarHBondContact O-N 2.99Å; L85-L88 PolarHBondContact O-N 2.81Å; M86-L88 PolarHBondContact O-N 2.99Å
89	N	97.3	Very high	96.9	Very high	47 Å²	47	79.9 Å²	79.9	25%	0.251	41%	0.41	S	S	.	.	H	α-helix	trans	-109.3	12	-172	-65.6	-85	0	0	0	113.7	L85 M86 G95 I99 I103	L85-N89 WeakPolarHBondContact O-CB 3.35Å; L85-N89 PolarHBondContact O-N 2.89Å; L85-N89 PolarHBondContact O-ND2 3.12Å; M86-N89 PolarHBondContact O-N 3.44Å; N89-G95 WeakPolarHBondContact O-CA 3.45Å; N89-I99 HydrophobicContact CB-CG2 4.25Å; N89-I103 HydrophobicContact CB-CD1 3.71Å
90	H	96.6	Very high	97	Very high	59 Å²	59	74.3 Å²	74.3	27%	0.273	39%	0.391	S	S	.	.			trans	-61.9	133.1	-177.2	-159	-83.2	0	0	0	111.2	M86 D92 R93 G95	M86-H90 WeakPolarHBondContact O-CA 3.23Å; M86-H90 VanDerWaalsContact O-CB 3.32Å; M86-H90 WeakPolarHBondContact O-CB 3.17Å; M86-H90 PolarHBondContact O-N 3.4Å; H90-D92 VanDerWaalsContact C-N 3.31Å; H90-D92 IonicContact CE1-OD1 2.86Å; H90-D92 IonicContact CE1-OD2 3.76Å; H90-D92 PolarHBondContact CE1-OD2 3.01Å; H90-D92 WeakPolarHBondContact ND1-CB 3.39Å; H90-D92 PolarHBondContact ND1-N 3.4Å; H90-D92 IonicContact ND1-OD1 2.66Å; H90-D92 IonicContact ND1-OD2 3.88Å; H90-D92 PolarHBondContact O-N 3.31Å; H90-R93 HydrophobicContact CB-CB 4.36Å; H90-R93 HydrophobicContact CB-CG 4.31Å; H90-R93 PolarHBondContact O-N 3.36Å; H90-G95 WeakPolarHBondContact O-CA 3.38Å; H90-G95 PolarHBondContact O-N 3.17Å
91	P	97	Very high	97	Very high	48 Å²	48	73 Å²	73	31%	0.312	39%	0.394	S	S	.	.	G	3₁₀ helix	trans	-58.4	-41.5	-178.9	21.7	-32.9	0	0	0	112.9	R93 G94 G95 P97	P91-R93 PolarHBondContact O-N 3.49Å; P91-G94 PolarHBondContact O-N 2.97Å; P91-G95 WeakPolarHBondContact CA-O 2.99Å; P91-P97 HydrophobicContact CB-CG 4.18Å
92	D	96.8	Very high	97	Very high	140 Å²	140	73 Å²	73	75%	0.749	39%	0.391	S	S	*	.	G	3₁₀ helix	trans	-64.1	-12.3	177.7	-51.9	-4.2	0	0	0	114.2	H90	H90-D92 VanDerWaalsContact C-N 3.31Å; H90-D92 IonicContact CE1-OD1 2.86Å; H90-D92 IonicContact CE1-OD2 3.76Å; H90-D92 PolarHBondContact CE1-OD2 3.01Å; H90-D92 WeakPolarHBondContact ND1-CB 3.39Å; H90-D92 PolarHBondContact ND1-N 3.4Å; H90-D92 IonicContact ND1-OD1 2.66Å; H90-D92 IonicContact ND1-OD2 3.88Å; H90-D92 PolarHBondContact O-N 3.31Å
93	R	95.8	Very high	97	Very high	175 Å²	175	71.5 Å²	71.5	66%	0.66	38%	0.384	S	S	*	.	G	3₁₀ helix	trans	-108.3	20	176.4	-61.7	-178	179.3	171.4	-2.4	112.2	V87 H90 P91	V87-R93 PolarHBondContact O-NH1 3.02Å; H90-R93 HydrophobicContact CB-CB 4.36Å; H90-R93 HydrophobicContact CB-CG 4.31Å; H90-R93 PolarHBondContact O-N 3.36Å; P91-R93 PolarHBondContact O-N 3.49Å
94	G	94.7	Very high	97	Very high	75 Å²	75	68 Å²	68	77%	0.773	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	83	10.2	-178.4	0	0	0	0	0	114.2	P91	P91-G94 PolarHBondContact O-N 2.97Å
95	G	96.1	Very high	97	Very high	17 Å²	17	65.9 Å²	65.9	18%	0.175	37%	0.368	C	S	.	.			trans	-72	161	171.8	0	0	0	0	0	112.6	N89 H90 P91 P97	N89-G95 WeakPolarHBondContact O-CA 3.45Å; H90-G95 WeakPolarHBondContact O-CA 3.38Å; H90-G95 PolarHBondContact O-N 3.17Å; P91-G95 WeakPolarHBondContact CA-O 2.99Å; G95-P97 WeakPolarHBondContact O-CD 3.43Å
96	S	97.6	Very high	97	Very high	54 Å²	54	63.9 Å²	63.9	38%	0.378	36%	0.357	S	S	.	.			trans	-77.9	126.4	176	168.9	0	0	0	0	110.7	Y98 I99 A100	S96-Y98 PolarHBondContact O-N 2.98Å; S96-Y98 PolarHBondContact OG-N 3.44Å; S96-I99 PolarHBondContact O-N 3.35Å; S96-I99 VanDerWaalsContact O-N 3.1Å; S96-I99 PolarHBondContact OG-N 3.49Å; S96-A100 PolarHBondContact O-N 3.38Å
97	P	97.4	Very high	97	Very high	92 Å²	92	64.9 Å²	64.9	60%	0.597	36%	0.361	S	S	*	.	H	α-helix	trans	-55	-35.4	173.5	-25.3	33.6	0	0	0	112.6	P91 G95 A101	P91-P97 HydrophobicContact CB-CG 4.18Å; G95-P97 WeakPolarHBondContact O-CD 3.43Å; P97-A101 WeakPolarHBondContact O-CB 3.41Å; P97-A101 PolarHBondContact O-N 2.96Å
98	Y	96.8	Very high	96.9	Very high	130 Å²	130	65.8 Å²	65.8	51%	0.51	36%	0.363	S	S	.	.	H	α-helix	trans	-67.4	-42.8	178.6	-178.9	-114.7	0	0	0	112.2	F54 S96 A101 K102	F54-Y98 AromaticContact CD2-CE1 3.6Å; F54-Y98 HydrophobicContact CD2-CE1 3.6Å; F54-Y98 AromaticContact CD2-CZ 3.96Å; F54-Y98 HydrophobicContact CE2-CD1 4.44Å; F54-Y98 AromaticContact CE2-CE1 3.83Å; F54-Y98 HydrophobicContact CE2-CE1 3.83Å; S96-Y98 PolarHBondContact O-N 2.98Å; S96-Y98 PolarHBondContact OG-N 3.44Å; Y98-A101 PolarHBondContact O-N 2.93Å; Y98-K102 HydrophobicContact CE2-CG 4.46Å; Y98-K102 WeakPolarHBondContact O-CG 3.34Å; Y98-K102 PolarHBondContact O-N 3.44Å
99	I	96.8	Very high	96.9	Very high	53 Å²	53	61.5 Å²	61.5	27%	0.272	34%	0.341	S	S	.	.	H	α-helix	trans	-67.5	-43	177	-61.2	-61.1	0	0	0	110.7	F54 N89 S96 A101 K102 I103	F54-I99 HydrophobicContact CE2-CD1 3.75Å; F54-I99 HydrophobicContact CZ-CD1 3.91Å; N89-I99 HydrophobicContact CB-CG2 4.25Å; S96-I99 PolarHBondContact O-N 3.35Å; S96-I99 VanDerWaalsContact O-N 3.1Å; S96-I99 PolarHBondContact OG-N 3.49Å; I99-A101 VanDerWaalsContact C-N 3.31Å; I99-A101 PolarHBondContact O-N 2.92Å; I99-K102 PolarHBondContact O-N 3.5Å; I99-I103 HydrophobicContact CG2-CD1 3.88Å; I99-I103 WeakPolarHBondContact O-CG1 3.47Å; I99-I103 PolarHBondContact O-N 2.98Å
100	A	97.9	Very high	96.7	Very high	6 Å²	6	59.5 Å²	59.5	5%	0.05	33%	0.33	C	S	.	.	H	α-helix	trans	-59.2	-42.6	175	0	0	0	0	0	111.6	M86 S96 K102 I103 N104	M86-A100 HydrophobicContact CE-CB 4.28Å; M86-A100 HydrophobicContact SD-CB 4.09Å; S96-A100 PolarHBondContact O-N 3.38Å; A100-K102 PolarHBondContact O-N 2.97Å; A100-I103 PolarHBondContact O-N 3.45Å; A100-N104 PolarHBondContact O-N 2.96Å; A100-N104 PolarHBondContact O-ND2 2.72Å
101	A	97.3	Very high	96.5	Very high	53 Å²	53	57 Å²	57	44%	0.438	32%	0.319	S	S	.	.	H	α-helix	trans	-60.3	-43.8	174.5	0	0	0	0	0	112	P97 Y98 I99 I103 N104 E105	P97-A101 WeakPolarHBondContact O-CB 3.41Å; P97-A101 PolarHBondContact O-N 2.96Å; Y98-A101 PolarHBondContact O-N 2.93Å; I99-A101 VanDerWaalsContact C-N 3.31Å; I99-A101 PolarHBondContact O-N 2.92Å; A101-I103 PolarHBondContact O-N 2.95Å; A101-N104 PolarHBondContact O-N 3.47Å; A101-E105 WeakPolarHBondContact O-CB 3.27Å; A101-E105 PolarHBondContact O-N 3.36Å
102	K	97.8	Very high	95.9	Very high	16 Å²	16	56.4 Å²	56.4	7%	0.07	32%	0.321	C	S	.	.	H	α-helix	trans	-65.1	-37.3	177	-74.2	-73.1	170.6	-166.8	0	113.2	F54 M58 Y98 I99 A100 N104 E105 A106	F54-K102 HydrophobicContact CB-CD 4.1Å; F54-K102 HydrophobicContact CD1-CB 4.48Å; F54-K102 HydrophobicContact CD1-CD 3.93Å; F54-K102 HydrophobicContact CD1-CG 4.16Å; F54-K102 HydrophobicContact CD2-CD 4.17Å; F54-K102 HydrophobicContact CD2-CG 3.93Å; F54-K102 HydrophobicContact CE1-CB 4.13Å; F54-K102 HydrophobicContact CE1-CD 4.41Å; F54-K102 HydrophobicContact CE1-CG 4.2Å; F54-K102 HydrophobicContact CE2-CB 4.44Å; F54-K102 HydrophobicContact CE2-CG 3.96Å; F54-K102 HydrophobicContact CG-CD 3.79Å; F54-K102 HydrophobicContact CG-CG 4.03Å; F54-K102 HydrophobicContact CZ-CB 4.1Å; F54-K102 HydrophobicContact CZ-CG 4.1Å; M58-K102 HydrophobicContact CE-CD 3.78Å; Y98-K102 HydrophobicContact CE2-CG 4.46Å; Y98-K102 WeakPolarHBondContact O-CG 3.34Å; Y98-K102 PolarHBondContact O-N 3.44Å; I99-K102 PolarHBondContact O-N 3.5Å; A100-K102 PolarHBondContact O-N 2.97Å; K102-N104 VanDerWaalsContact C-N 3.34Å; K102-E105 WeakPolarHBondContact CD-OE2 3.34Å; K102-E105 IonicContact NZ-OE2 2.72Å; K102-E105 PolarHBondContact NZ-OE2 3.45Å; K102-E105 PolarHBondContact O-N 3.39Å; K102-A106 WeakPolarHBondContact O-CB 3.4Å; K102-A106 PolarHBondContact O-N 3.2Å
103	I	98.1	Very high	95	Very high	6 Å²	6	52.6 Å²	52.6	3%	0.031	30%	0.298	C	S	.	.	H	α-helix	trans	-63.6	-40.8	173.5	-69.3	161.6	0	0	0	111	I66 L85 M86 N89 I99 A100 A101 K107	I66-I103 HydrophobicContact CG2-CG1 4.09Å; L85-I103 HydrophobicContact CB-CD1 4.08Å; L85-I103 HydrophobicContact CB-CG1 4.46Å; L85-I103 HydrophobicContact CB-CG2 4.08Å; M86-I103 HydrophobicContact CE-CB 4.27Å; M86-I103 HydrophobicContact CE-CG2 3.97Å; N89-I103 HydrophobicContact CB-CD1 3.71Å; I99-I103 HydrophobicContact CG2-CD1 3.88Å; I99-I103 WeakPolarHBondContact O-CG1 3.47Å; I99-I103 PolarHBondContact O-N 2.98Å; A100-I103 PolarHBondContact O-N 3.45Å; A101-I103 PolarHBondContact O-N 2.95Å; I103-K107 PolarHBondContact O-N 2.91Å; I103-K107 VanDerWaalsContact O-N 3.11Å
104	N	97.6	Very high	93.8	Very high	64 Å²	64	45 Å²	45	34%	0.342	27%	0.274	S	S	.	.	H	α-helix	trans	-66.5	-46.8	176.1	-72.1	-28.8	0	0	0	111.9	H82 M86 A100 A101 K102 A106 K107 D108	H82-N104 PolarHBondContact NE2-OD1 3.42Å; M86-N104 WeakPolarHBondContact CE-OD1 3.43Å; A100-N104 PolarHBondContact O-N 2.96Å; A100-N104 PolarHBondContact O-ND2 2.72Å; A101-N104 PolarHBondContact O-N 3.47Å; K102-N104 VanDerWaalsContact C-N 3.34Å; N104-A106 VanDerWaalsContact C-N 3.3Å; N104-A106 PolarHBondContact O-N 3.43Å; N104-K107 PolarHBondContact O-N 3.34Å; N104-K107 VanDerWaalsContact O-N 3.15Å; N104-D108 PolarHBondContact O-N 3.22Å
105	E	97.5	Very high	92.5	Very high	73 Å²	73	49.2 Å²	49.2	34%	0.341	27%	0.266	S	S	.	.	H	α-helix	trans	-57.4	-43.1	177.2	-169.9	-176.9	-173.8	0	0	111.3	M58 A101 K102 D108 L109	M58-E105 VanDerWaalsContact CB-CD 3.45Å; M58-E105 HydrophobicContact CB-CG 3.66Å; M58-E105 WeakPolarHBondContact CB-OE1 3.43Å; M58-E105 HydrophobicContact CE-CB 3.96Å; M58-E105 HydrophobicContact CE-CG 3.95Å; M58-E105 WeakPolarHBondContact CE-OE2 3.4Å; M58-E105 HydrophobicContact CG-CG 3.98Å; A101-E105 WeakPolarHBondContact O-CB 3.27Å; A101-E105 PolarHBondContact O-N 3.36Å; K102-E105 WeakPolarHBondContact CD-OE2 3.34Å; K102-E105 IonicContact NZ-OE2 2.72Å; K102-E105 PolarHBondContact NZ-OE2 3.45Å; K102-E105 PolarHBondContact O-N 3.39Å; E105-D108 PolarHBondContact O-N 3.02Å; E105-L109 PolarHBondContact O-N 3.33Å; E105-L109 VanDerWaalsContact O-N 3.1Å
106	A	97.8	Very high	91	Very high	0 Å²	0	57.4 Å²	57.4	0%	0	30%	0.297	C	S	.	.	H	α-helix	trans	-62	-45.5	175.8	0	0	0	0	0	112.6	M58 A63 I66 L67 K102 N104 M110	M58-A106 HydrophobicContact CE-CB 4.34Å; M58-A106 HydrophobicContact SD-CB 4.25Å; A63-A106 HydrophobicContact CB-CB 3.83Å; I66-A106 HydrophobicContact CB-CB 4.09Å; I66-A106 HydrophobicContact CD1-CB 4.25Å; I66-A106 HydrophobicContact CG2-CB 3.95Å; L67-A106 HydrophobicContact CD1-CB 4.37Å; L67-A106 HydrophobicContact CD2-CB 4.45Å; L67-A106 HydrophobicContact CG-CB 4.07Å; K102-A106 WeakPolarHBondContact O-CB 3.4Å; K102-A106 PolarHBondContact O-N 3.2Å; N104-A106 VanDerWaalsContact C-N 3.3Å; N104-A106 PolarHBondContact O-N 3.43Å; A106-M110 WeakPolarHBondContact O-CB 3.41Å; A106-M110 VanDerWaalsContact O-CG 3.27Å; A106-M110 WeakPolarHBondContact O-CG 3.49Å; A106-M110 PolarHBondContact O-N 2.99Å; A106-M110 VanDerWaalsContact O-N 3.11Å
107	K	96.8	Very high	89.1	Confident	47 Å²	47	60.9 Å²	60.9	20%	0.204	31%	0.307	C	S	.	.	H	α-helix	trans	-60.8	-47.6	177.2	173.2	-80.4	-167.9	-161.8	0	110.7	I78 H82 I103 N104 L109 M110 D111	I78-K107 HydrophobicContact CG2-CG 4.47Å; H82-K107 HydrophobicContact CB-CB 4.13Å; H82-K107 HydrophobicContact CB-CG 3.93Å; I103-K107 PolarHBondContact O-N 2.91Å; I103-K107 VanDerWaalsContact O-N 3.11Å; N104-K107 PolarHBondContact O-N 3.34Å; N104-K107 VanDerWaalsContact O-N 3.15Å; K107-L109 PolarHBondContact O-N 3.34Å; K107-M110 PolarHBondContact O-N 3.12Å; K107-D111 WeakPolarHBondContact CE-OD2 3.31Å; K107-D111 IonicContact NZ-OD2 3.61Å; K107-D111 PolarHBondContact NZ-OD2 3.35Å; K107-D111 WeakPolarHBondContact O-CB 3.49Å; K107-D111 PolarHBondContact O-N 2.97Å
108	D	96.1	Very high	86.9	Confident	94 Å²	94	63 Å²	63	50%	0.503	32%	0.324	S	S	.	.	H	α-helix	trans	-67.2	-37.7	-174.1	-72.1	-26.2	0	0	0	112	N104 E105 G112	N104-D108 PolarHBondContact O-N 3.22Å; E105-D108 PolarHBondContact O-N 3.02Å; D108-G112 PolarHBondContact O-N 3.38Å; D108-G112 VanDerWaalsContact O-N 3.07Å
109	L	95.5	Very high	86.4	Confident	43 Å²	43	59.7 Å²	59.7	23%	0.225	32%	0.315	C	S	.	.	H	α-helix	trans	-61.8	-48.9	172.4	-171.8	155.1	0	0	0	111.2	M58 K60 A63 E105 K107 G112 Q113	M58-L109 HydrophobicContact CB-CD1 4.13Å; M58-L109 HydrophobicContact CG-CB 4.42Å; M58-L109 HydrophobicContact CG-CD1 3.78Å; M58-L109 WeakPolarHBondContact O-CD1 3.48Å; K60-L109 HydrophobicContact CB-CD2 4.22Å; A63-L109 HydrophobicContact CB-CD2 4.25Å; E105-L109 PolarHBondContact O-N 3.33Å; E105-L109 VanDerWaalsContact O-N 3.1Å; K107-L109 PolarHBondContact O-N 3.34Å; L109-G112 PolarHBondContact O-N 2.93Å; L109-Q113 HydrophobicContact CD2-CG 4.25Å; L109-Q113 WeakPolarHBondContact O-CG 3.49Å; L109-Q113 PolarHBondContact O-N 3.42Å; L109-Q113 VanDerWaalsContact O-N 3.09Å
110	M	93.8	Very high	85.8	Confident	5 Å²	5	60 Å²	60	3%	0.025	32%	0.317	C	S	.	.	H	α-helix	trans	-68	-39.3	-176.3	-70.6	-67.7	-75.3	0	0	112.4	K60 A63 A64 L67 V69 I78 A106 K107 G112 Q113 A114	K60-M110 HydrophobicContact CG-SD 4.11Å; A63-M110 HydrophobicContact CB-CG 3.72Å; A63-M110 HydrophobicContact CB-SD 4.21Å; A64-M110 HydrophobicContact CB-CE 4.23Å; L67-M110 HydrophobicContact CD1-CB 4.35Å; L67-M110 HydrophobicContact CD1-CG 4.11Å; V69-M110 HydrophobicContact CG2-CE 4.11Å; I78-M110 HydrophobicContact CD1-CB 3.88Å; I78-M110 HydrophobicContact CD1-CE 4.4Å; I78-M110 HydrophobicContact CG1-CB 4.25Å; I78-M110 HydrophobicContact CG2-CB 4.04Å; A106-M110 WeakPolarHBondContact O-CB 3.41Å; A106-M110 VanDerWaalsContact O-CG 3.27Å; A106-M110 WeakPolarHBondContact O-CG 3.49Å; A106-M110 PolarHBondContact O-N 2.99Å; A106-M110 VanDerWaalsContact O-N 3.11Å; K107-M110 PolarHBondContact O-N 3.12Å; M110-G112 VanDerWaalsContact C-N 3.35Å; M110-G112 PolarHBondContact O-N 3.45Å; M110-Q113 PolarHBondContact O-N 3.49Å; M110-A114 WeakPolarHBondContact O-CB 3.47Å; M110-A114 PolarHBondContact O-N 3.31Å
111	D	90.7	Very high	85.2	Confident	7 Å²	7	63 Å²	63	4%	0.037	33%	0.332	C	S	.	.	H	α-helix	trans	-62.3	-41.1	173.4	-94.5	-11.1	0	0	0	111.8	K107 Q113 A114 R115	K107-D111 WeakPolarHBondContact CE-OD2 3.31Å; K107-D111 IonicContact NZ-OD2 3.61Å; K107-D111 PolarHBondContact NZ-OD2 3.35Å; K107-D111 WeakPolarHBondContact O-CB 3.49Å; K107-D111 PolarHBondContact O-N 2.97Å; D111-Q113 VanDerWaalsContact C-N 3.32Å; D111-Q113 PolarHBondContact O-N 2.94Å; D111-A114 PolarHBondContact O-N 3.47Å; D111-R115 WeakPolarHBondContact O-CG 3.3Å; D111-R115 PolarHBondContact O-N 3.14Å
112	G	84.6	Confident	84.4	Confident	35 Å²	35	63.6 Å²	63.6	36%	0.361	33%	0.326	S	S	.	.	H	α-helix	trans	-63.5	-37.1	176.7	0	0	0	0	0	112.7	D108 L109 M110	D108-G112 PolarHBondContact O-N 3.38Å; D108-G112 VanDerWaalsContact O-N 3.07Å; L109-G112 PolarHBondContact O-N 2.93Å; M110-G112 VanDerWaalsContact C-N 3.35Å; M110-G112 PolarHBondContact O-N 3.45Å
113	Q	77.9	Confident	83.6	Confident	59 Å²	59	66.6 Å²	66.6	28%	0.276	34%	0.342	S	S	.	.	H	α-helix	trans	-75.6	-38.9	176.9	-67.8	-158.3	5	0	0	113.4	K60 L109 M110 D111 R115 K116 Q117	K60-Q113 VanDerWaalsContact CG-OE1 3.29Å; L109-Q113 HydrophobicContact CD2-CG 4.25Å; L109-Q113 WeakPolarHBondContact O-CG 3.49Å; L109-Q113 PolarHBondContact O-N 3.42Å; L109-Q113 VanDerWaalsContact O-N 3.09Å; M110-Q113 PolarHBondContact O-N 3.49Å; D111-Q113 VanDerWaalsContact C-N 3.32Å; D111-Q113 PolarHBondContact O-N 2.94Å; Q113-R115 PolarHBondContact O-N 2.98Å; Q113-R115 VanDerWaalsContact O-N 3.15Å; Q113-K116 PolarHBondContact O-N 2.93Å; Q113-Q117 PolarHBondContact O-N 3.06Å
114	A	70.6	Confident	82.6	Confident	17 Å²	17	70.6 Å²	70.6	14%	0.14	36%	0.362	C	S	.	.	H	α-helix	trans	-64.7	-16.8	176.6	0	0	0	0	0	113	K75 I78 M110 D111	K75-A114 HydrophobicContact CD-CB 4.36Å; K75-A114 VanDerWaalsContact CE-C 3.46Å; K75-A114 VanDerWaalsContact CE-O 3.26Å; K75-A114 WeakPolarHBondContact CE-O 3.24Å; K75-A114 HydrophobicContact CG-CB 3.57Å; I78-A114 HydrophobicContact CD1-CB 4.29Å; M110-A114 WeakPolarHBondContact O-CB 3.47Å; M110-A114 PolarHBondContact O-N 3.31Å; D111-A114 PolarHBondContact O-N 3.47Å
115	R	68.8	Low	81.6	Confident	163 Å²	163	71.1 Å²	71.1	62%	0.615	36%	0.364	S	S	*	.	H	α-helix	trans	-80.1	-26.5	170.1	-69.4	174.4	-171.1	-166.9	2	113.7	D111 Q113 Q117 S118	D111-R115 WeakPolarHBondContact O-CG 3.3Å; D111-R115 PolarHBondContact O-N 3.14Å; Q113-R115 PolarHBondContact O-N 2.98Å; Q113-R115 VanDerWaalsContact O-N 3.15Å; R115-Q117 VanDerWaalsContact C-N 3.35Å; R115-S118 PolarHBondContact O-OG 3.27Å
116	K	63.3	Low	80.4	Confident	189 Å²	189	70.9 Å²	70.9	82%	0.822	37%	0.366	S	S	*	.	H	α-helix	trans	-82.7	-14.1	179.4	-70.4	-174.2	177.2	-175	0	113.4	Q113	Q113-K116 PolarHBondContact O-N 2.93Å
117	Q	57.6	Low	78.9	Confident	127 Å²	127	76.8 Å²	76.8	59%	0.593	40%	0.396	S	S	*	.			trans	-104.3	-1.2	-176.7	-64.3	-174.6	-22.9	0	0	113.3	Q113 R115	Q113-Q117 PolarHBondContact O-N 3.06Å; R115-Q117 VanDerWaalsContact C-N 3.35Å
118	S	51.3	Low	77.3	Confident	136 Å²	136	79.5 Å²	79.5	95%	0.951	41%	0.413	S	S	*	.			trans	-106.4	0	173	65.2	0	0	0	0	109.8	R115	R115-S118 PolarHBondContact O-OG 3.27Å

Retrieved 118 of 118 residues in 156.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).